diff --git a/README.md b/README.md index 37c037f..526d793 100644 --- a/README.md +++ b/README.md @@ -1,7 +1,9 @@ -##DJI Onboard SDK ROS Packages +#DJI Onboard SDK ROS Packages ---- +##Introduction + This is a ROS package for DJI OnBoard SDK. It helps users handle the following commands and actions. @@ -12,41 +14,91 @@ It helps users handle the following commands and actions. * The take off procedure * The landing procedure * The go home procedure -* Example for the gimbal control -* Example for the attitude control +* The Gimbal control +* The attitude control * The photo taking procedure * The start/stop video recording procedure * Local navigation (fly into a certain (X,Y,Z)) * GPS navigation (fly into a certain GPS coordinate) * Waypoint navigation (fly through a series of GPS coordinates) * Using WebSocket together with Baidu Map for navigation -* Using MAVLink protocol and QGroundStation (TODO) - -We also provides a ROS package +* Using MAVLink protocol and QGroundStation -###How to use +##How to use 1. Install and configure your hardware correctly. -2. Enter the following info into *dji_sdk/launch/sdk_manifold.launch*. +2. Enter the following info into `dji_sdk/launch/sdk_manifold.launch`. * APP ID * APP Level * Communication Key - * uart device name - * baudrate + * Uart Device Name + * Baudrate 3. Use `roslaunch dji_sdk sdk_manifold.launch` to start the core node. 4. Include the `dji_drone.h` from `dji_sdk/include/dji_sdk` into your package and run it. (there also provides a python version `dji_drone.py` in `dji_sdk/src/dji_sdk`) -###System Structure +##System Structure * [dji_sdk](dji_sdk): the core package handling the communication with Matrice 100, which provides a header file `dji_drone.h` for future use * [dji_sdk_demo](dji_sdk_demo): an example package of using `dji_drone.h` to control the Matrice 100 * [dji_sdk_web_groundstation](dji_sdk_web_groundstation): a WebSocket example using ROS-bridge-suite, where a webpage groundstatino is provided -* [dji_sdk_manifold_read_cam](dji_sdk_manifold_read_cam): a specifed X3 video reading package for Manifold, video stream will be published out in RGB, CATKIN_IGNOREd by defualt -* [dji_sdk_manifold_read_cam_nv](dji_sdk_manifold_read_cam_nv): same as the previous one, but use hardware decoding method and in Grayscale, CATKIN_IGNOREd by defualt +* [dji_sdk_manifold_read_cam](dji_sdk_manifold_read_cam): a X3 video decoding package for Manifold, CATKIN_IGNOREd by defualt +* [dji_sdk_dji2mav](dji_sdk_dji2mav): a protocol converter making M100 compatiable with all MAVLink-protocol-dependent softwares * [dji_sdk_doc](dji_sdk_doc): all documents ![image](dji_sdk_doc/structure.jpg) +[click to see fullsize image](https://raw.githubusercontent.com/dji-sdk/Onboard-SDK-ROS/2.3/dji_sdk_doc/structure.jpg) -###System Environment +##System Environment The below environment has been tested. * Operating System: Ubuntu 14.04, Manifold * ROS version: ROS Indigo + +--- + +#DJI Onboard SDK ROS例程 + +##简介 + +此ROS例程实现了以下功能： + +* 激活 Matrice100 （以下简称M100） +* 获取 M100 控制权 +* 释放 M100 控制权 +* 向 M100 发送起飞指令 +* 向 M100 发送降落指令 +* 向 M100 发送返航指令 +* 对 M100 进行姿态控制 +* 对 M100 进行云台角度控制 +* 向 M100 发送相机控制指令 +* 控制 M100 进行 (x,y,z) 坐标导航 +* 控制 M100 进行 GPS 坐标导航 +* 控制 M100 进行航点飞行任务 +* 通过 WebSocket 向 M100 发送网页地图生成的航点指令 +* 通过 MAVLink 和 QGroundControl 控制 M100 + +##如何使用 + +1. 按照文档配置好 M100 +2. 将激活信息输入至launch file：`dji_sdk/launch/sdk_manifold.launch` + * APP ID （在官网注册key后得到） + * API Level （key对应的 API 权限等级） + * Communication Key（在官网注册key后得到） + * Uart Device Name（串口设备名称） + * Baudrate（比特率） +3. 运行 `roslaunch dji_sdk sdk_manifold.launch` 来启动核心包。 +4. 将 `dji_sdk/include/dji_sdk` 下的客户端头文件`dji_drone.h` 引用到你自己的 ROS 包中，并运行它（我们也提供了python版本的客户端`dji_drone.py`） + +##系统架构 +* [dji_sdk](dji_sdk): 核心 ROS 包，处理所有与 M100 的串口通信并提供了 `dji_drone.h`的头文件供开发者引用。 +* [dji_sdk_demo](dji_sdk_demo): 一个调用 `dji_drone.h` 控制 M100 的例子。 +* [dji_sdk_web_groundstation](dji_sdk_web_groundstation): 基于 WebSocket 的网页版地面站，依赖 ROS-bridge-suite 。 +* [dji_sdk_manifold_read_cam](dji_sdk_manifold_read_cam): Manifold专用 ROS 包，对禅思 X3 云台的视频信息进行解码输出视频流。默认通过`CATKIN_IGNORE`禁用，需要手动启用。 +* [dji_sdk_dji2mav](dji_sdk_dji2mav): MAVLink 协议转接器，使得 M100 可以支持任意使用 MAVLink 为协议的地面站软件。 +* [dji_sdk_doc](dji_sdk_doc): 所有的文档与图片信息。 + +![image](dji_sdk_doc/structure.jpg) +[点击查看大图](https://raw.githubusercontent.com/dji-sdk/Onboard-SDK-ROS/2.3/dji_sdk_doc/structure.jpg) + +#系统环境 +此 ROS 包在如下系统中进行测试； +* 操作系统：Ubuntu 14.04， DJI Manifold +* ROS 版本：ROS Indigo diff --git a/dji_sdk_manifold_read_cam/CMakeLists.txt b/dji_sdk_manifold_read_cam/CMakeLists.txt index a611c40..4dd8730 100644 --- a/dji_sdk_manifold_read_cam/CMakeLists.txt +++ b/dji_sdk_manifold_read_cam/CMakeLists.txt @@ -3,215 +3,27 @@ project(dji_sdk_read_cam) ## Find catkin macros and libraries ## if COMPONENTS list like find_package(catkin REQUIRED COMPONENTS xyz) + ## is used, also find other catkin packages +catkin_package() find_package(catkin REQUIRED COMPONENTS cv_bridge + image_transport + #opencv2 roscpp - rospy sensor_msgs std_msgs - image_transport -) - -## System dependencies are found with CMake's conventions -# find_package(Boost REQUIRED COMPONENTS system) - -find_package(OpenCV REQUIRED) - - -## Uncomment this if the package has a setup.py. This macro ensures -## modules and global scripts declared therein get installed -## See http://ros.org/doc/api/catkin/html/user_guide/setup_dot_py.html -# catkin_python_setup() - -################################################ -## Declare ROS messages, services and actions ## -################################################ - -## To decbavformatlare and build messages, services or actions from within this -## package, follow these steps: -## * Let MSG_DEP_SET be the set of packages whose message types you use in -## your messages/services/actions (e.g. std_msgs, actionlib_msgs, ...). -## * In the file package.xml: -## * add a build_depend and a run_depend tag for each package in MSG_DEP_SET -## * If MSG_DEP_SET isn't empty the following dependencies might have been -## pulled in transitively but can be declared for certainty nonetheless: -## * add a build_depend tag for "message_generation" -## * add a run_depend tag for "message_runtime" -## * In this file (CMakeLists.txt): -## * add "message_generation" and every package in MSG_DEP_SET to -## find_package(catkin REQUIRED COMPONENTS ...) -## * add "message_runtime" and every package in MSG_DEP_SET to -## catkin_package(CATKIN_DEPENDS ...) -## * uncomment the add_*_files sections below as needed -## and list every .msg/.srv/.action file to be processed -## * uncomment the generate_messages entry below -## * add every package in MSG_DEP_SET to generate_messages(DEPENDENCIES ...) - -## Generate messages in the 'msg' folder -# add_message_files( -# FILES -# Message1.msg -# Message2.msg -# ) - -## Generate services in the 'srv' folder -# add_service_files( -# FILES -# Service1.srv -# Service2.srv -# ) - -## Generate actions in the 'action' folder -# add_action_files( -# FILES -# Action1.action -# Action2.action -# ) - -## Generate added messages and services with any dependencies listed here -# generate_messages( -# DEPENDENCIES -# sensor_msgs# std_msgs -# ) - -################################### -## catkin specific configuration ## -################################### -## The catkin_package macro generates cmake config files for your package -## Declare things to be passed to dependent projects -## INCLUDE_DIRS: uncomment this if you package contains header files -## LIBRARIES: libraries you create in this project that dependent projects also need -## CATKIN_DEPENDS: catkin_packages dependent projects also need -## DEPENDS: system dependencies of this project that dependent projects also need -catkin_package( -# INCLUDE_DIRS include -# LIBRARIES read_cam -# CATKIN_DEPENDS cv_bridge roscpp rospy sensor_msgs std_msgs -# DEPENDS system_lib ) -########### -## Build ## -########### - -## Specify additional locations of header files -## Your package locations should be listed before other locations -# include_directories(include) -include_directories(include ${OpenCV_INCLUDE_DIRS}) include_directories( - include -# /usr/local/include - + include ${catkin_INCLUDE_DIRS} - # ${/usr/local/include} ) +add_executable(dji_sdk_read_cam src/nv_cam.cpp) +link_directories(/usr/local/lib /usr/lib/arm-linux-gnueabihf /usr/lib) +target_link_libraries( + dji_sdk_read_cam + dcam + ${catkin_LIBRARIES}) -## Declare a cpp library -# add_library(read_cam -# src/${PROJECT_NAME}/read_cam.cpp -# ) - - - -## Declare a cpp executable -add_executable(dji_sdk_read_cam src/CamMain.cpp src/djiCam.c src/usbHost.c include/libusb-gadget/src/usb-gadget.c include/libusb-gadget/src/usbstring.c) - -## Add cmake target dependencies of the executable/library -## as an example, message headers may need to be generated before nodes -# add_dependencies(read_cam_node read_cam_generate_messages_cpp) - -## Specify libraries to link a library or executable target against - -##target_link_libraries(${PROJECT_NAME} ${LIBAVFORMAT_LIBRARY} ${LIBAVCODEC_LIBRARY} ${LIBAVUTIL_LIBRARY} ${catkin_LIBRARIES}) -link_directories(/usr/local/lib /usr/lib/arm-linux-gnueabihf) -target_link_libraries(dji_sdk_read_cam - pthread - avdevice - avfilter - usb-1.0 - avformat - avcodec - xcb-shm - xcb-xfixes - xcb-render - xcb-shape - xcb - X11 - dl - vpx - vorbisenc - vorbis - theoraenc - theoradec - ogg - rtmp - gnutls - opencore-amrwb - opencore-amrnb - mp3lame - faac - bz2 - z - swresample - swscale - avutil - m - SDLmain - SDL - jpeg - x264 - - ${catkin_LIBRARIES} - ${OpenCV_LIBRARIES} -) -add_dependencies(dji_sdk_read_cam dji_sdk_read_cam_gencpp) - -############# -## Install ## -############# - -# all install targets should use catkin DESTINATION variables -# See http://ros.org/doc/api/catkin/html/adv_user_guide/variables.html - -## Mark executable scripts (Python etc.) for installation -## in contrast to setup.py, you can choose the destination -# install(PROGRAMS -# scripts/my_python_script -# DESTINATION ${CATKIN_PACKAGE_BIN_DESTINATION} -# ) - -## Mark executables and/or libraries for installation -# install(TARGETS read_cam read_cam_node -# ARCHIVE DESTINATION ${CATKIN_PACKAGE_LIB_DESTINATION} -# LIBRARY DESTINATION ${CATKIN_PACKAGE_LIB_DESTINATION} -# RUNTIME DESTINATION ${CATKIN_PACKAGE_BIN_DESTINATION} -# ) - -## Mark cpp header files for installation -# install(DIRECTORY include/${PROJECT_NAME}/ -# DESTINATION ${CATKIN_PACKAGE_INCLUDE_DESTINATION} -# FILES_MATCHING PATTERN "*.h" -# PATTERN ".svn" EXCLUDE -# ) - -## Mark other files for installation (e.g. launch and bag files, etc.) -# install(FILES -# # myfile1 -# # myfile2 -# DESTINATION ${CATKIN_PACKAGE_SHARE_DESTINATION} -# ) - -############# -## Testing ## -############# - -## Add gtest based cpp test target and link libraries -# catkin_add_gtest(${PROJECT_NAME}-test test/test_read_cam.cpp) -# if(TARGET ${PROJECT_NAME}-test) -# target_link_libraries(${PROJECT_NAME}-test ${PROJECT_NAME}) -# endif() - -## Add folders to be run by python nosetests -# catkin_add_nosetests(test) diff --git a/dji_sdk_manifold_read_cam/README.md b/dji_sdk_manifold_read_cam/README.md index 2f7661a..55f326c 100644 --- a/dji_sdk_manifold_read_cam/README.md +++ b/dji_sdk_manifold_read_cam/README.md @@ -1,19 +1,26 @@ ##DJI Onboard SDK ROS Package for Video Decoding on Manifold -This package is a specified video decoding package for Manifold. +This video-decoding package is a specifically desiged package for Manifold to read the X3 video stream. ###How to use -1. Install the necessary library: it should be already there, try to run the project in the `demo` folder of your Manifold home directory. If not, please run the `install_lib.sh` +1. Install the necessary library: refer [here](https://github.com/dji-sdk/manifold_cam) 2. Delete the `CATKIN_IGNORE` file inside package and `catkin_make`. -3. `rosrun dji_sdk_manifold_read_cam dji_sdk_manifold_read_cam` +3. `sudo -s` first, then `rosrun dji_sdk_read_cam dji_sdk_read_cam` 4. The image will be published into topic `/dji_sdk/image_raw` ###Note: 1. This package is specially designed for Manifold. 2. The RC controller must be connected to Matrice 100 in order to get the video stream. +3. The DJI Go has a power-saving strategy, users should either enter the camera view or do not run DJI GO at first in order to get the video stream. The video will be freezed if uses stay in the main screen of DJI GO. 3. This package does not provice video transparent transmission. You cannot see the video on DJI Go while running this package. -4. This package uses FFMPENG for video decoding. while the _nv one uses hardware decoding method. -5. The image format is RGB, while the _nv one publishes Grayscale image. -![image](../dji_sdk_doc/readcam_nv.png) \ No newline at end of file + +The default video stream is in RGB format. +![image](../dji_sdk_doc/readcam_nv.png) + +Comment the `#define RGB` in `nv_cam.cpp` if you prefer the grayscale. +![image](../dji_sdk_doc/readcam.png) + + +Note: frame size is 640x480, no matter RGB or Grayscale diff --git a/dji_sdk_manifold_read_cam/include/_mingw.h b/dji_sdk_manifold_read_cam/include/_mingw.h deleted file mode 100644 index a89bdf8..0000000 --- a/dji_sdk_manifold_read_cam/include/_mingw.h +++ /dev/null @@ -1,288 +0,0 @@ -#ifndef __MINGW_H -/* - * _mingw.h - * - * Mingw specific macros included by ALL include files. - * - * This file is part of the Mingw32 package. - * - * Contributors: - * Created by Mumit Khan - * - * THIS SOFTWARE IS NOT COPYRIGHTED - * - * This source code is offered for use in the public domain. You may - * use, modify or distribute it freely. - * - * This code is distributed in the hope that it will be useful but - * WITHOUT ANY WARRANTY. ALL WARRANTIES, EXPRESS OR IMPLIED ARE HEREBY - * DISCLAIMED. This includes but is not limited to warranties of - * MERCHANTABILITY or FITNESS FOR A PARTICULAR PURPOSE. - * - */ -#define __MINGW_H - -#define __MINGW32_VERSION 3.20 -#define __MINGW32_MAJOR_VERSION 3 -#define __MINGW32_MINOR_VERSION 20 -#define __MINGW32_PATCHLEVEL 0 - -#if __GNUC__ >= 3 -#ifndef __PCC__ -#pragma GCC system_header -#endif -#endif - -/* These are defined by the user (or the compiler) - to specify how identifiers are imported from a DLL. - - __DECLSPEC_SUPPORTED Defined if dllimport attribute is supported. - __MINGW_IMPORT The attribute definition to specify imported - variables/functions. - _CRTIMP As above. For MS compatibility. - __MINGW32_VERSION Runtime version. - __MINGW32_MAJOR_VERSION Runtime major version. - __MINGW32_MINOR_VERSION Runtime minor version. - __MINGW32_BUILD_DATE Runtime build date. - - Macros to enable MinGW features which deviate from standard MSVC - compatible behaviour; these may be specified directly in user code, - activated implicitly, (e.g. by specifying _POSIX_C_SOURCE or such), - or by inclusion in __MINGW_FEATURES__: - - __USE_MINGW_ANSI_STDIO Select a more ANSI C99 compatible - implementation of printf() and friends. - - Other macros: - - __int64 define to be long long. Using a typedef - doesn't work for "unsigned __int64" - - All headers should include this first, and then use __DECLSPEC_SUPPORTED - to choose between the old ``__imp__name'' style or __MINGW_IMPORT - style declarations. */ - - -/* Manifest definitions identifying the flag bits, controlling activation - * of MinGW features, as specified by the user in __MINGW_FEATURES__. - */ -#define __MINGW_ANSI_STDIO__ 0x0000000000000001ULL -/* - * The following three are not yet formally supported; they are - * included here, to document anticipated future usage. - */ -#define __MINGW_LC_EXTENSIONS__ 0x0000000000000050ULL -#define __MINGW_LC_MESSAGES__ 0x0000000000000010ULL -#define __MINGW_LC_ENVVARS__ 0x0000000000000040ULL - -/* Try to avoid problems with outdated checks for GCC __attribute__ support. */ -#undef __attribute__ - -#if defined (__PCC__) -# undef __DECLSPEC_SUPPORTED -# ifndef __MINGW_IMPORT -# define __MINGW_IMPORT extern -# endif -# ifndef _CRTIMP -# define _CRTIMP -# endif -# ifndef __cdecl -# define __cdecl _Pragma("cdecl") -# endif -# ifndef __stdcall -# define __stdcall _Pragma("stdcall") -# endif -# ifndef __int64 -# define __int64 long long -# endif -# ifndef __int32 -# define __int32 long -# endif -# ifndef __int16 -# define __int16 short -# endif -# ifndef __int8 -# define __int8 char -# endif -# ifndef __small -# define __small char -# endif -# ifndef __hyper -# define __hyper long long -# endif -# ifndef __volatile__ -# define __volatile__ volatile -# endif -# ifndef __restrict__ -# define __restrict__ restrict -# endif -# define NONAMELESSUNION -#elif defined(__GNUC__) -# ifdef __declspec -# ifndef __MINGW_IMPORT - /* Note the extern. This is needed to work around GCC's - limitations in handling dllimport attribute. */ -# define __MINGW_IMPORT extern __attribute__ ((__dllimport__)) -# endif -# ifndef _CRTIMP -# ifdef __USE_CRTIMP -# define _CRTIMP __attribute__ ((dllimport)) -# else -# define _CRTIMP -# endif -# endif -# define __DECLSPEC_SUPPORTED -# else /* __declspec */ -# undef __DECLSPEC_SUPPORTED -# undef __MINGW_IMPORT -# ifndef _CRTIMP -# define _CRTIMP -# endif -# endif /* __declspec */ -/* - * The next two defines can cause problems if user code adds the - * __cdecl attribute like so: - * void __attribute__ ((__cdecl)) foo(void); - */ -# ifndef __cdecl -# define __cdecl __attribute__ ((__cdecl__)) -# endif -# ifndef __stdcall -# define __stdcall __attribute__ ((__stdcall__)) -# endif -# ifndef __int64 -# define __int64 long long -# endif -# ifndef __int32 -# define __int32 long -# endif -# ifndef __int16 -# define __int16 short -# endif -# ifndef __int8 -# define __int8 char -# endif -# ifndef __small -# define __small char -# endif -# ifndef __hyper -# define __hyper long long -# endif -#else /* ! __GNUC__ && ! __PCC__ */ -# ifndef __MINGW_IMPORT -# define __MINGW_IMPORT __declspec(dllimport) -# endif -# ifndef _CRTIMP -# define _CRTIMP __declspec(dllimport) -# endif -# define __DECLSPEC_SUPPORTED -# define __attribute__(x) /* nothing */ -#endif - -#if defined (__GNUC__) && defined (__GNUC_MINOR__) -#define __MINGW_GNUC_PREREQ(major, minor) \ - (__GNUC__ > (major) \ - || (__GNUC__ == (major) && __GNUC_MINOR__ >= (minor))) -#else -#define __MINGW_GNUC_PREREQ(major, minor) 0 -#endif - -#ifdef __cplusplus -# define __CRT_INLINE inline -#else -# if __GNUC_STDC_INLINE__ -# define __CRT_INLINE extern inline __attribute__((__gnu_inline__)) -# else -# define __CRT_INLINE extern __inline__ -# endif -#endif - -# ifdef __GNUC__ -# define _CRTALIAS __CRT_INLINE __attribute__ ((__always_inline__)) -# else -# define _CRTALIAS __CRT_INLINE -# endif - -#ifdef __cplusplus -# define __UNUSED_PARAM(x) -#else -# ifdef __GNUC__ -# define __UNUSED_PARAM(x) x __attribute__ ((__unused__)) -# else -# define __UNUSED_PARAM(x) x -# endif -#endif - -#ifdef __GNUC__ -#define __MINGW_ATTRIB_NORETURN __attribute__ ((__noreturn__)) -#define __MINGW_ATTRIB_CONST __attribute__ ((__const__)) -#else -#define __MINGW_ATTRIB_NORETURN -#define __MINGW_ATTRIB_CONST -#endif - -#if __MINGW_GNUC_PREREQ (3, 0) -#define __MINGW_ATTRIB_MALLOC __attribute__ ((__malloc__)) -#define __MINGW_ATTRIB_PURE __attribute__ ((__pure__)) -#else -#define __MINGW_ATTRIB_MALLOC -#define __MINGW_ATTRIB_PURE -#endif - -/* Attribute `nonnull' was valid as of gcc 3.3. We don't use GCC's - variadiac macro facility, because variadic macros cause syntax - errors with --traditional-cpp. */ -#if __MINGW_GNUC_PREREQ (3, 3) -#define __MINGW_ATTRIB_NONNULL(arg) __attribute__ ((__nonnull__ (arg))) -#else -#define __MINGW_ATTRIB_NONNULL(arg) -#endif /* GNUC >= 3.3 */ - -#if __MINGW_GNUC_PREREQ (3, 1) -#define __MINGW_ATTRIB_DEPRECATED __attribute__ ((__deprecated__)) -#else -#define __MINGW_ATTRIB_DEPRECATED -#endif /* GNUC >= 3.1 */ - -#if __MINGW_GNUC_PREREQ (3, 3) -#define __MINGW_NOTHROW __attribute__ ((__nothrow__)) -#else -#define __MINGW_NOTHROW -#endif /* GNUC >= 3.3 */ - - -/* TODO: Mark (almost) all CRT functions as __MINGW_NOTHROW. This will -allow GCC to optimize away some EH unwind code, at least in DW2 case. */ - -#ifndef __MSVCRT_VERSION__ -/* High byte is the major version, low byte is the minor. */ -# define __MSVCRT_VERSION__ 0x0600 -#endif - -/* Activation of MinGW specific extended features: - */ -#ifndef __USE_MINGW_ANSI_STDIO -/* - * If user didn't specify it explicitly... - */ -# if defined __STRICT_ANSI__ || defined _ISOC99_SOURCE \ - || defined _POSIX_SOURCE || defined _POSIX_C_SOURCE \ - || defined _XOPEN_SOURCE || defined _XOPEN_SOURCE_EXTENDED \ - || defined _GNU_SOURCE || defined _BSD_SOURCE \ - || defined _SVID_SOURCE - /* - * but where any of these source code qualifiers are specified, - * then assume ANSI I/O standards are preferred over Microsoft's... - */ -# define __USE_MINGW_ANSI_STDIO 1 -# else - /* - * otherwise use whatever __MINGW_FEATURES__ specifies... - */ -# define __USE_MINGW_ANSI_STDIO (__MINGW_FEATURES__ & __MINGW_ANSI_STDIO__) -# endif -#endif -//inttypes.hĴ -#define __restrict__ - -#endif /* __MINGW_H */ diff --git a/dji_sdk_manifold_read_cam/include/djiCam.h b/dji_sdk_manifold_read_cam/include/djiCam.h deleted file mode 100644 index 7ec94b6..0000000 --- a/dji_sdk_manifold_read_cam/include/djiCam.h +++ /dev/null @@ -1,45 +0,0 @@ -/* Copyright (C) 2015, DJI Innovations, Inc. All rights reserved. - * - * The software is licensed under the terms of the GNU Lesser General Public License as published by - * the Free Software Foundation, either version 3 of the License, or - * (at your option) any later version. - * - * This program is distributed in the hope that it will be useful, - * but WITHOUT ANY WARRANTY; without even the implied warranty of - * MERCHANTABILITY or FITNESS FOR A PARTICULAR PURPOSE. See the - * GNU Lesser General Public License for more details. - * - * You should have received a copy of the GNU Lesser General Public License. - * If not, see . - */ -//#include -//#include -//#include -#include "cv.h" -#include "highgui.h" - -//using namespace cv; - -#ifndef __DJICAM_H -#define __DJICAM_H - -#define DISPLAY_MODE (1 << 0) -#define SAVEPICTURE_MODE (1 << 1) -#define TRANSFER_MODE (1 << 2) - -extern IplImage * g_pImage; -#ifdef __cplusplus -extern "C" { -#endif -//void Imagetransf(AVFrame *pFrame,int width,int height,int time); -int djiCam_init(); -void djiCam_exit(); -int djiCam_loop(IplImage* pImg); - -#ifdef __cplusplus -} -IplImage* sendImageBack(); -#endif - -#endif - diff --git a/dji_sdk_manifold_read_cam_nv/include/djicam.h b/dji_sdk_manifold_read_cam/include/djicam.h similarity index 61% rename from dji_sdk_manifold_read_cam_nv/include/djicam.h rename to dji_sdk_manifold_read_cam/include/djicam.h index 1b79115..897e746 100644 --- a/dji_sdk_manifold_read_cam_nv/include/djicam.h +++ b/dji_sdk_manifold_read_cam/include/djicam.h @@ -9,9 +9,9 @@ extern "C" { #endif -int manifold_decode_start(unsigned char *buffer, unsigned int *size, unsigned int *nframe); -int manifold_cam_init(int mode); -int manifold_cam_exit(); + int manifold_cam_read(unsigned char *buffer, unsigned int *nframe, unsigned int block); + int manifold_cam_init(int mode); + int manifold_cam_exit(); #ifdef __cplusplus } #endif diff --git a/dji_sdk_manifold_read_cam/include/inttypes.h b/dji_sdk_manifold_read_cam/include/inttypes.h deleted file mode 100644 index 2d2bb8d..0000000 --- a/dji_sdk_manifold_read_cam/include/inttypes.h +++ /dev/null @@ -1,281 +0,0 @@ -/* 7.8 Format conversion of integer types */ - -#ifndef _INTTYPES_H_ -#define _INTTYPES_H_ - -#include <_mingw.h> -#include -#define __need_wchar_t -#include - -#ifdef __cplusplus -extern "C" { -#endif - -typedef struct { - intmax_t quot; - intmax_t rem; - } imaxdiv_t; - -#if !defined(__cplusplus) || defined(__STDC_FORMAT_MACROS) - -/* 7.8.1 Macros for format specifiers - * - * MS runtime does not yet understand C9x standard "ll" - * length specifier. It appears to treat "ll" as "l". - * The non-standard I64 length specifier causes warning in GCC, - * but understood by MS runtime functions. - */ - -/* fprintf macros for signed types */ -#define PRId8 "d" -#define PRId16 "d" -#define PRId32 "d" -#define PRId64 "I64d" - -#define PRIdLEAST8 "d" -#define PRIdLEAST16 "d" -#define PRIdLEAST32 "d" -#define PRIdLEAST64 "I64d" - -#define PRIdFAST8 "d" -#define PRIdFAST16 "d" -#define PRIdFAST32 "d" -#define PRIdFAST64 "I64d" - -#define PRIdMAX "I64d" -#define PRIdPTR "d" - -#define PRIi8 "i" -#define PRIi16 "i" -#define PRIi32 "i" -#define PRIi64 "I64i" - -#define PRIiLEAST8 "i" -#define PRIiLEAST16 "i" -#define PRIiLEAST32 "i" -#define PRIiLEAST64 "I64i" - -#define PRIiFAST8 "i" -#define PRIiFAST16 "i" -#define PRIiFAST32 "i" -#define PRIiFAST64 "I64i" - -#define PRIiMAX "I64i" -#define PRIiPTR "i" - -#define PRIo8 "o" -#define PRIo16 "o" -#define PRIo32 "o" -#define PRIo64 "I64o" - -#define PRIoLEAST8 "o" -#define PRIoLEAST16 "o" -#define PRIoLEAST32 "o" -#define PRIoLEAST64 "I64o" - -#define PRIoFAST8 "o" -#define PRIoFAST16 "o" -#define PRIoFAST32 "o" -#define PRIoFAST64 "I64o" - -#define PRIoMAX "I64o" - -#define PRIoPTR "o" - -/* fprintf macros for unsigned types */ -#define PRIu8 "u" -#define PRIu16 "u" -#define PRIu32 "u" -#define PRIu64 "I64u" - - -#define PRIuLEAST8 "u" -#define PRIuLEAST16 "u" -#define PRIuLEAST32 "u" -#define PRIuLEAST64 "I64u" - -#define PRIuFAST8 "u" -#define PRIuFAST16 "u" -#define PRIuFAST32 "u" -#define PRIuFAST64 "I64u" - -#define PRIuMAX "I64u" -#define PRIuPTR "u" - -#define PRIx8 "x" -#define PRIx16 "x" -#define PRIx32 "x" -#define PRIx64 "I64x" - -#define PRIxLEAST8 "x" -#define PRIxLEAST16 "x" -#define PRIxLEAST32 "x" -#define PRIxLEAST64 "I64x" - -#define PRIxFAST8 "x" -#define PRIxFAST16 "x" -#define PRIxFAST32 "x" -#define PRIxFAST64 "I64x" - -#define PRIxMAX "I64x" -#define PRIxPTR "x" - -#define PRIX8 "X" -#define PRIX16 "X" -#define PRIX32 "X" -#define PRIX64 "I64X" - -#define PRIXLEAST8 "X" -#define PRIXLEAST16 "X" -#define PRIXLEAST32 "X" -#define PRIXLEAST64 "I64X" - -#define PRIXFAST8 "X" -#define PRIXFAST16 "X" -#define PRIXFAST32 "X" -#define PRIXFAST64 "I64X" - -#define PRIXMAX "I64X" -#define PRIXPTR "X" - -/* - * fscanf macros for signed int types - * NOTE: if 32-bit int is used for int_fast8_t and int_fast16_t - * (see stdint.h, 7.18.1.3), FAST8 and FAST16 should have - * no length identifiers - */ - -#define SCNd16 "hd" -#define SCNd32 "d" -#define SCNd64 "I64d" - -#define SCNdLEAST16 "hd" -#define SCNdLEAST32 "d" -#define SCNdLEAST64 "I64d" - -#define SCNdFAST16 "hd" -#define SCNdFAST32 "d" -#define SCNdFAST64 "I64d" - -#define SCNdMAX "I64d" -#define SCNdPTR "d" - -#define SCNi16 "hi" -#define SCNi32 "i" -#define SCNi64 "I64i" - -#define SCNiLEAST16 "hi" -#define SCNiLEAST32 "i" -#define SCNiLEAST64 "I64i" - -#define SCNiFAST16 "hi" -#define SCNiFAST32 "i" -#define SCNiFAST64 "I64i" - -#define SCNiMAX "I64i" -#define SCNiPTR "i" - -#define SCNo16 "ho" -#define SCNo32 "o" -#define SCNo64 "I64o" - -#define SCNoLEAST16 "ho" -#define SCNoLEAST32 "o" -#define SCNoLEAST64 "I64o" - -#define SCNoFAST16 "ho" -#define SCNoFAST32 "o" -#define SCNoFAST64 "I64o" - -#define SCNoMAX "I64o" -#define SCNoPTR "o" - -#define SCNx16 "hx" -#define SCNx32 "x" -#define SCNx64 "I64x" - -#define SCNxLEAST16 "hx" -#define SCNxLEAST32 "x" -#define SCNxLEAST64 "I64x" - -#define SCNxFAST16 "hx" -#define SCNxFAST32 "x" -#define SCNxFAST64 "I64x" - -#define SCNxMAX "I64x" -#define SCNxPTR "x" - - -/* fscanf macros for unsigned int types */ - -#define SCNu16 "hu" -#define SCNu32 "u" -#define SCNu64 "I64u" - -#define SCNuLEAST16 "hu" -#define SCNuLEAST32 "u" -#define SCNuLEAST64 "I64u" - -#define SCNuFAST16 "hu" -#define SCNuFAST32 "u" -#define SCNuFAST64 "I64u" - -#define SCNuMAX "I64u" -#define SCNuPTR "u" - -#if defined (__STDC_VERSION__) && __STDC_VERSION__ >= 199901L -/* - * no length modifier for char types prior to C9x - * MS runtime scanf appears to treat "hh" as "h" - */ - -/* signed char */ -#define SCNd8 "hhd" -#define SCNdLEAST8 "hhd" -#define SCNdFAST8 "hhd" - -#define SCNi8 "hhi" -#define SCNiLEAST8 "hhi" -#define SCNiFAST8 "hhi" - -#define SCNo8 "hho" -#define SCNoLEAST8 "hho" -#define SCNoFAST8 "hho" - -#define SCNx8 "hhx" -#define SCNxLEAST8 "hhx" -#define SCNxFAST8 "hhx" - -/* unsigned char */ -#define SCNu8 "hhu" -#define SCNuLEAST8 "hhu" -#define SCNuFAST8 "hhu" -#endif /* __STDC_VERSION__ >= 199901 */ - -#endif /* !defined(__cplusplus) || defined(__STDC_FORMAT_MACROS) */ - -intmax_t __cdecl __MINGW_NOTHROW imaxabs (intmax_t j); -#ifndef __NO_INLINE__ -__CRT_INLINE intmax_t __cdecl __MINGW_NOTHROW imaxabs (intmax_t j) - {return (j >= 0 ? j : -j);} -#endif -imaxdiv_t __cdecl __MINGW_NOTHROW imaxdiv (intmax_t numer, intmax_t denom); - -/* 7.8.2 Conversion functions for greatest-width integer types */ - -intmax_t __cdecl __MINGW_NOTHROW strtoimax (const char* __restrict__ nptr, - char** __restrict__ endptr, int base); -uintmax_t __cdecl __MINGW_NOTHROW strtoumax (const char* __restrict__ nptr, - char** __restrict__ endptr, int base); - -intmax_t __cdecl __MINGW_NOTHROW wcstoimax (const wchar_t* __restrict__ nptr, - wchar_t** __restrict__ endptr, int base); -uintmax_t __cdecl __MINGW_NOTHROW wcstoumax (const wchar_t* __restrict__ nptr, - wchar_t** __restrict__ endptr, int base); - -#ifdef __cplusplus -} -#endif - -#endif /* ndef _INTTYPES_H */ diff --git a/dji_sdk_manifold_read_cam/include/libavcodec/avcodec.h b/dji_sdk_manifold_read_cam/include/libavcodec/avcodec.h deleted file mode 100644 index 94d4cf0..0000000 --- a/dji_sdk_manifold_read_cam/include/libavcodec/avcodec.h +++ /dev/null @@ -1,5116 +0,0 @@ -/* - * copyright (c) 2001 Fabrice Bellard - * - * This file is part of FFmpeg. - * - * FFmpeg is free software; you can redistribute it and/or - * modify it under the terms of the GNU Lesser General Public - * License as published by the Free Software Foundation; either - * version 2.1 of the License, or (at your option) any later version. - * - * FFmpeg is distributed in the hope that it will be useful, - * but WITHOUT ANY WARRANTY; without even the implied warranty of - * MERCHANTABILITY or FITNESS FOR A PARTICULAR PURPOSE. See the GNU - * Lesser General Public License for more details. - * - * You should have received a copy of the GNU Lesser General Public - * License along with FFmpeg; if not, write to the Free Software - * Foundation, Inc., 51 Franklin Street, Fifth Floor, Boston, MA 02110-1301 USA - */ - -#ifndef AVCODEC_AVCODEC_H -#define AVCODEC_AVCODEC_H - -/** - * @file - * @ingroup libavc - * Libavcodec external API header - */ - -#include -#include "libavutil/samplefmt.h" -#include "libavutil/attributes.h" -#include "libavutil/avutil.h" -#include "libavutil/buffer.h" -#include "libavutil/cpu.h" -#include "libavutil/channel_layout.h" -#include "libavutil/dict.h" -#include "libavutil/frame.h" -#include "libavutil/log.h" -#include "libavutil/pixfmt.h" -#include "libavutil/rational.h" - -#include "version.h" - -#if FF_API_FAST_MALLOC -// to provide fast_*alloc -#include "libavutil/mem.h" -#endif - -/** - * @defgroup libavc Encoding/Decoding Library - * @{ - * - * @defgroup lavc_decoding Decoding - * @{ - * @} - * - * @defgroup lavc_encoding Encoding - * @{ - * @} - * - * @defgroup lavc_codec Codecs - * @{ - * @defgroup lavc_codec_native Native Codecs - * @{ - * @} - * @defgroup lavc_codec_wrappers External library wrappers - * @{ - * @} - * @defgroup lavc_codec_hwaccel Hardware Accelerators bridge - * @{ - * @} - * @} - * @defgroup lavc_internal Internal - * @{ - * @} - * @} - * - */ - -/** - * @defgroup lavc_core Core functions/structures. - * @ingroup libavc - * - * Basic definitions, functions for querying libavcodec capabilities, - * allocating core structures, etc. - * @{ - */ - - -/** - * Identify the syntax and semantics of the bitstream. - * The principle is roughly: - * Two decoders with the same ID can decode the same streams. - * Two encoders with the same ID can encode compatible streams. - * There may be slight deviations from the principle due to implementation - * details. - * - * If you add a codec ID to this list, add it so that - * 1. no value of a existing codec ID changes (that would break ABI), - * 2. Give it a value which when taken as ASCII is recognized uniquely by a human as this specific codec. - * This ensures that 2 forks can independently add AVCodecIDs without producing conflicts. - * - * After adding new codec IDs, do not forget to add an entry to the codec - * descriptor list and bump libavcodec minor version. - */ -enum AVCodecID { - AV_CODEC_ID_NONE, - - /* video codecs */ - AV_CODEC_ID_MPEG1VIDEO, - AV_CODEC_ID_MPEG2VIDEO, ///< preferred ID for MPEG-1/2 video decoding -#if FF_API_XVMC - AV_CODEC_ID_MPEG2VIDEO_XVMC, -#endif /* FF_API_XVMC */ - AV_CODEC_ID_H261, - AV_CODEC_ID_H263, - AV_CODEC_ID_RV10, - AV_CODEC_ID_RV20, - AV_CODEC_ID_MJPEG, - AV_CODEC_ID_MJPEGB, - AV_CODEC_ID_LJPEG, - AV_CODEC_ID_SP5X, - AV_CODEC_ID_JPEGLS, - AV_CODEC_ID_MPEG4, - AV_CODEC_ID_RAWVIDEO, - AV_CODEC_ID_MSMPEG4V1, - AV_CODEC_ID_MSMPEG4V2, - AV_CODEC_ID_MSMPEG4V3, - AV_CODEC_ID_WMV1, - AV_CODEC_ID_WMV2, - AV_CODEC_ID_H263P, - AV_CODEC_ID_H263I, - AV_CODEC_ID_FLV1, - AV_CODEC_ID_SVQ1, - AV_CODEC_ID_SVQ3, - AV_CODEC_ID_DVVIDEO, - AV_CODEC_ID_HUFFYUV, - AV_CODEC_ID_CYUV, - AV_CODEC_ID_H264, - AV_CODEC_ID_INDEO3, - AV_CODEC_ID_VP3, - AV_CODEC_ID_THEORA, - AV_CODEC_ID_ASV1, - AV_CODEC_ID_ASV2, - AV_CODEC_ID_FFV1, - AV_CODEC_ID_4XM, - AV_CODEC_ID_VCR1, - AV_CODEC_ID_CLJR, - AV_CODEC_ID_MDEC, - AV_CODEC_ID_ROQ, - AV_CODEC_ID_INTERPLAY_VIDEO, - AV_CODEC_ID_XAN_WC3, - AV_CODEC_ID_XAN_WC4, - AV_CODEC_ID_RPZA, - AV_CODEC_ID_CINEPAK, - AV_CODEC_ID_WS_VQA, - AV_CODEC_ID_MSRLE, - AV_CODEC_ID_MSVIDEO1, - AV_CODEC_ID_IDCIN, - AV_CODEC_ID_8BPS, - AV_CODEC_ID_SMC, - AV_CODEC_ID_FLIC, - AV_CODEC_ID_TRUEMOTION1, - AV_CODEC_ID_VMDVIDEO, - AV_CODEC_ID_MSZH, - AV_CODEC_ID_ZLIB, - AV_CODEC_ID_QTRLE, - AV_CODEC_ID_TSCC, - AV_CODEC_ID_ULTI, - AV_CODEC_ID_QDRAW, - AV_CODEC_ID_VIXL, - AV_CODEC_ID_QPEG, - AV_CODEC_ID_PNG, - AV_CODEC_ID_PPM, - AV_CODEC_ID_PBM, - AV_CODEC_ID_PGM, - AV_CODEC_ID_PGMYUV, - AV_CODEC_ID_PAM, - AV_CODEC_ID_FFVHUFF, - AV_CODEC_ID_RV30, - AV_CODEC_ID_RV40, - AV_CODEC_ID_VC1, - AV_CODEC_ID_WMV3, - AV_CODEC_ID_LOCO, - AV_CODEC_ID_WNV1, - AV_CODEC_ID_AASC, - AV_CODEC_ID_INDEO2, - AV_CODEC_ID_FRAPS, - AV_CODEC_ID_TRUEMOTION2, - AV_CODEC_ID_BMP, - AV_CODEC_ID_CSCD, - AV_CODEC_ID_MMVIDEO, - AV_CODEC_ID_ZMBV, - AV_CODEC_ID_AVS, - AV_CODEC_ID_SMACKVIDEO, - AV_CODEC_ID_NUV, - AV_CODEC_ID_KMVC, - AV_CODEC_ID_FLASHSV, - AV_CODEC_ID_CAVS, - AV_CODEC_ID_JPEG2000, - AV_CODEC_ID_VMNC, - AV_CODEC_ID_VP5, - AV_CODEC_ID_VP6, - AV_CODEC_ID_VP6F, - AV_CODEC_ID_TARGA, - AV_CODEC_ID_DSICINVIDEO, - AV_CODEC_ID_TIERTEXSEQVIDEO, - AV_CODEC_ID_TIFF, - AV_CODEC_ID_GIF, - AV_CODEC_ID_DXA, - AV_CODEC_ID_DNXHD, - AV_CODEC_ID_THP, - AV_CODEC_ID_SGI, - AV_CODEC_ID_C93, - AV_CODEC_ID_BETHSOFTVID, - AV_CODEC_ID_PTX, - AV_CODEC_ID_TXD, - AV_CODEC_ID_VP6A, - AV_CODEC_ID_AMV, - AV_CODEC_ID_VB, - AV_CODEC_ID_PCX, - AV_CODEC_ID_SUNRAST, - AV_CODEC_ID_INDEO4, - AV_CODEC_ID_INDEO5, - AV_CODEC_ID_MIMIC, - AV_CODEC_ID_RL2, - AV_CODEC_ID_ESCAPE124, - AV_CODEC_ID_DIRAC, - AV_CODEC_ID_BFI, - AV_CODEC_ID_CMV, - AV_CODEC_ID_MOTIONPIXELS, - AV_CODEC_ID_TGV, - AV_CODEC_ID_TGQ, - AV_CODEC_ID_TQI, - AV_CODEC_ID_AURA, - AV_CODEC_ID_AURA2, - AV_CODEC_ID_V210X, - AV_CODEC_ID_TMV, - AV_CODEC_ID_V210, - AV_CODEC_ID_DPX, - AV_CODEC_ID_MAD, - AV_CODEC_ID_FRWU, - AV_CODEC_ID_FLASHSV2, - AV_CODEC_ID_CDGRAPHICS, - AV_CODEC_ID_R210, - AV_CODEC_ID_ANM, - AV_CODEC_ID_BINKVIDEO, - AV_CODEC_ID_IFF_ILBM, - AV_CODEC_ID_IFF_BYTERUN1, - AV_CODEC_ID_KGV1, - AV_CODEC_ID_YOP, - AV_CODEC_ID_VP8, - AV_CODEC_ID_PICTOR, - AV_CODEC_ID_ANSI, - AV_CODEC_ID_A64_MULTI, - AV_CODEC_ID_A64_MULTI5, - AV_CODEC_ID_R10K, - AV_CODEC_ID_MXPEG, - AV_CODEC_ID_LAGARITH, - AV_CODEC_ID_PRORES, - AV_CODEC_ID_JV, - AV_CODEC_ID_DFA, - AV_CODEC_ID_WMV3IMAGE, - AV_CODEC_ID_VC1IMAGE, - AV_CODEC_ID_UTVIDEO, - AV_CODEC_ID_BMV_VIDEO, - AV_CODEC_ID_VBLE, - AV_CODEC_ID_DXTORY, - AV_CODEC_ID_V410, - AV_CODEC_ID_XWD, - AV_CODEC_ID_CDXL, - AV_CODEC_ID_XBM, - AV_CODEC_ID_ZEROCODEC, - AV_CODEC_ID_MSS1, - AV_CODEC_ID_MSA1, - AV_CODEC_ID_TSCC2, - AV_CODEC_ID_MTS2, - AV_CODEC_ID_CLLC, - AV_CODEC_ID_MSS2, - AV_CODEC_ID_VP9, - AV_CODEC_ID_AIC, - AV_CODEC_ID_ESCAPE130_DEPRECATED, - AV_CODEC_ID_G2M_DEPRECATED, - AV_CODEC_ID_WEBP_DEPRECATED, - AV_CODEC_ID_HNM4_VIDEO, - AV_CODEC_ID_HEVC_DEPRECATED, - AV_CODEC_ID_FIC, - AV_CODEC_ID_ALIAS_PIX, - AV_CODEC_ID_BRENDER_PIX_DEPRECATED, - AV_CODEC_ID_PAF_VIDEO_DEPRECATED, - AV_CODEC_ID_EXR_DEPRECATED, - AV_CODEC_ID_VP7_DEPRECATED, - AV_CODEC_ID_SANM_DEPRECATED, - AV_CODEC_ID_SGIRLE_DEPRECATED, - AV_CODEC_ID_MVC1_DEPRECATED, - AV_CODEC_ID_MVC2_DEPRECATED, - - AV_CODEC_ID_BRENDER_PIX= MKBETAG('B','P','I','X'), - AV_CODEC_ID_Y41P = MKBETAG('Y','4','1','P'), - AV_CODEC_ID_ESCAPE130 = MKBETAG('E','1','3','0'), - AV_CODEC_ID_EXR = MKBETAG('0','E','X','R'), - AV_CODEC_ID_AVRP = MKBETAG('A','V','R','P'), - - AV_CODEC_ID_012V = MKBETAG('0','1','2','V'), - AV_CODEC_ID_G2M = MKBETAG( 0 ,'G','2','M'), - AV_CODEC_ID_AVUI = MKBETAG('A','V','U','I'), - AV_CODEC_ID_AYUV = MKBETAG('A','Y','U','V'), - AV_CODEC_ID_TARGA_Y216 = MKBETAG('T','2','1','6'), - AV_CODEC_ID_V308 = MKBETAG('V','3','0','8'), - AV_CODEC_ID_V408 = MKBETAG('V','4','0','8'), - AV_CODEC_ID_YUV4 = MKBETAG('Y','U','V','4'), - AV_CODEC_ID_SANM = MKBETAG('S','A','N','M'), - AV_CODEC_ID_PAF_VIDEO = MKBETAG('P','A','F','V'), - AV_CODEC_ID_AVRN = MKBETAG('A','V','R','n'), - AV_CODEC_ID_CPIA = MKBETAG('C','P','I','A'), - AV_CODEC_ID_XFACE = MKBETAG('X','F','A','C'), - AV_CODEC_ID_SGIRLE = MKBETAG('S','G','I','R'), - AV_CODEC_ID_MVC1 = MKBETAG('M','V','C','1'), - AV_CODEC_ID_MVC2 = MKBETAG('M','V','C','2'), - AV_CODEC_ID_SNOW = MKBETAG('S','N','O','W'), - AV_CODEC_ID_WEBP = MKBETAG('W','E','B','P'), - AV_CODEC_ID_SMVJPEG = MKBETAG('S','M','V','J'), - AV_CODEC_ID_HEVC = MKBETAG('H','2','6','5'), -#define AV_CODEC_ID_H265 AV_CODEC_ID_HEVC - AV_CODEC_ID_VP7 = MKBETAG('V','P','7','0'), - - /* various PCM "codecs" */ - AV_CODEC_ID_FIRST_AUDIO = 0x10000, ///< A dummy id pointing at the start of audio codecs - AV_CODEC_ID_PCM_S16LE = 0x10000, - AV_CODEC_ID_PCM_S16BE, - AV_CODEC_ID_PCM_U16LE, - AV_CODEC_ID_PCM_U16BE, - AV_CODEC_ID_PCM_S8, - AV_CODEC_ID_PCM_U8, - AV_CODEC_ID_PCM_MULAW, - AV_CODEC_ID_PCM_ALAW, - AV_CODEC_ID_PCM_S32LE, - AV_CODEC_ID_PCM_S32BE, - AV_CODEC_ID_PCM_U32LE, - AV_CODEC_ID_PCM_U32BE, - AV_CODEC_ID_PCM_S24LE, - AV_CODEC_ID_PCM_S24BE, - AV_CODEC_ID_PCM_U24LE, - AV_CODEC_ID_PCM_U24BE, - AV_CODEC_ID_PCM_S24DAUD, - AV_CODEC_ID_PCM_ZORK, - AV_CODEC_ID_PCM_S16LE_PLANAR, - AV_CODEC_ID_PCM_DVD, - AV_CODEC_ID_PCM_F32BE, - AV_CODEC_ID_PCM_F32LE, - AV_CODEC_ID_PCM_F64BE, - AV_CODEC_ID_PCM_F64LE, - AV_CODEC_ID_PCM_BLURAY, - AV_CODEC_ID_PCM_LXF, - AV_CODEC_ID_S302M, - AV_CODEC_ID_PCM_S8_PLANAR, - AV_CODEC_ID_PCM_S24LE_PLANAR_DEPRECATED, - AV_CODEC_ID_PCM_S32LE_PLANAR_DEPRECATED, - AV_CODEC_ID_PCM_S24LE_PLANAR = MKBETAG(24,'P','S','P'), - AV_CODEC_ID_PCM_S32LE_PLANAR = MKBETAG(32,'P','S','P'), - AV_CODEC_ID_PCM_S16BE_PLANAR = MKBETAG('P','S','P',16), - - /* various ADPCM codecs */ - AV_CODEC_ID_ADPCM_IMA_QT = 0x11000, - AV_CODEC_ID_ADPCM_IMA_WAV, - AV_CODEC_ID_ADPCM_IMA_DK3, - AV_CODEC_ID_ADPCM_IMA_DK4, - AV_CODEC_ID_ADPCM_IMA_WS, - AV_CODEC_ID_ADPCM_IMA_SMJPEG, - AV_CODEC_ID_ADPCM_MS, - AV_CODEC_ID_ADPCM_4XM, - AV_CODEC_ID_ADPCM_XA, - AV_CODEC_ID_ADPCM_ADX, - AV_CODEC_ID_ADPCM_EA, - AV_CODEC_ID_ADPCM_G726, - AV_CODEC_ID_ADPCM_CT, - AV_CODEC_ID_ADPCM_SWF, - AV_CODEC_ID_ADPCM_YAMAHA, - AV_CODEC_ID_ADPCM_SBPRO_4, - AV_CODEC_ID_ADPCM_SBPRO_3, - AV_CODEC_ID_ADPCM_SBPRO_2, - AV_CODEC_ID_ADPCM_THP, - AV_CODEC_ID_ADPCM_IMA_AMV, - AV_CODEC_ID_ADPCM_EA_R1, - AV_CODEC_ID_ADPCM_EA_R3, - AV_CODEC_ID_ADPCM_EA_R2, - AV_CODEC_ID_ADPCM_IMA_EA_SEAD, - AV_CODEC_ID_ADPCM_IMA_EA_EACS, - AV_CODEC_ID_ADPCM_EA_XAS, - AV_CODEC_ID_ADPCM_EA_MAXIS_XA, - AV_CODEC_ID_ADPCM_IMA_ISS, - AV_CODEC_ID_ADPCM_G722, - AV_CODEC_ID_ADPCM_IMA_APC, - AV_CODEC_ID_ADPCM_VIMA_DEPRECATED, - AV_CODEC_ID_ADPCM_VIMA = MKBETAG('V','I','M','A'), - AV_CODEC_ID_VIMA = MKBETAG('V','I','M','A'), - AV_CODEC_ID_ADPCM_AFC = MKBETAG('A','F','C',' '), - AV_CODEC_ID_ADPCM_IMA_OKI = MKBETAG('O','K','I',' '), - AV_CODEC_ID_ADPCM_DTK = MKBETAG('D','T','K',' '), - AV_CODEC_ID_ADPCM_IMA_RAD = MKBETAG('R','A','D',' '), - AV_CODEC_ID_ADPCM_G726LE = MKBETAG('6','2','7','G'), - - /* AMR */ - AV_CODEC_ID_AMR_NB = 0x12000, - AV_CODEC_ID_AMR_WB, - - /* RealAudio codecs*/ - AV_CODEC_ID_RA_144 = 0x13000, - AV_CODEC_ID_RA_288, - - /* various DPCM codecs */ - AV_CODEC_ID_ROQ_DPCM = 0x14000, - AV_CODEC_ID_INTERPLAY_DPCM, - AV_CODEC_ID_XAN_DPCM, - AV_CODEC_ID_SOL_DPCM, - - /* audio codecs */ - AV_CODEC_ID_MP2 = 0x15000, - AV_CODEC_ID_MP3, ///< preferred ID for decoding MPEG audio layer 1, 2 or 3 - AV_CODEC_ID_AAC, - AV_CODEC_ID_AC3, - AV_CODEC_ID_DTS, - AV_CODEC_ID_VORBIS, - AV_CODEC_ID_DVAUDIO, - AV_CODEC_ID_WMAV1, - AV_CODEC_ID_WMAV2, - AV_CODEC_ID_MACE3, - AV_CODEC_ID_MACE6, - AV_CODEC_ID_VMDAUDIO, - AV_CODEC_ID_FLAC, - AV_CODEC_ID_MP3ADU, - AV_CODEC_ID_MP3ON4, - AV_CODEC_ID_SHORTEN, - AV_CODEC_ID_ALAC, - AV_CODEC_ID_WESTWOOD_SND1, - AV_CODEC_ID_GSM, ///< as in Berlin toast format - AV_CODEC_ID_QDM2, - AV_CODEC_ID_COOK, - AV_CODEC_ID_TRUESPEECH, - AV_CODEC_ID_TTA, - AV_CODEC_ID_SMACKAUDIO, - AV_CODEC_ID_QCELP, - AV_CODEC_ID_WAVPACK, - AV_CODEC_ID_DSICINAUDIO, - AV_CODEC_ID_IMC, - AV_CODEC_ID_MUSEPACK7, - AV_CODEC_ID_MLP, - AV_CODEC_ID_GSM_MS, /* as found in WAV */ - AV_CODEC_ID_ATRAC3, -#if FF_API_VOXWARE - AV_CODEC_ID_VOXWARE, -#endif - AV_CODEC_ID_APE, - AV_CODEC_ID_NELLYMOSER, - AV_CODEC_ID_MUSEPACK8, - AV_CODEC_ID_SPEEX, - AV_CODEC_ID_WMAVOICE, - AV_CODEC_ID_WMAPRO, - AV_CODEC_ID_WMALOSSLESS, - AV_CODEC_ID_ATRAC3P, - AV_CODEC_ID_EAC3, - AV_CODEC_ID_SIPR, - AV_CODEC_ID_MP1, - AV_CODEC_ID_TWINVQ, - AV_CODEC_ID_TRUEHD, - AV_CODEC_ID_MP4ALS, - AV_CODEC_ID_ATRAC1, - AV_CODEC_ID_BINKAUDIO_RDFT, - AV_CODEC_ID_BINKAUDIO_DCT, - AV_CODEC_ID_AAC_LATM, - AV_CODEC_ID_QDMC, - AV_CODEC_ID_CELT, - AV_CODEC_ID_G723_1, - AV_CODEC_ID_G729, - AV_CODEC_ID_8SVX_EXP, - AV_CODEC_ID_8SVX_FIB, - AV_CODEC_ID_BMV_AUDIO, - AV_CODEC_ID_RALF, - AV_CODEC_ID_IAC, - AV_CODEC_ID_ILBC, - AV_CODEC_ID_OPUS_DEPRECATED, - AV_CODEC_ID_COMFORT_NOISE, - AV_CODEC_ID_TAK_DEPRECATED, - AV_CODEC_ID_METASOUND, - AV_CODEC_ID_PAF_AUDIO_DEPRECATED, - AV_CODEC_ID_ON2AVC, - AV_CODEC_ID_FFWAVESYNTH = MKBETAG('F','F','W','S'), - AV_CODEC_ID_SONIC = MKBETAG('S','O','N','C'), - AV_CODEC_ID_SONIC_LS = MKBETAG('S','O','N','L'), - AV_CODEC_ID_PAF_AUDIO = MKBETAG('P','A','F','A'), - AV_CODEC_ID_OPUS = MKBETAG('O','P','U','S'), - AV_CODEC_ID_TAK = MKBETAG('t','B','a','K'), - AV_CODEC_ID_EVRC = MKBETAG('s','e','v','c'), - AV_CODEC_ID_SMV = MKBETAG('s','s','m','v'), - AV_CODEC_ID_DSD_LSBF = MKBETAG('D','S','D','L'), - AV_CODEC_ID_DSD_MSBF = MKBETAG('D','S','D','M'), - AV_CODEC_ID_DSD_LSBF_PLANAR = MKBETAG('D','S','D','1'), - AV_CODEC_ID_DSD_MSBF_PLANAR = MKBETAG('D','S','D','8'), - - /* subtitle codecs */ - AV_CODEC_ID_FIRST_SUBTITLE = 0x17000, ///< A dummy ID pointing at the start of subtitle codecs. - AV_CODEC_ID_DVD_SUBTITLE = 0x17000, - AV_CODEC_ID_DVB_SUBTITLE, - AV_CODEC_ID_TEXT, ///< raw UTF-8 text - AV_CODEC_ID_XSUB, - AV_CODEC_ID_SSA, - AV_CODEC_ID_MOV_TEXT, - AV_CODEC_ID_HDMV_PGS_SUBTITLE, - AV_CODEC_ID_DVB_TELETEXT, - AV_CODEC_ID_SRT, - AV_CODEC_ID_MICRODVD = MKBETAG('m','D','V','D'), - AV_CODEC_ID_EIA_608 = MKBETAG('c','6','0','8'), - AV_CODEC_ID_JACOSUB = MKBETAG('J','S','U','B'), - AV_CODEC_ID_SAMI = MKBETAG('S','A','M','I'), - AV_CODEC_ID_REALTEXT = MKBETAG('R','T','X','T'), - AV_CODEC_ID_SUBVIEWER1 = MKBETAG('S','b','V','1'), - AV_CODEC_ID_SUBVIEWER = MKBETAG('S','u','b','V'), - AV_CODEC_ID_SUBRIP = MKBETAG('S','R','i','p'), - AV_CODEC_ID_WEBVTT = MKBETAG('W','V','T','T'), - AV_CODEC_ID_MPL2 = MKBETAG('M','P','L','2'), - AV_CODEC_ID_VPLAYER = MKBETAG('V','P','l','r'), - AV_CODEC_ID_PJS = MKBETAG('P','h','J','S'), - AV_CODEC_ID_ASS = MKBETAG('A','S','S',' '), ///< ASS as defined in Matroska - - /* other specific kind of codecs (generally used for attachments) */ - AV_CODEC_ID_FIRST_UNKNOWN = 0x18000, ///< A dummy ID pointing at the start of various fake codecs. - AV_CODEC_ID_TTF = 0x18000, - AV_CODEC_ID_BINTEXT = MKBETAG('B','T','X','T'), - AV_CODEC_ID_XBIN = MKBETAG('X','B','I','N'), - AV_CODEC_ID_IDF = MKBETAG( 0 ,'I','D','F'), - AV_CODEC_ID_OTF = MKBETAG( 0 ,'O','T','F'), - AV_CODEC_ID_SMPTE_KLV = MKBETAG('K','L','V','A'), - AV_CODEC_ID_DVD_NAV = MKBETAG('D','N','A','V'), - AV_CODEC_ID_TIMED_ID3 = MKBETAG('T','I','D','3'), - AV_CODEC_ID_BIN_DATA = MKBETAG('D','A','T','A'), - - - AV_CODEC_ID_PROBE = 0x19000, ///< codec_id is not known (like AV_CODEC_ID_NONE) but lavf should attempt to identify it - - AV_CODEC_ID_MPEG2TS = 0x20000, /**< _FAKE_ codec to indicate a raw MPEG-2 TS - * stream (only used by libavformat) */ - AV_CODEC_ID_MPEG4SYSTEMS = 0x20001, /**< _FAKE_ codec to indicate a MPEG-4 Systems - * stream (only used by libavformat) */ - AV_CODEC_ID_FFMETADATA = 0x21000, ///< Dummy codec for streams containing only metadata information. - -#if FF_API_CODEC_ID -#include "old_codec_ids.h" -#endif -}; - -/** - * This struct describes the properties of a single codec described by an - * AVCodecID. - * @see avcodec_get_descriptor() - */ -typedef struct AVCodecDescriptor { - enum AVCodecID id; - enum AVMediaType type; - /** - * Name of the codec described by this descriptor. It is non-empty and - * unique for each codec descriptor. It should contain alphanumeric - * characters and '_' only. - */ - const char *name; - /** - * A more descriptive name for this codec. May be NULL. - */ - const char *long_name; - /** - * Codec properties, a combination of AV_CODEC_PROP_* flags. - */ - int props; - - /** - * MIME type(s) associated with the codec. - * May be NULL; if not, a NULL-terminated array of MIME types. - * The first item is always non-NULL and is the prefered MIME type. - */ - const char *const *mime_types; -} AVCodecDescriptor; - -/** - * Codec uses only intra compression. - * Video codecs only. - */ -#define AV_CODEC_PROP_INTRA_ONLY (1 << 0) -/** - * Codec supports lossy compression. Audio and video codecs only. - * @note a codec may support both lossy and lossless - * compression modes - */ -#define AV_CODEC_PROP_LOSSY (1 << 1) -/** - * Codec supports lossless compression. Audio and video codecs only. - */ -#define AV_CODEC_PROP_LOSSLESS (1 << 2) -/** - * Subtitle codec is bitmap based - * Decoded AVSubtitle data can be read from the AVSubtitleRect->pict field. - */ -#define AV_CODEC_PROP_BITMAP_SUB (1 << 16) -/** - * Subtitle codec is text based. - * Decoded AVSubtitle data can be read from the AVSubtitleRect->ass field. - */ -#define AV_CODEC_PROP_TEXT_SUB (1 << 17) - -/** - * @ingroup lavc_decoding - * Required number of additionally allocated bytes at the end of the input bitstream for decoding. - * This is mainly needed because some optimized bitstream readers read - * 32 or 64 bit at once and could read over the end.
- * Note: If the first 23 bits of the additional bytes are not 0, then damaged - * MPEG bitstreams could cause overread and segfault. - */ -#define FF_INPUT_BUFFER_PADDING_SIZE 16 - -/** - * @ingroup lavc_encoding - * minimum encoding buffer size - * Used to avoid some checks during header writing. - */ -#define FF_MIN_BUFFER_SIZE 16384 - - -/** - * @ingroup lavc_encoding - * motion estimation type. - */ -enum Motion_Est_ID { - ME_ZERO = 1, ///< no search, that is use 0,0 vector whenever one is needed - ME_FULL, - ME_LOG, - ME_PHODS, - ME_EPZS, ///< enhanced predictive zonal search - ME_X1, ///< reserved for experiments - ME_HEX, ///< hexagon based search - ME_UMH, ///< uneven multi-hexagon search - ME_TESA, ///< transformed exhaustive search algorithm - ME_ITER=50, ///< iterative search -}; - -/** - * @ingroup lavc_decoding - */ -enum AVDiscard{ - /* We leave some space between them for extensions (drop some - * keyframes for intra-only or drop just some bidir frames). */ - AVDISCARD_NONE =-16, ///< discard nothing - AVDISCARD_DEFAULT = 0, ///< discard useless packets like 0 size packets in avi - AVDISCARD_NONREF = 8, ///< discard all non reference - AVDISCARD_BIDIR = 16, ///< discard all bidirectional frames - AVDISCARD_NONKEY = 32, ///< discard all frames except keyframes - AVDISCARD_ALL = 48, ///< discard all -}; - -enum AVColorPrimaries{ - AVCOL_PRI_BT709 = 1, ///< also ITU-R BT1361 / IEC 61966-2-4 / SMPTE RP177 Annex B - AVCOL_PRI_UNSPECIFIED = 2, - AVCOL_PRI_BT470M = 4, - AVCOL_PRI_BT470BG = 5, ///< also ITU-R BT601-6 625 / ITU-R BT1358 625 / ITU-R BT1700 625 PAL & SECAM - AVCOL_PRI_SMPTE170M = 6, ///< also ITU-R BT601-6 525 / ITU-R BT1358 525 / ITU-R BT1700 NTSC - AVCOL_PRI_SMPTE240M = 7, ///< functionally identical to above - AVCOL_PRI_FILM = 8, - AVCOL_PRI_BT2020 = 9, ///< ITU-R BT2020 - AVCOL_PRI_NB , ///< Not part of ABI -}; - -enum AVColorTransferCharacteristic{ - AVCOL_TRC_BT709 = 1, ///< also ITU-R BT1361 - AVCOL_TRC_UNSPECIFIED = 2, - AVCOL_TRC_GAMMA22 = 4, ///< also ITU-R BT470M / ITU-R BT1700 625 PAL & SECAM - AVCOL_TRC_GAMMA28 = 5, ///< also ITU-R BT470BG - AVCOL_TRC_SMPTE170M = 6, ///< also ITU-R BT601-6 525 or 625 / ITU-R BT1358 525 or 625 / ITU-R BT1700 NTSC - AVCOL_TRC_SMPTE240M = 7, - AVCOL_TRC_LINEAR = 8, ///< "Linear transfer characteristics" - AVCOL_TRC_LOG = 9, ///< "Logarithmic transfer characteristic (100:1 range)" - AVCOL_TRC_LOG_SQRT = 10, ///< "Logarithmic transfer characteristic (100 * Sqrt( 10 ) : 1 range)" - AVCOL_TRC_IEC61966_2_4 = 11, ///< IEC 61966-2-4 - AVCOL_TRC_BT1361_ECG = 12, ///< ITU-R BT1361 Extended Colour Gamut - AVCOL_TRC_IEC61966_2_1 = 13, ///< IEC 61966-2-1 (sRGB or sYCC) - AVCOL_TRC_BT2020_10 = 14, ///< ITU-R BT2020 for 10 bit system - AVCOL_TRC_BT2020_12 = 15, ///< ITU-R BT2020 for 12 bit system - AVCOL_TRC_NB , ///< Not part of ABI -}; - -/** - * X X 3 4 X X are luma samples, - * 1 2 1-6 are possible chroma positions - * X X 5 6 X 0 is undefined/unknown position - */ -enum AVChromaLocation{ - AVCHROMA_LOC_UNSPECIFIED = 0, - AVCHROMA_LOC_LEFT = 1, ///< mpeg2/4, h264 default - AVCHROMA_LOC_CENTER = 2, ///< mpeg1, jpeg, h263 - AVCHROMA_LOC_TOPLEFT = 3, ///< DV - AVCHROMA_LOC_TOP = 4, - AVCHROMA_LOC_BOTTOMLEFT = 5, - AVCHROMA_LOC_BOTTOM = 6, - AVCHROMA_LOC_NB , ///< Not part of ABI -}; - -enum AVAudioServiceType { - AV_AUDIO_SERVICE_TYPE_MAIN = 0, - AV_AUDIO_SERVICE_TYPE_EFFECTS = 1, - AV_AUDIO_SERVICE_TYPE_VISUALLY_IMPAIRED = 2, - AV_AUDIO_SERVICE_TYPE_HEARING_IMPAIRED = 3, - AV_AUDIO_SERVICE_TYPE_DIALOGUE = 4, - AV_AUDIO_SERVICE_TYPE_COMMENTARY = 5, - AV_AUDIO_SERVICE_TYPE_EMERGENCY = 6, - AV_AUDIO_SERVICE_TYPE_VOICE_OVER = 7, - AV_AUDIO_SERVICE_TYPE_KARAOKE = 8, - AV_AUDIO_SERVICE_TYPE_NB , ///< Not part of ABI -}; - -/** - * @ingroup lavc_encoding - */ -typedef struct RcOverride{ - int start_frame; - int end_frame; - int qscale; // If this is 0 then quality_factor will be used instead. - float quality_factor; -} RcOverride; - -#if FF_API_MAX_BFRAMES -/** - * @deprecated there is no libavcodec-wide limit on the number of B-frames - */ -#define FF_MAX_B_FRAMES 16 -#endif - -/* encoding support - These flags can be passed in AVCodecContext.flags before initialization. - Note: Not everything is supported yet. -*/ - -/** - * Allow decoders to produce frames with data planes that are not aligned - * to CPU requirements (e.g. due to cropping). - */ -#define CODEC_FLAG_UNALIGNED 0x0001 -#define CODEC_FLAG_QSCALE 0x0002 ///< Use fixed qscale. -#define CODEC_FLAG_4MV 0x0004 ///< 4 MV per MB allowed / advanced prediction for H.263. -#define CODEC_FLAG_OUTPUT_CORRUPT 0x0008 ///< Output even those frames that might be corrupted -#define CODEC_FLAG_QPEL 0x0010 ///< Use qpel MC. -#if FF_API_GMC -/** - * @deprecated use the "gmc" private option of the libxvid encoder - */ -#define CODEC_FLAG_GMC 0x0020 ///< Use GMC. -#endif -#if FF_API_MV0 -/** - * @deprecated use the flag "mv0" in the "mpv_flags" private option of the - * mpegvideo encoders - */ -#define CODEC_FLAG_MV0 0x0040 -#endif -#if FF_API_INPUT_PRESERVED -/** - * @deprecated passing reference-counted frames to the encoders replaces this - * flag - */ -#define CODEC_FLAG_INPUT_PRESERVED 0x0100 -#endif -#define CODEC_FLAG_PASS1 0x0200 ///< Use internal 2pass ratecontrol in first pass mode. -#define CODEC_FLAG_PASS2 0x0400 ///< Use internal 2pass ratecontrol in second pass mode. -#define CODEC_FLAG_GRAY 0x2000 ///< Only decode/encode grayscale. -#if FF_API_EMU_EDGE -/** - * @deprecated edges are not used/required anymore. I.e. this flag is now always - * set. - */ -#define CODEC_FLAG_EMU_EDGE 0x4000 -#endif -#define CODEC_FLAG_PSNR 0x8000 ///< error[?] variables will be set during encoding. -#define CODEC_FLAG_TRUNCATED 0x00010000 /** Input bitstream might be truncated at a random - location instead of only at frame boundaries. */ -#if FF_API_NORMALIZE_AQP -/** - * @deprecated use the flag "naq" in the "mpv_flags" private option of the - * mpegvideo encoders - */ -#define CODEC_FLAG_NORMALIZE_AQP 0x00020000 -#endif -#define CODEC_FLAG_INTERLACED_DCT 0x00040000 ///< Use interlaced DCT. -#define CODEC_FLAG_LOW_DELAY 0x00080000 ///< Force low delay. -#define CODEC_FLAG_GLOBAL_HEADER 0x00400000 ///< Place global headers in extradata instead of every keyframe. -#define CODEC_FLAG_BITEXACT 0x00800000 ///< Use only bitexact stuff (except (I)DCT). -/* Fx : Flag for h263+ extra options */ -#define CODEC_FLAG_AC_PRED 0x01000000 ///< H.263 advanced intra coding / MPEG-4 AC prediction -#define CODEC_FLAG_LOOP_FILTER 0x00000800 ///< loop filter -#define CODEC_FLAG_INTERLACED_ME 0x20000000 ///< interlaced motion estimation -#define CODEC_FLAG_CLOSED_GOP 0x80000000 -#define CODEC_FLAG2_FAST 0x00000001 ///< Allow non spec compliant speedup tricks. -#define CODEC_FLAG2_NO_OUTPUT 0x00000004 ///< Skip bitstream encoding. -#define CODEC_FLAG2_LOCAL_HEADER 0x00000008 ///< Place global headers at every keyframe instead of in extradata. -#define CODEC_FLAG2_DROP_FRAME_TIMECODE 0x00002000 ///< timecode is in drop frame format. DEPRECATED!!!! -#define CODEC_FLAG2_IGNORE_CROP 0x00010000 ///< Discard cropping information from SPS. - -#define CODEC_FLAG2_CHUNKS 0x00008000 ///< Input bitstream might be truncated at a packet boundaries instead of only at frame boundaries. -#define CODEC_FLAG2_SHOW_ALL 0x00400000 ///< Show all frames before the first keyframe - -/* Unsupported options : - * Syntax Arithmetic coding (SAC) - * Reference Picture Selection - * Independent Segment Decoding */ -/* /Fx */ -/* codec capabilities */ - -#define CODEC_CAP_DRAW_HORIZ_BAND 0x0001 ///< Decoder can use draw_horiz_band callback. -/** - * Codec uses get_buffer() for allocating buffers and supports custom allocators. - * If not set, it might not use get_buffer() at all or use operations that - * assume the buffer was allocated by avcodec_default_get_buffer. - */ -#define CODEC_CAP_DR1 0x0002 -#define CODEC_CAP_TRUNCATED 0x0008 -#if FF_API_XVMC -/* Codec can export data for HW decoding. This flag indicates that - * the codec would call get_format() with list that might contain HW accelerated - * pixel formats (XvMC, VDPAU, VAAPI, etc). The application can pick any of them - * including raw image format. - * The application can use the passed context to determine bitstream version, - * chroma format, resolution etc. - */ -#define CODEC_CAP_HWACCEL 0x0010 -#endif /* FF_API_XVMC */ -/** - * Encoder or decoder requires flushing with NULL input at the end in order to - * give the complete and correct output. - * - * NOTE: If this flag is not set, the codec is guaranteed to never be fed with - * with NULL data. The user can still send NULL data to the public encode - * or decode function, but libavcodec will not pass it along to the codec - * unless this flag is set. - * - * Decoders: - * The decoder has a non-zero delay and needs to be fed with avpkt->data=NULL, - * avpkt->size=0 at the end to get the delayed data until the decoder no longer - * returns frames. - * - * Encoders: - * The encoder needs to be fed with NULL data at the end of encoding until the - * encoder no longer returns data. - * - * NOTE: For encoders implementing the AVCodec.encode2() function, setting this - * flag also means that the encoder must set the pts and duration for - * each output packet. If this flag is not set, the pts and duration will - * be determined by libavcodec from the input frame. - */ -#define CODEC_CAP_DELAY 0x0020 -/** - * Codec can be fed a final frame with a smaller size. - * This can be used to prevent truncation of the last audio samples. - */ -#define CODEC_CAP_SMALL_LAST_FRAME 0x0040 -#if FF_API_CAP_VDPAU -/** - * Codec can export data for HW decoding (VDPAU). - */ -#define CODEC_CAP_HWACCEL_VDPAU 0x0080 -#endif -/** - * Codec can output multiple frames per AVPacket - * Normally demuxers return one frame at a time, demuxers which do not do - * are connected to a parser to split what they return into proper frames. - * This flag is reserved to the very rare category of codecs which have a - * bitstream that cannot be split into frames without timeconsuming - * operations like full decoding. Demuxers carring such bitstreams thus - * may return multiple frames in a packet. This has many disadvantages like - * prohibiting stream copy in many cases thus it should only be considered - * as a last resort. - */ -#define CODEC_CAP_SUBFRAMES 0x0100 -/** - * Codec is experimental and is thus avoided in favor of non experimental - * encoders - */ -#define CODEC_CAP_EXPERIMENTAL 0x0200 -/** - * Codec should fill in channel configuration and samplerate instead of container - */ -#define CODEC_CAP_CHANNEL_CONF 0x0400 -#if FF_API_NEG_LINESIZES -/** - * @deprecated no codecs use this capability - */ -#define CODEC_CAP_NEG_LINESIZES 0x0800 -#endif -/** - * Codec supports frame-level multithreading. - */ -#define CODEC_CAP_FRAME_THREADS 0x1000 -/** - * Codec supports slice-based (or partition-based) multithreading. - */ -#define CODEC_CAP_SLICE_THREADS 0x2000 -/** - * Codec supports changed parameters at any point. - */ -#define CODEC_CAP_PARAM_CHANGE 0x4000 -/** - * Codec supports avctx->thread_count == 0 (auto). - */ -#define CODEC_CAP_AUTO_THREADS 0x8000 -/** - * Audio encoder supports receiving a different number of samples in each call. - */ -#define CODEC_CAP_VARIABLE_FRAME_SIZE 0x10000 -/** - * Codec is intra only. - */ -#define CODEC_CAP_INTRA_ONLY 0x40000000 -/** - * Codec is lossless. - */ -#define CODEC_CAP_LOSSLESS 0x80000000 - -#if FF_API_MB_TYPE -//The following defines may change, don't expect compatibility if you use them. -#define MB_TYPE_INTRA4x4 0x0001 -#define MB_TYPE_INTRA16x16 0x0002 //FIXME H.264-specific -#define MB_TYPE_INTRA_PCM 0x0004 //FIXME H.264-specific -#define MB_TYPE_16x16 0x0008 -#define MB_TYPE_16x8 0x0010 -#define MB_TYPE_8x16 0x0020 -#define MB_TYPE_8x8 0x0040 -#define MB_TYPE_INTERLACED 0x0080 -#define MB_TYPE_DIRECT2 0x0100 //FIXME -#define MB_TYPE_ACPRED 0x0200 -#define MB_TYPE_GMC 0x0400 -#define MB_TYPE_SKIP 0x0800 -#define MB_TYPE_P0L0 0x1000 -#define MB_TYPE_P1L0 0x2000 -#define MB_TYPE_P0L1 0x4000 -#define MB_TYPE_P1L1 0x8000 -#define MB_TYPE_L0 (MB_TYPE_P0L0 | MB_TYPE_P1L0) -#define MB_TYPE_L1 (MB_TYPE_P0L1 | MB_TYPE_P1L1) -#define MB_TYPE_L0L1 (MB_TYPE_L0 | MB_TYPE_L1) -#define MB_TYPE_QUANT 0x00010000 -#define MB_TYPE_CBP 0x00020000 -//Note bits 24-31 are reserved for codec specific use (h264 ref0, mpeg1 0mv, ...) -#endif - -/** - * Pan Scan area. - * This specifies the area which should be displayed. - * Note there may be multiple such areas for one frame. - */ -typedef struct AVPanScan{ - /** - * id - * - encoding: Set by user. - * - decoding: Set by libavcodec. - */ - int id; - - /** - * width and height in 1/16 pel - * - encoding: Set by user. - * - decoding: Set by libavcodec. - */ - int width; - int height; - - /** - * position of the top left corner in 1/16 pel for up to 3 fields/frames - * - encoding: Set by user. - * - decoding: Set by libavcodec. - */ - int16_t position[3][2]; -}AVPanScan; - -#if FF_API_QSCALE_TYPE -#define FF_QSCALE_TYPE_MPEG1 0 -#define FF_QSCALE_TYPE_MPEG2 1 -#define FF_QSCALE_TYPE_H264 2 -#define FF_QSCALE_TYPE_VP56 3 -#endif - -#if FF_API_GET_BUFFER -#define FF_BUFFER_TYPE_INTERNAL 1 -#define FF_BUFFER_TYPE_USER 2 ///< direct rendering buffers (image is (de)allocated by user) -#define FF_BUFFER_TYPE_SHARED 4 ///< Buffer from somewhere else; don't deallocate image (data/base), all other tables are not shared. -#define FF_BUFFER_TYPE_COPY 8 ///< Just a (modified) copy of some other buffer, don't deallocate anything. - -#define FF_BUFFER_HINTS_VALID 0x01 // Buffer hints value is meaningful (if 0 ignore). -#define FF_BUFFER_HINTS_READABLE 0x02 // Codec will read from buffer. -#define FF_BUFFER_HINTS_PRESERVE 0x04 // User must not alter buffer content. -#define FF_BUFFER_HINTS_REUSABLE 0x08 // Codec will reuse the buffer (update). -#endif - -/** - * The decoder will keep a reference to the frame and may reuse it later. - */ -#define AV_GET_BUFFER_FLAG_REF (1 << 0) - -/** - * @defgroup lavc_packet AVPacket - * - * Types and functions for working with AVPacket. - * @{ - */ -enum AVPacketSideDataType { - AV_PKT_DATA_PALETTE, - AV_PKT_DATA_NEW_EXTRADATA, - - /** - * An AV_PKT_DATA_PARAM_CHANGE side data packet is laid out as follows: - * @code - * u32le param_flags - * if (param_flags & AV_SIDE_DATA_PARAM_CHANGE_CHANNEL_COUNT) - * s32le channel_count - * if (param_flags & AV_SIDE_DATA_PARAM_CHANGE_CHANNEL_LAYOUT) - * u64le channel_layout - * if (param_flags & AV_SIDE_DATA_PARAM_CHANGE_SAMPLE_RATE) - * s32le sample_rate - * if (param_flags & AV_SIDE_DATA_PARAM_CHANGE_DIMENSIONS) - * s32le width - * s32le height - * @endcode - */ - AV_PKT_DATA_PARAM_CHANGE, - - /** - * An AV_PKT_DATA_H263_MB_INFO side data packet contains a number of - * structures with info about macroblocks relevant to splitting the - * packet into smaller packets on macroblock edges (e.g. as for RFC 2190). - * That is, it does not necessarily contain info about all macroblocks, - * as long as the distance between macroblocks in the info is smaller - * than the target payload size. - * Each MB info structure is 12 bytes, and is laid out as follows: - * @code - * u32le bit offset from the start of the packet - * u8 current quantizer at the start of the macroblock - * u8 GOB number - * u16le macroblock address within the GOB - * u8 horizontal MV predictor - * u8 vertical MV predictor - * u8 horizontal MV predictor for block number 3 - * u8 vertical MV predictor for block number 3 - * @endcode - */ - AV_PKT_DATA_H263_MB_INFO, - - /** - * This side data should be associated with an audio stream and contains - * ReplayGain information in form of the AVReplayGain struct. - */ - AV_PKT_DATA_REPLAYGAIN, - - /** - * Recommmends skipping the specified number of samples - * @code - * u32le number of samples to skip from start of this packet - * u32le number of samples to skip from end of this packet - * u8 reason for start skip - * u8 reason for end skip (0=padding silence, 1=convergence) - * @endcode - */ - AV_PKT_DATA_SKIP_SAMPLES=70, - - /** - * An AV_PKT_DATA_JP_DUALMONO side data packet indicates that - * the packet may contain "dual mono" audio specific to Japanese DTV - * and if it is true, recommends only the selected channel to be used. - * @code - * u8 selected channels (0=mail/left, 1=sub/right, 2=both) - * @endcode - */ - AV_PKT_DATA_JP_DUALMONO, - - /** - * A list of zero terminated key/value strings. There is no end marker for - * the list, so it is required to rely on the side data size to stop. - */ - AV_PKT_DATA_STRINGS_METADATA, - - /** - * Subtitle event position - * @code - * u32le x1 - * u32le y1 - * u32le x2 - * u32le y2 - * @endcode - */ - AV_PKT_DATA_SUBTITLE_POSITION, - - /** - * Data found in BlockAdditional element of matroska container. There is - * no end marker for the data, so it is required to rely on the side data - * size to recognize the end. 8 byte id (as found in BlockAddId) followed - * by data. - */ - AV_PKT_DATA_MATROSKA_BLOCKADDITIONAL, - - /** - * The optional first identifier line of a WebVTT cue. - */ - AV_PKT_DATA_WEBVTT_IDENTIFIER, - - /** - * The optional settings (rendering instructions) that immediately - * follow the timestamp specifier of a WebVTT cue. - */ - AV_PKT_DATA_WEBVTT_SETTINGS, - - /** - * A list of zero terminated key/value strings. There is no end marker for - * the list, so it is required to rely on the side data size to stop. This - * side data includes updated metadata which appeared in the stream. - */ - AV_PKT_DATA_METADATA_UPDATE, -}; - -typedef struct AVPacketSideData { - uint8_t *data; - int size; - enum AVPacketSideDataType type; -} AVPacketSideData; - -/** - * This structure stores compressed data. It is typically exported by demuxers - * and then passed as input to decoders, or received as output from encoders and - * then passed to muxers. - * - * For video, it should typically contain one compressed frame. For audio it may - * contain several compressed frames. - * - * AVPacket is one of the few structs in FFmpeg, whose size is a part of public - * ABI. Thus it may be allocated on stack and no new fields can be added to it - * without libavcodec and libavformat major bump. - * - * The semantics of data ownership depends on the buf or destruct (deprecated) - * fields. If either is set, the packet data is dynamically allocated and is - * valid indefinitely until av_free_packet() is called (which in turn calls - * av_buffer_unref()/the destruct callback to free the data). If neither is set, - * the packet data is typically backed by some static buffer somewhere and is - * only valid for a limited time (e.g. until the next read call when demuxing). - * - * The side data is always allocated with av_malloc() and is freed in - * av_free_packet(). - */ -typedef struct AVPacket { - /** - * A reference to the reference-counted buffer where the packet data is - * stored. - * May be NULL, then the packet data is not reference-counted. - */ - AVBufferRef *buf; - /** - * Presentation timestamp in AVStream->time_base units; the time at which - * the decompressed packet will be presented to the user. - * Can be AV_NOPTS_VALUE if it is not stored in the file. - * pts MUST be larger or equal to dts as presentation cannot happen before - * decompression, unless one wants to view hex dumps. Some formats misuse - * the terms dts and pts/cts to mean something different. Such timestamps - * must be converted to true pts/dts before they are stored in AVPacket. - */ - int64_t pts; - /** - * Decompression timestamp in AVStream->time_base units; the time at which - * the packet is decompressed. - * Can be AV_NOPTS_VALUE if it is not stored in the file. - */ - int64_t dts; - uint8_t *data; - int size; - int stream_index; - /** - * A combination of AV_PKT_FLAG values - */ - int flags; - /** - * Additional packet data that can be provided by the container. - * Packet can contain several types of side information. - */ - AVPacketSideData *side_data; - int side_data_elems; - - /** - * Duration of this packet in AVStream->time_base units, 0 if unknown. - * Equals next_pts - this_pts in presentation order. - */ - int duration; -#if FF_API_DESTRUCT_PACKET - attribute_deprecated - void (*destruct)(struct AVPacket *); - attribute_deprecated - void *priv; -#endif - int64_t pos; ///< byte position in stream, -1 if unknown - - /** - * Time difference in AVStream->time_base units from the pts of this - * packet to the point at which the output from the decoder has converged - * independent from the availability of previous frames. That is, the - * frames are virtually identical no matter if decoding started from - * the very first frame or from this keyframe. - * Is AV_NOPTS_VALUE if unknown. - * This field is not the display duration of the current packet. - * This field has no meaning if the packet does not have AV_PKT_FLAG_KEY - * set. - * - * The purpose of this field is to allow seeking in streams that have no - * keyframes in the conventional sense. It corresponds to the - * recovery point SEI in H.264 and match_time_delta in NUT. It is also - * essential for some types of subtitle streams to ensure that all - * subtitles are correctly displayed after seeking. - */ - int64_t convergence_duration; -} AVPacket; -#define AV_PKT_FLAG_KEY 0x0001 ///< The packet contains a keyframe -#define AV_PKT_FLAG_CORRUPT 0x0002 ///< The packet content is corrupted - -enum AVSideDataParamChangeFlags { - AV_SIDE_DATA_PARAM_CHANGE_CHANNEL_COUNT = 0x0001, - AV_SIDE_DATA_PARAM_CHANGE_CHANNEL_LAYOUT = 0x0002, - AV_SIDE_DATA_PARAM_CHANGE_SAMPLE_RATE = 0x0004, - AV_SIDE_DATA_PARAM_CHANGE_DIMENSIONS = 0x0008, -}; -/** - * @} - */ - -struct AVCodecInternal; - -enum AVFieldOrder { - AV_FIELD_UNKNOWN, - AV_FIELD_PROGRESSIVE, - AV_FIELD_TT, //< Top coded_first, top displayed first - AV_FIELD_BB, //< Bottom coded first, bottom displayed first - AV_FIELD_TB, //< Top coded first, bottom displayed first - AV_FIELD_BT, //< Bottom coded first, top displayed first -}; - -/** - * main external API structure. - * New fields can be added to the end with minor version bumps. - * Removal, reordering and changes to existing fields require a major - * version bump. - * Please use AVOptions (av_opt* / av_set/get*()) to access these fields from user - * applications. - * sizeof(AVCodecContext) must not be used outside libav*. - */ -typedef struct AVCodecContext { - /** - * information on struct for av_log - * - set by avcodec_alloc_context3 - */ - const AVClass *av_class; - int log_level_offset; - - enum AVMediaType codec_type; /* see AVMEDIA_TYPE_xxx */ - const struct AVCodec *codec; -#if FF_API_CODEC_NAME - /** - * @deprecated this field is not used for anything in libavcodec - */ - attribute_deprecated - char codec_name[32]; -#endif - enum AVCodecID codec_id; /* see AV_CODEC_ID_xxx */ - - /** - * fourcc (LSB first, so "ABCD" -> ('D'<<24) + ('C'<<16) + ('B'<<8) + 'A'). - * This is used to work around some encoder bugs. - * A demuxer should set this to what is stored in the field used to identify the codec. - * If there are multiple such fields in a container then the demuxer should choose the one - * which maximizes the information about the used codec. - * If the codec tag field in a container is larger than 32 bits then the demuxer should - * remap the longer ID to 32 bits with a table or other structure. Alternatively a new - * extra_codec_tag + size could be added but for this a clear advantage must be demonstrated - * first. - * - encoding: Set by user, if not then the default based on codec_id will be used. - * - decoding: Set by user, will be converted to uppercase by libavcodec during init. - */ - unsigned int codec_tag; - - /** - * fourcc from the AVI stream header (LSB first, so "ABCD" -> ('D'<<24) + ('C'<<16) + ('B'<<8) + 'A'). - * This is used to work around some encoder bugs. - * - encoding: unused - * - decoding: Set by user, will be converted to uppercase by libavcodec during init. - */ - unsigned int stream_codec_tag; - - void *priv_data; - - /** - * Private context used for internal data. - * - * Unlike priv_data, this is not codec-specific. It is used in general - * libavcodec functions. - */ - struct AVCodecInternal *internal; - - /** - * Private data of the user, can be used to carry app specific stuff. - * - encoding: Set by user. - * - decoding: Set by user. - */ - void *opaque; - - /** - * the average bitrate - * - encoding: Set by user; unused for constant quantizer encoding. - * - decoding: Set by libavcodec. 0 or some bitrate if this info is available in the stream. - */ - int bit_rate; - - /** - * number of bits the bitstream is allowed to diverge from the reference. - * the reference can be CBR (for CBR pass1) or VBR (for pass2) - * - encoding: Set by user; unused for constant quantizer encoding. - * - decoding: unused - */ - int bit_rate_tolerance; - - /** - * Global quality for codecs which cannot change it per frame. - * This should be proportional to MPEG-1/2/4 qscale. - * - encoding: Set by user. - * - decoding: unused - */ - int global_quality; - - /** - * - encoding: Set by user. - * - decoding: unused - */ - int compression_level; -#define FF_COMPRESSION_DEFAULT -1 - - /** - * CODEC_FLAG_*. - * - encoding: Set by user. - * - decoding: Set by user. - */ - int flags; - - /** - * CODEC_FLAG2_* - * - encoding: Set by user. - * - decoding: Set by user. - */ - int flags2; - - /** - * some codecs need / can use extradata like Huffman tables. - * mjpeg: Huffman tables - * rv10: additional flags - * mpeg4: global headers (they can be in the bitstream or here) - * The allocated memory should be FF_INPUT_BUFFER_PADDING_SIZE bytes larger - * than extradata_size to avoid problems if it is read with the bitstream reader. - * The bytewise contents of extradata must not depend on the architecture or CPU endianness. - * - encoding: Set/allocated/freed by libavcodec. - * - decoding: Set/allocated/freed by user. - */ - uint8_t *extradata; - int extradata_size; - - /** - * This is the fundamental unit of time (in seconds) in terms - * of which frame timestamps are represented. For fixed-fps content, - * timebase should be 1/framerate and timestamp increments should be - * identically 1. - * - encoding: MUST be set by user. - * - decoding: Set by libavcodec. - */ - AVRational time_base; - - /** - * For some codecs, the time base is closer to the field rate than the frame rate. - * Most notably, H.264 and MPEG-2 specify time_base as half of frame duration - * if no telecine is used ... - * - * Set to time_base ticks per frame. Default 1, e.g., H.264/MPEG-2 set it to 2. - */ - int ticks_per_frame; - - /** - * Codec delay. - * - * Encoding: Number of frames delay there will be from the encoder input to - * the decoder output. (we assume the decoder matches the spec) - * Decoding: Number of frames delay in addition to what a standard decoder - * as specified in the spec would produce. - * - * Video: - * Number of frames the decoded output will be delayed relative to the - * encoded input. - * - * Audio: - * For encoding, this is the number of "priming" samples added by the - * encoder to the beginning of the stream. The decoded output will be - * delayed by this many samples relative to the input to the encoder (or - * more, if the decoder adds its own padding). - * The timestamps on the output packets are adjusted by the encoder so - * that they always refer to the first sample of the data actually - * contained in the packet, including any added padding. - * E.g. if the timebase is 1/samplerate and the timestamp of the first - * input sample is 0, the timestamp of the first output packet will be - * -delay. - * - * For decoding, this is the number of samples the decoder needs to - * output before the decoder's output is valid. When seeking, you should - * start decoding this many samples prior to your desired seek point. - * - * - encoding: Set by libavcodec. - * - decoding: Set by libavcodec. - */ - int delay; - - - /* video only */ - /** - * picture width / height. - * - encoding: MUST be set by user. - * - decoding: May be set by the user before opening the decoder if known e.g. - * from the container. Some decoders will require the dimensions - * to be set by the caller. During decoding, the decoder may - * overwrite those values as required. - */ - int width, height; - - /** - * Bitstream width / height, may be different from width/height e.g. when - * the decoded frame is cropped before being output or lowres is enabled. - * - encoding: unused - * - decoding: May be set by the user before opening the decoder if known - * e.g. from the container. During decoding, the decoder may - * overwrite those values as required. - */ - int coded_width, coded_height; - -#if FF_API_ASPECT_EXTENDED -#define FF_ASPECT_EXTENDED 15 -#endif - - /** - * the number of pictures in a group of pictures, or 0 for intra_only - * - encoding: Set by user. - * - decoding: unused - */ - int gop_size; - - /** - * Pixel format, see AV_PIX_FMT_xxx. - * May be set by the demuxer if known from headers. - * May be overridden by the decoder if it knows better. - * - encoding: Set by user. - * - decoding: Set by user if known, overridden by libavcodec if known - */ - enum AVPixelFormat pix_fmt; - - /** - * Motion estimation algorithm used for video coding. - * 1 (zero), 2 (full), 3 (log), 4 (phods), 5 (epzs), 6 (x1), 7 (hex), - * 8 (umh), 9 (iter), 10 (tesa) [7, 8, 10 are x264 specific, 9 is snow specific] - * - encoding: MUST be set by user. - * - decoding: unused - */ - int me_method; - - /** - * If non NULL, 'draw_horiz_band' is called by the libavcodec - * decoder to draw a horizontal band. It improves cache usage. Not - * all codecs can do that. You must check the codec capabilities - * beforehand. - * When multithreading is used, it may be called from multiple threads - * at the same time; threads might draw different parts of the same AVFrame, - * or multiple AVFrames, and there is no guarantee that slices will be drawn - * in order. - * The function is also used by hardware acceleration APIs. - * It is called at least once during frame decoding to pass - * the data needed for hardware render. - * In that mode instead of pixel data, AVFrame points to - * a structure specific to the acceleration API. The application - * reads the structure and can change some fields to indicate progress - * or mark state. - * - encoding: unused - * - decoding: Set by user. - * @param height the height of the slice - * @param y the y position of the slice - * @param type 1->top field, 2->bottom field, 3->frame - * @param offset offset into the AVFrame.data from which the slice should be read - */ - void (*draw_horiz_band)(struct AVCodecContext *s, - const AVFrame *src, int offset[AV_NUM_DATA_POINTERS], - int y, int type, int height); - - /** - * callback to negotiate the pixelFormat - * @param fmt is the list of formats which are supported by the codec, - * it is terminated by -1 as 0 is a valid format, the formats are ordered by quality. - * The first is always the native one. - * @return the chosen format - * - encoding: unused - * - decoding: Set by user, if not set the native format will be chosen. - */ - enum AVPixelFormat (*get_format)(struct AVCodecContext *s, const enum AVPixelFormat * fmt); - - /** - * maximum number of B-frames between non-B-frames - * Note: The output will be delayed by max_b_frames+1 relative to the input. - * - encoding: Set by user. - * - decoding: unused - */ - int max_b_frames; - - /** - * qscale factor between IP and B-frames - * If > 0 then the last P-frame quantizer will be used (q= lastp_q*factor+offset). - * If < 0 then normal ratecontrol will be done (q= -normal_q*factor+offset). - * - encoding: Set by user. - * - decoding: unused - */ - float b_quant_factor; - - /** obsolete FIXME remove */ - int rc_strategy; -#define FF_RC_STRATEGY_XVID 1 - - int b_frame_strategy; - - /** - * qscale offset between IP and B-frames - * - encoding: Set by user. - * - decoding: unused - */ - float b_quant_offset; - - /** - * Size of the frame reordering buffer in the decoder. - * For MPEG-2 it is 1 IPB or 0 low delay IP. - * - encoding: Set by libavcodec. - * - decoding: Set by libavcodec. - */ - int has_b_frames; - - /** - * 0-> h263 quant 1-> mpeg quant - * - encoding: Set by user. - * - decoding: unused - */ - int mpeg_quant; - - /** - * qscale factor between P and I-frames - * If > 0 then the last p frame quantizer will be used (q= lastp_q*factor+offset). - * If < 0 then normal ratecontrol will be done (q= -normal_q*factor+offset). - * - encoding: Set by user. - * - decoding: unused - */ - float i_quant_factor; - - /** - * qscale offset between P and I-frames - * - encoding: Set by user. - * - decoding: unused - */ - float i_quant_offset; - - /** - * luminance masking (0-> disabled) - * - encoding: Set by user. - * - decoding: unused - */ - float lumi_masking; - - /** - * temporary complexity masking (0-> disabled) - * - encoding: Set by user. - * - decoding: unused - */ - float temporal_cplx_masking; - - /** - * spatial complexity masking (0-> disabled) - * - encoding: Set by user. - * - decoding: unused - */ - float spatial_cplx_masking; - - /** - * p block masking (0-> disabled) - * - encoding: Set by user. - * - decoding: unused - */ - float p_masking; - - /** - * darkness masking (0-> disabled) - * - encoding: Set by user. - * - decoding: unused - */ - float dark_masking; - - /** - * slice count - * - encoding: Set by libavcodec. - * - decoding: Set by user (or 0). - */ - int slice_count; - /** - * prediction method (needed for huffyuv) - * - encoding: Set by user. - * - decoding: unused - */ - int prediction_method; -#define FF_PRED_LEFT 0 -#define FF_PRED_PLANE 1 -#define FF_PRED_MEDIAN 2 - - /** - * slice offsets in the frame in bytes - * - encoding: Set/allocated by libavcodec. - * - decoding: Set/allocated by user (or NULL). - */ - int *slice_offset; - - /** - * sample aspect ratio (0 if unknown) - * That is the width of a pixel divided by the height of the pixel. - * Numerator and denominator must be relatively prime and smaller than 256 for some video standards. - * - encoding: Set by user. - * - decoding: Set by libavcodec. - */ - AVRational sample_aspect_ratio; - - /** - * motion estimation comparison function - * - encoding: Set by user. - * - decoding: unused - */ - int me_cmp; - /** - * subpixel motion estimation comparison function - * - encoding: Set by user. - * - decoding: unused - */ - int me_sub_cmp; - /** - * macroblock comparison function (not supported yet) - * - encoding: Set by user. - * - decoding: unused - */ - int mb_cmp; - /** - * interlaced DCT comparison function - * - encoding: Set by user. - * - decoding: unused - */ - int ildct_cmp; -#define FF_CMP_SAD 0 -#define FF_CMP_SSE 1 -#define FF_CMP_SATD 2 -#define FF_CMP_DCT 3 -#define FF_CMP_PSNR 4 -#define FF_CMP_BIT 5 -#define FF_CMP_RD 6 -#define FF_CMP_ZERO 7 -#define FF_CMP_VSAD 8 -#define FF_CMP_VSSE 9 -#define FF_CMP_NSSE 10 -#define FF_CMP_W53 11 -#define FF_CMP_W97 12 -#define FF_CMP_DCTMAX 13 -#define FF_CMP_DCT264 14 -#define FF_CMP_CHROMA 256 - - /** - * ME diamond size & shape - * - encoding: Set by user. - * - decoding: unused - */ - int dia_size; - - /** - * amount of previous MV predictors (2a+1 x 2a+1 square) - * - encoding: Set by user. - * - decoding: unused - */ - int last_predictor_count; - - /** - * prepass for motion estimation - * - encoding: Set by user. - * - decoding: unused - */ - int pre_me; - - /** - * motion estimation prepass comparison function - * - encoding: Set by user. - * - decoding: unused - */ - int me_pre_cmp; - - /** - * ME prepass diamond size & shape - * - encoding: Set by user. - * - decoding: unused - */ - int pre_dia_size; - - /** - * subpel ME quality - * - encoding: Set by user. - * - decoding: unused - */ - int me_subpel_quality; - - /** - * DTG active format information (additional aspect ratio - * information only used in DVB MPEG-2 transport streams) - * 0 if not set. - * - * - encoding: unused - * - decoding: Set by decoder. - */ - int dtg_active_format; -#define FF_DTG_AFD_SAME 8 -#define FF_DTG_AFD_4_3 9 -#define FF_DTG_AFD_16_9 10 -#define FF_DTG_AFD_14_9 11 -#define FF_DTG_AFD_4_3_SP_14_9 13 -#define FF_DTG_AFD_16_9_SP_14_9 14 -#define FF_DTG_AFD_SP_4_3 15 - - /** - * maximum motion estimation search range in subpel units - * If 0 then no limit. - * - * - encoding: Set by user. - * - decoding: unused - */ - int me_range; - - /** - * intra quantizer bias - * - encoding: Set by user. - * - decoding: unused - */ - int intra_quant_bias; -#define FF_DEFAULT_QUANT_BIAS 999999 - - /** - * inter quantizer bias - * - encoding: Set by user. - * - decoding: unused - */ - int inter_quant_bias; - - /** - * slice flags - * - encoding: unused - * - decoding: Set by user. - */ - int slice_flags; -#define SLICE_FLAG_CODED_ORDER 0x0001 ///< draw_horiz_band() is called in coded order instead of display -#define SLICE_FLAG_ALLOW_FIELD 0x0002 ///< allow draw_horiz_band() with field slices (MPEG2 field pics) -#define SLICE_FLAG_ALLOW_PLANE 0x0004 ///< allow draw_horiz_band() with 1 component at a time (SVQ1) - -#if FF_API_XVMC - /** - * XVideo Motion Acceleration - * - encoding: forbidden - * - decoding: set by decoder - * @deprecated XvMC doesn't need it anymore. - */ - attribute_deprecated int xvmc_acceleration; -#endif /* FF_API_XVMC */ - - /** - * macroblock decision mode - * - encoding: Set by user. - * - decoding: unused - */ - int mb_decision; -#define FF_MB_DECISION_SIMPLE 0 ///< uses mb_cmp -#define FF_MB_DECISION_BITS 1 ///< chooses the one which needs the fewest bits -#define FF_MB_DECISION_RD 2 ///< rate distortion - - /** - * custom intra quantization matrix - * - encoding: Set by user, can be NULL. - * - decoding: Set by libavcodec. - */ - uint16_t *intra_matrix; - - /** - * custom inter quantization matrix - * - encoding: Set by user, can be NULL. - * - decoding: Set by libavcodec. - */ - uint16_t *inter_matrix; - - /** - * scene change detection threshold - * 0 is default, larger means fewer detected scene changes. - * - encoding: Set by user. - * - decoding: unused - */ - int scenechange_threshold; - - /** - * noise reduction strength - * - encoding: Set by user. - * - decoding: unused - */ - int noise_reduction; - - /** - * Motion estimation threshold below which no motion estimation is - * performed, but instead the user specified motion vectors are used. - * - * - encoding: Set by user. - * - decoding: unused - */ - int me_threshold; - - /** - * Macroblock threshold below which the user specified macroblock types will be used. - * - encoding: Set by user. - * - decoding: unused - */ - int mb_threshold; - - /** - * precision of the intra DC coefficient - 8 - * - encoding: Set by user. - * - decoding: unused - */ - int intra_dc_precision; - - /** - * Number of macroblock rows at the top which are skipped. - * - encoding: unused - * - decoding: Set by user. - */ - int skip_top; - - /** - * Number of macroblock rows at the bottom which are skipped. - * - encoding: unused - * - decoding: Set by user. - */ - int skip_bottom; - - /** - * Border processing masking, raises the quantizer for mbs on the borders - * of the picture. - * - encoding: Set by user. - * - decoding: unused - */ - float border_masking; - - /** - * minimum MB lagrange multipler - * - encoding: Set by user. - * - decoding: unused - */ - int mb_lmin; - - /** - * maximum MB lagrange multipler - * - encoding: Set by user. - * - decoding: unused - */ - int mb_lmax; - - /** - * - * - encoding: Set by user. - * - decoding: unused - */ - int me_penalty_compensation; - - /** - * - * - encoding: Set by user. - * - decoding: unused - */ - int bidir_refine; - - /** - * - * - encoding: Set by user. - * - decoding: unused - */ - int brd_scale; - - /** - * minimum GOP size - * - encoding: Set by user. - * - decoding: unused - */ - int keyint_min; - - /** - * number of reference frames - * - encoding: Set by user. - * - decoding: Set by lavc. - */ - int refs; - - /** - * chroma qp offset from luma - * - encoding: Set by user. - * - decoding: unused - */ - int chromaoffset; - - /** - * Multiplied by qscale for each frame and added to scene_change_score. - * - encoding: Set by user. - * - decoding: unused - */ - int scenechange_factor; - - /** - * - * Note: Value depends upon the compare function used for fullpel ME. - * - encoding: Set by user. - * - decoding: unused - */ - int mv0_threshold; - - /** - * Adjust sensitivity of b_frame_strategy 1. - * - encoding: Set by user. - * - decoding: unused - */ - int b_sensitivity; - - /** - * Chromaticity coordinates of the source primaries. - * - encoding: Set by user - * - decoding: Set by libavcodec - */ - enum AVColorPrimaries color_primaries; - - /** - * Color Transfer Characteristic. - * - encoding: Set by user - * - decoding: Set by libavcodec - */ - enum AVColorTransferCharacteristic color_trc; - - /** - * YUV colorspace type. - * - encoding: Set by user - * - decoding: Set by libavcodec - */ - enum AVColorSpace colorspace; - - /** - * MPEG vs JPEG YUV range. - * - encoding: Set by user - * - decoding: Set by libavcodec - */ - enum AVColorRange color_range; - - /** - * This defines the location of chroma samples. - * - encoding: Set by user - * - decoding: Set by libavcodec - */ - enum AVChromaLocation chroma_sample_location; - - /** - * Number of slices. - * Indicates number of picture subdivisions. Used for parallelized - * decoding. - * - encoding: Set by user - * - decoding: unused - */ - int slices; - - /** Field order - * - encoding: set by libavcodec - * - decoding: Set by user. - */ - enum AVFieldOrder field_order; - - /* audio only */ - int sample_rate; ///< samples per second - int channels; ///< number of audio channels - - /** - * audio sample format - * - encoding: Set by user. - * - decoding: Set by libavcodec. - */ - enum AVSampleFormat sample_fmt; ///< sample format - - /* The following data should not be initialized. */ - /** - * Number of samples per channel in an audio frame. - * - * - encoding: set by libavcodec in avcodec_open2(). Each submitted frame - * except the last must contain exactly frame_size samples per channel. - * May be 0 when the codec has CODEC_CAP_VARIABLE_FRAME_SIZE set, then the - * frame size is not restricted. - * - decoding: may be set by some decoders to indicate constant frame size - */ - int frame_size; - - /** - * Frame counter, set by libavcodec. - * - * - decoding: total number of frames returned from the decoder so far. - * - encoding: total number of frames passed to the encoder so far. - * - * @note the counter is not incremented if encoding/decoding resulted in - * an error. - */ - int frame_number; - - /** - * number of bytes per packet if constant and known or 0 - * Used by some WAV based audio codecs. - */ - int block_align; - - /** - * Audio cutoff bandwidth (0 means "automatic") - * - encoding: Set by user. - * - decoding: unused - */ - int cutoff; - -#if FF_API_REQUEST_CHANNELS - /** - * Decoder should decode to this many channels if it can (0 for default) - * - encoding: unused - * - decoding: Set by user. - * @deprecated Deprecated in favor of request_channel_layout. - */ - attribute_deprecated int request_channels; -#endif - - /** - * Audio channel layout. - * - encoding: set by user. - * - decoding: set by user, may be overwritten by libavcodec. - */ - uint64_t channel_layout; - - /** - * Request decoder to use this channel layout if it can (0 for default) - * - encoding: unused - * - decoding: Set by user. - */ - uint64_t request_channel_layout; - - /** - * Type of service that the audio stream conveys. - * - encoding: Set by user. - * - decoding: Set by libavcodec. - */ - enum AVAudioServiceType audio_service_type; - - /** - * desired sample format - * - encoding: Not used. - * - decoding: Set by user. - * Decoder will decode to this format if it can. - */ - enum AVSampleFormat request_sample_fmt; - -#if FF_API_GET_BUFFER - /** - * Called at the beginning of each frame to get a buffer for it. - * - * The function will set AVFrame.data[], AVFrame.linesize[]. - * AVFrame.extended_data[] must also be set, but it should be the same as - * AVFrame.data[] except for planar audio with more channels than can fit - * in AVFrame.data[]. In that case, AVFrame.data[] shall still contain as - * many data pointers as it can hold. - * - * if CODEC_CAP_DR1 is not set then get_buffer() must call - * avcodec_default_get_buffer() instead of providing buffers allocated by - * some other means. - * - * AVFrame.data[] should be 32- or 16-byte-aligned unless the CPU doesn't - * need it. avcodec_default_get_buffer() aligns the output buffer properly, - * but if get_buffer() is overridden then alignment considerations should - * be taken into account. - * - * @see avcodec_default_get_buffer() - * - * Video: - * - * If pic.reference is set then the frame will be read later by libavcodec. - * avcodec_align_dimensions2() should be used to find the required width and - * height, as they normally need to be rounded up to the next multiple of 16. - * - * If frame multithreading is used and thread_safe_callbacks is set, - * it may be called from a different thread, but not from more than one at - * once. Does not need to be reentrant. - * - * @see release_buffer(), reget_buffer() - * @see avcodec_align_dimensions2() - * - * Audio: - * - * Decoders request a buffer of a particular size by setting - * AVFrame.nb_samples prior to calling get_buffer(). The decoder may, - * however, utilize only part of the buffer by setting AVFrame.nb_samples - * to a smaller value in the output frame. - * - * Decoders cannot use the buffer after returning from - * avcodec_decode_audio4(), so they will not call release_buffer(), as it - * is assumed to be released immediately upon return. In some rare cases, - * a decoder may need to call get_buffer() more than once in a single - * call to avcodec_decode_audio4(). In that case, when get_buffer() is - * called again after it has already been called once, the previously - * acquired buffer is assumed to be released at that time and may not be - * reused by the decoder. - * - * As a convenience, av_samples_get_buffer_size() and - * av_samples_fill_arrays() in libavutil may be used by custom get_buffer() - * functions to find the required data size and to fill data pointers and - * linesize. In AVFrame.linesize, only linesize[0] may be set for audio - * since all planes must be the same size. - * - * @see av_samples_get_buffer_size(), av_samples_fill_arrays() - * - * - encoding: unused - * - decoding: Set by libavcodec, user can override. - * - * @deprecated use get_buffer2() - */ - attribute_deprecated - int (*get_buffer)(struct AVCodecContext *c, AVFrame *pic); - - /** - * Called to release buffers which were allocated with get_buffer. - * A released buffer can be reused in get_buffer(). - * pic.data[*] must be set to NULL. - * May be called from a different thread if frame multithreading is used, - * but not by more than one thread at once, so does not need to be reentrant. - * - encoding: unused - * - decoding: Set by libavcodec, user can override. - * - * @deprecated custom freeing callbacks should be set from get_buffer2() - */ - attribute_deprecated - void (*release_buffer)(struct AVCodecContext *c, AVFrame *pic); - - /** - * Called at the beginning of a frame to get cr buffer for it. - * Buffer type (size, hints) must be the same. libavcodec won't check it. - * libavcodec will pass previous buffer in pic, function should return - * same buffer or new buffer with old frame "painted" into it. - * If pic.data[0] == NULL must behave like get_buffer(). - * if CODEC_CAP_DR1 is not set then reget_buffer() must call - * avcodec_default_reget_buffer() instead of providing buffers allocated by - * some other means. - * - encoding: unused - * - decoding: Set by libavcodec, user can override. - */ - attribute_deprecated - int (*reget_buffer)(struct AVCodecContext *c, AVFrame *pic); -#endif - - /** - * This callback is called at the beginning of each frame to get data - * buffer(s) for it. There may be one contiguous buffer for all the data or - * there may be a buffer per each data plane or anything in between. What - * this means is, you may set however many entries in buf[] you feel necessary. - * Each buffer must be reference-counted using the AVBuffer API (see description - * of buf[] below). - * - * The following fields will be set in the frame before this callback is - * called: - * - format - * - width, height (video only) - * - sample_rate, channel_layout, nb_samples (audio only) - * Their values may differ from the corresponding values in - * AVCodecContext. This callback must use the frame values, not the codec - * context values, to calculate the required buffer size. - * - * This callback must fill the following fields in the frame: - * - data[] - * - linesize[] - * - extended_data: - * * if the data is planar audio with more than 8 channels, then this - * callback must allocate and fill extended_data to contain all pointers - * to all data planes. data[] must hold as many pointers as it can. - * extended_data must be allocated with av_malloc() and will be freed in - * av_frame_unref(). - * * otherwise exended_data must point to data - * - buf[] must contain one or more pointers to AVBufferRef structures. Each of - * the frame's data and extended_data pointers must be contained in these. That - * is, one AVBufferRef for each allocated chunk of memory, not necessarily one - * AVBufferRef per data[] entry. See: av_buffer_create(), av_buffer_alloc(), - * and av_buffer_ref(). - * - extended_buf and nb_extended_buf must be allocated with av_malloc() by - * this callback and filled with the extra buffers if there are more - * buffers than buf[] can hold. extended_buf will be freed in - * av_frame_unref(). - * - * If CODEC_CAP_DR1 is not set then get_buffer2() must call - * avcodec_default_get_buffer2() instead of providing buffers allocated by - * some other means. - * - * Each data plane must be aligned to the maximum required by the target - * CPU. - * - * @see avcodec_default_get_buffer2() - * - * Video: - * - * If AV_GET_BUFFER_FLAG_REF is set in flags then the frame may be reused - * (read and/or written to if it is writable) later by libavcodec. - * - * avcodec_align_dimensions2() should be used to find the required width and - * height, as they normally need to be rounded up to the next multiple of 16. - * - * Some decoders do not support linesizes changing between frames. - * - * If frame multithreading is used and thread_safe_callbacks is set, - * this callback may be called from a different thread, but not from more - * than one at once. Does not need to be reentrant. - * - * @see avcodec_align_dimensions2() - * - * Audio: - * - * Decoders request a buffer of a particular size by setting - * AVFrame.nb_samples prior to calling get_buffer2(). The decoder may, - * however, utilize only part of the buffer by setting AVFrame.nb_samples - * to a smaller value in the output frame. - * - * As a convenience, av_samples_get_buffer_size() and - * av_samples_fill_arrays() in libavutil may be used by custom get_buffer2() - * functions to find the required data size and to fill data pointers and - * linesize. In AVFrame.linesize, only linesize[0] may be set for audio - * since all planes must be the same size. - * - * @see av_samples_get_buffer_size(), av_samples_fill_arrays() - * - * - encoding: unused - * - decoding: Set by libavcodec, user can override. - */ - int (*get_buffer2)(struct AVCodecContext *s, AVFrame *frame, int flags); - - /** - * If non-zero, the decoded audio and video frames returned from - * avcodec_decode_video2() and avcodec_decode_audio4() are reference-counted - * and are valid indefinitely. The caller must free them with - * av_frame_unref() when they are not needed anymore. - * Otherwise, the decoded frames must not be freed by the caller and are - * only valid until the next decode call. - * - * - encoding: unused - * - decoding: set by the caller before avcodec_open2(). - */ - int refcounted_frames; - - /* - encoding parameters */ - float qcompress; ///< amount of qscale change between easy & hard scenes (0.0-1.0) - float qblur; ///< amount of qscale smoothing over time (0.0-1.0) - - /** - * minimum quantizer - * - encoding: Set by user. - * - decoding: unused - */ - int qmin; - - /** - * maximum quantizer - * - encoding: Set by user. - * - decoding: unused - */ - int qmax; - - /** - * maximum quantizer difference between frames - * - encoding: Set by user. - * - decoding: unused - */ - int max_qdiff; - - /** - * ratecontrol qmin qmax limiting method - * 0-> clipping, 1-> use a nice continuous function to limit qscale within qmin/qmax. - * - encoding: Set by user. - * - decoding: unused - */ - float rc_qsquish; - - float rc_qmod_amp; - int rc_qmod_freq; - - /** - * decoder bitstream buffer size - * - encoding: Set by user. - * - decoding: unused - */ - int rc_buffer_size; - - /** - * ratecontrol override, see RcOverride - * - encoding: Allocated/set/freed by user. - * - decoding: unused - */ - int rc_override_count; - RcOverride *rc_override; - - /** - * rate control equation - * - encoding: Set by user - * - decoding: unused - */ - const char *rc_eq; - - /** - * maximum bitrate - * - encoding: Set by user. - * - decoding: unused - */ - int rc_max_rate; - - /** - * minimum bitrate - * - encoding: Set by user. - * - decoding: unused - */ - int rc_min_rate; - - float rc_buffer_aggressivity; - - /** - * initial complexity for pass1 ratecontrol - * - encoding: Set by user. - * - decoding: unused - */ - float rc_initial_cplx; - - /** - * Ratecontrol attempt to use, at maximum, of what can be used without an underflow. - * - encoding: Set by user. - * - decoding: unused. - */ - float rc_max_available_vbv_use; - - /** - * Ratecontrol attempt to use, at least, times the amount needed to prevent a vbv overflow. - * - encoding: Set by user. - * - decoding: unused. - */ - float rc_min_vbv_overflow_use; - - /** - * Number of bits which should be loaded into the rc buffer before decoding starts. - * - encoding: Set by user. - * - decoding: unused - */ - int rc_initial_buffer_occupancy; - -#define FF_CODER_TYPE_VLC 0 -#define FF_CODER_TYPE_AC 1 -#define FF_CODER_TYPE_RAW 2 -#define FF_CODER_TYPE_RLE 3 -#define FF_CODER_TYPE_DEFLATE 4 - /** - * coder type - * - encoding: Set by user. - * - decoding: unused - */ - int coder_type; - - /** - * context model - * - encoding: Set by user. - * - decoding: unused - */ - int context_model; - - /** - * minimum Lagrange multiplier - * - encoding: Set by user. - * - decoding: unused - */ - int lmin; - - /** - * maximum Lagrange multiplier - * - encoding: Set by user. - * - decoding: unused - */ - int lmax; - - /** - * frame skip threshold - * - encoding: Set by user. - * - decoding: unused - */ - int frame_skip_threshold; - - /** - * frame skip factor - * - encoding: Set by user. - * - decoding: unused - */ - int frame_skip_factor; - - /** - * frame skip exponent - * - encoding: Set by user. - * - decoding: unused - */ - int frame_skip_exp; - - /** - * frame skip comparison function - * - encoding: Set by user. - * - decoding: unused - */ - int frame_skip_cmp; - - /** - * trellis RD quantization - * - encoding: Set by user. - * - decoding: unused - */ - int trellis; - - /** - * - encoding: Set by user. - * - decoding: unused - */ - int min_prediction_order; - - /** - * - encoding: Set by user. - * - decoding: unused - */ - int max_prediction_order; - - /** - * GOP timecode frame start number - * - encoding: Set by user, in non drop frame format - * - decoding: Set by libavcodec (timecode in the 25 bits format, -1 if unset) - */ - int64_t timecode_frame_start; - - /* The RTP callback: This function is called */ - /* every time the encoder has a packet to send. */ - /* It depends on the encoder if the data starts */ - /* with a Start Code (it should). H.263 does. */ - /* mb_nb contains the number of macroblocks */ - /* encoded in the RTP payload. */ - void (*rtp_callback)(struct AVCodecContext *avctx, void *data, int size, int mb_nb); - - int rtp_payload_size; /* The size of the RTP payload: the coder will */ - /* do its best to deliver a chunk with size */ - /* below rtp_payload_size, the chunk will start */ - /* with a start code on some codecs like H.263. */ - /* This doesn't take account of any particular */ - /* headers inside the transmitted RTP payload. */ - - /* statistics, used for 2-pass encoding */ - int mv_bits; - int header_bits; - int i_tex_bits; - int p_tex_bits; - int i_count; - int p_count; - int skip_count; - int misc_bits; - - /** - * number of bits used for the previously encoded frame - * - encoding: Set by libavcodec. - * - decoding: unused - */ - int frame_bits; - - /** - * pass1 encoding statistics output buffer - * - encoding: Set by libavcodec. - * - decoding: unused - */ - char *stats_out; - - /** - * pass2 encoding statistics input buffer - * Concatenated stuff from stats_out of pass1 should be placed here. - * - encoding: Allocated/set/freed by user. - * - decoding: unused - */ - char *stats_in; - - /** - * Work around bugs in encoders which sometimes cannot be detected automatically. - * - encoding: Set by user - * - decoding: Set by user - */ - int workaround_bugs; -#define FF_BUG_AUTODETECT 1 ///< autodetection -#if FF_API_OLD_MSMPEG4 -#define FF_BUG_OLD_MSMPEG4 2 -#endif -#define FF_BUG_XVID_ILACE 4 -#define FF_BUG_UMP4 8 -#define FF_BUG_NO_PADDING 16 -#define FF_BUG_AMV 32 -#if FF_API_AC_VLC -#define FF_BUG_AC_VLC 0 ///< Will be removed, libavcodec can now handle these non-compliant files by default. -#endif -#define FF_BUG_QPEL_CHROMA 64 -#define FF_BUG_STD_QPEL 128 -#define FF_BUG_QPEL_CHROMA2 256 -#define FF_BUG_DIRECT_BLOCKSIZE 512 -#define FF_BUG_EDGE 1024 -#define FF_BUG_HPEL_CHROMA 2048 -#define FF_BUG_DC_CLIP 4096 -#define FF_BUG_MS 8192 ///< Work around various bugs in Microsoft's broken decoders. -#define FF_BUG_TRUNCATED 16384 - - /** - * strictly follow the standard (MPEG4, ...). - * - encoding: Set by user. - * - decoding: Set by user. - * Setting this to STRICT or higher means the encoder and decoder will - * generally do stupid things, whereas setting it to unofficial or lower - * will mean the encoder might produce output that is not supported by all - * spec-compliant decoders. Decoders don't differentiate between normal, - * unofficial and experimental (that is, they always try to decode things - * when they can) unless they are explicitly asked to behave stupidly - * (=strictly conform to the specs) - */ - int strict_std_compliance; -#define FF_COMPLIANCE_VERY_STRICT 2 ///< Strictly conform to an older more strict version of the spec or reference software. -#define FF_COMPLIANCE_STRICT 1 ///< Strictly conform to all the things in the spec no matter what consequences. -#define FF_COMPLIANCE_NORMAL 0 -#define FF_COMPLIANCE_UNOFFICIAL -1 ///< Allow unofficial extensions -#define FF_COMPLIANCE_EXPERIMENTAL -2 ///< Allow nonstandardized experimental things. - - /** - * error concealment flags - * - encoding: unused - * - decoding: Set by user. - */ - int error_concealment; -#define FF_EC_GUESS_MVS 1 -#define FF_EC_DEBLOCK 2 - - /** - * debug - * - encoding: Set by user. - * - decoding: Set by user. - */ - int debug; -#define FF_DEBUG_PICT_INFO 1 -#define FF_DEBUG_RC 2 -#define FF_DEBUG_BITSTREAM 4 -#define FF_DEBUG_MB_TYPE 8 -#define FF_DEBUG_QP 16 -#if FF_API_DEBUG_MV -/** - * @deprecated this option does nothing - */ -#define FF_DEBUG_MV 32 -#endif -#define FF_DEBUG_DCT_COEFF 0x00000040 -#define FF_DEBUG_SKIP 0x00000080 -#define FF_DEBUG_STARTCODE 0x00000100 -#define FF_DEBUG_PTS 0x00000200 -#define FF_DEBUG_ER 0x00000400 -#define FF_DEBUG_MMCO 0x00000800 -#define FF_DEBUG_BUGS 0x00001000 -#if FF_API_DEBUG_MV -#define FF_DEBUG_VIS_QP 0x00002000 ///< only access through AVOptions from outside libavcodec -#define FF_DEBUG_VIS_MB_TYPE 0x00004000 ///< only access through AVOptions from outside libavcodec -#endif -#define FF_DEBUG_BUFFERS 0x00008000 -#define FF_DEBUG_THREADS 0x00010000 -#define FF_DEBUG_NOMC 0x01000000 - -#if FF_API_DEBUG_MV - /** - * debug - * Code outside libavcodec should access this field using AVOptions - * - encoding: Set by user. - * - decoding: Set by user. - */ - int debug_mv; -#define FF_DEBUG_VIS_MV_P_FOR 0x00000001 //visualize forward predicted MVs of P frames -#define FF_DEBUG_VIS_MV_B_FOR 0x00000002 //visualize forward predicted MVs of B frames -#define FF_DEBUG_VIS_MV_B_BACK 0x00000004 //visualize backward predicted MVs of B frames -#endif - - /** - * Error recognition; may misdetect some more or less valid parts as errors. - * - encoding: unused - * - decoding: Set by user. - */ - int err_recognition; - -/** - * Verify checksums embedded in the bitstream (could be of either encoded or - * decoded data, depending on the codec) and print an error message on mismatch. - * If AV_EF_EXPLODE is also set, a mismatching checksum will result in the - * decoder returning an error. - */ -#define AV_EF_CRCCHECK (1<<0) -#define AV_EF_BITSTREAM (1<<1) ///< detect bitstream specification deviations -#define AV_EF_BUFFER (1<<2) ///< detect improper bitstream length -#define AV_EF_EXPLODE (1<<3) ///< abort decoding on minor error detection - -#define AV_EF_IGNORE_ERR (1<<15) ///< ignore errors and continue -#define AV_EF_CAREFUL (1<<16) ///< consider things that violate the spec, are fast to calculate and have not been seen in the wild as errors -#define AV_EF_COMPLIANT (1<<17) ///< consider all spec non compliances as errors -#define AV_EF_AGGRESSIVE (1<<18) ///< consider things that a sane encoder should not do as an error - - - /** - * opaque 64bit number (generally a PTS) that will be reordered and - * output in AVFrame.reordered_opaque - * @deprecated in favor of pkt_pts - * - encoding: unused - * - decoding: Set by user. - */ - int64_t reordered_opaque; - - /** - * Hardware accelerator in use - * - encoding: unused. - * - decoding: Set by libavcodec - */ - struct AVHWAccel *hwaccel; - - /** - * Hardware accelerator context. - * For some hardware accelerators, a global context needs to be - * provided by the user. In that case, this holds display-dependent - * data FFmpeg cannot instantiate itself. Please refer to the - * FFmpeg HW accelerator documentation to know how to fill this - * is. e.g. for VA API, this is a struct vaapi_context. - * - encoding: unused - * - decoding: Set by user - */ - void *hwaccel_context; - - /** - * error - * - encoding: Set by libavcodec if flags&CODEC_FLAG_PSNR. - * - decoding: unused - */ - uint64_t error[AV_NUM_DATA_POINTERS]; - - /** - * DCT algorithm, see FF_DCT_* below - * - encoding: Set by user. - * - decoding: unused - */ - int dct_algo; -#define FF_DCT_AUTO 0 -#define FF_DCT_FASTINT 1 -#define FF_DCT_INT 2 -#define FF_DCT_MMX 3 -#define FF_DCT_ALTIVEC 5 -#define FF_DCT_FAAN 6 - - /** - * IDCT algorithm, see FF_IDCT_* below. - * - encoding: Set by user. - * - decoding: Set by user. - */ - int idct_algo; -#define FF_IDCT_AUTO 0 -#define FF_IDCT_INT 1 -#define FF_IDCT_SIMPLE 2 -#define FF_IDCT_SIMPLEMMX 3 -#define FF_IDCT_ARM 7 -#define FF_IDCT_ALTIVEC 8 -#if FF_API_ARCH_SH4 -#define FF_IDCT_SH4 9 -#endif -#define FF_IDCT_SIMPLEARM 10 -#define FF_IDCT_IPP 13 -#define FF_IDCT_XVIDMMX 14 -#define FF_IDCT_SIMPLEARMV5TE 16 -#define FF_IDCT_SIMPLEARMV6 17 -#if FF_API_ARCH_SPARC -#define FF_IDCT_SIMPLEVIS 18 -#endif -#define FF_IDCT_FAAN 20 -#define FF_IDCT_SIMPLENEON 22 -#if FF_API_ARCH_ALPHA -#define FF_IDCT_SIMPLEALPHA 23 -#endif - - /** - * bits per sample/pixel from the demuxer (needed for huffyuv). - * - encoding: Set by libavcodec. - * - decoding: Set by user. - */ - int bits_per_coded_sample; - - /** - * Bits per sample/pixel of internal libavcodec pixel/sample format. - * - encoding: set by user. - * - decoding: set by libavcodec. - */ - int bits_per_raw_sample; - -#if FF_API_LOWRES - /** - * low resolution decoding, 1-> 1/2 size, 2->1/4 size - * - encoding: unused - * - decoding: Set by user. - * Code outside libavcodec should access this field using: - * av_codec_{get,set}_lowres(avctx) - */ - int lowres; -#endif - - /** - * the picture in the bitstream - * - encoding: Set by libavcodec. - * - decoding: unused - */ - AVFrame *coded_frame; - - /** - * thread count - * is used to decide how many independent tasks should be passed to execute() - * - encoding: Set by user. - * - decoding: Set by user. - */ - int thread_count; - - /** - * Which multithreading methods to use. - * Use of FF_THREAD_FRAME will increase decoding delay by one frame per thread, - * so clients which cannot provide future frames should not use it. - * - * - encoding: Set by user, otherwise the default is used. - * - decoding: Set by user, otherwise the default is used. - */ - int thread_type; -#define FF_THREAD_FRAME 1 ///< Decode more than one frame at once -#define FF_THREAD_SLICE 2 ///< Decode more than one part of a single frame at once - - /** - * Which multithreading methods are in use by the codec. - * - encoding: Set by libavcodec. - * - decoding: Set by libavcodec. - */ - int active_thread_type; - - /** - * Set by the client if its custom get_buffer() callback can be called - * synchronously from another thread, which allows faster multithreaded decoding. - * draw_horiz_band() will be called from other threads regardless of this setting. - * Ignored if the default get_buffer() is used. - * - encoding: Set by user. - * - decoding: Set by user. - */ - int thread_safe_callbacks; - - /** - * The codec may call this to execute several independent things. - * It will return only after finishing all tasks. - * The user may replace this with some multithreaded implementation, - * the default implementation will execute the parts serially. - * @param count the number of things to execute - * - encoding: Set by libavcodec, user can override. - * - decoding: Set by libavcodec, user can override. - */ - int (*execute)(struct AVCodecContext *c, int (*func)(struct AVCodecContext *c2, void *arg), void *arg2, int *ret, int count, int size); - - /** - * The codec may call this to execute several independent things. - * It will return only after finishing all tasks. - * The user may replace this with some multithreaded implementation, - * the default implementation will execute the parts serially. - * Also see avcodec_thread_init and e.g. the --enable-pthread configure option. - * @param c context passed also to func - * @param count the number of things to execute - * @param arg2 argument passed unchanged to func - * @param ret return values of executed functions, must have space for "count" values. May be NULL. - * @param func function that will be called count times, with jobnr from 0 to count-1. - * threadnr will be in the range 0 to c->thread_count-1 < MAX_THREADS and so that no - * two instances of func executing at the same time will have the same threadnr. - * @return always 0 currently, but code should handle a future improvement where when any call to func - * returns < 0 no further calls to func may be done and < 0 is returned. - * - encoding: Set by libavcodec, user can override. - * - decoding: Set by libavcodec, user can override. - */ - int (*execute2)(struct AVCodecContext *c, int (*func)(struct AVCodecContext *c2, void *arg, int jobnr, int threadnr), void *arg2, int *ret, int count); - -#if FF_API_THREAD_OPAQUE - /** - * @deprecated this field should not be used from outside of lavc - */ - attribute_deprecated - void *thread_opaque; -#endif - - /** - * noise vs. sse weight for the nsse comparison function - * - encoding: Set by user. - * - decoding: unused - */ - int nsse_weight; - - /** - * profile - * - encoding: Set by user. - * - decoding: Set by libavcodec. - */ - int profile; -#define FF_PROFILE_UNKNOWN -99 -#define FF_PROFILE_RESERVED -100 - -#define FF_PROFILE_AAC_MAIN 0 -#define FF_PROFILE_AAC_LOW 1 -#define FF_PROFILE_AAC_SSR 2 -#define FF_PROFILE_AAC_LTP 3 -#define FF_PROFILE_AAC_HE 4 -#define FF_PROFILE_AAC_HE_V2 28 -#define FF_PROFILE_AAC_LD 22 -#define FF_PROFILE_AAC_ELD 38 -#define FF_PROFILE_MPEG2_AAC_LOW 128 -#define FF_PROFILE_MPEG2_AAC_HE 131 - -#define FF_PROFILE_DTS 20 -#define FF_PROFILE_DTS_ES 30 -#define FF_PROFILE_DTS_96_24 40 -#define FF_PROFILE_DTS_HD_HRA 50 -#define FF_PROFILE_DTS_HD_MA 60 - -#define FF_PROFILE_MPEG2_422 0 -#define FF_PROFILE_MPEG2_HIGH 1 -#define FF_PROFILE_MPEG2_SS 2 -#define FF_PROFILE_MPEG2_SNR_SCALABLE 3 -#define FF_PROFILE_MPEG2_MAIN 4 -#define FF_PROFILE_MPEG2_SIMPLE 5 - -#define FF_PROFILE_H264_CONSTRAINED (1<<9) // 8+1; constraint_set1_flag -#define FF_PROFILE_H264_INTRA (1<<11) // 8+3; constraint_set3_flag - -#define FF_PROFILE_H264_BASELINE 66 -#define FF_PROFILE_H264_CONSTRAINED_BASELINE (66|FF_PROFILE_H264_CONSTRAINED) -#define FF_PROFILE_H264_MAIN 77 -#define FF_PROFILE_H264_EXTENDED 88 -#define FF_PROFILE_H264_HIGH 100 -#define FF_PROFILE_H264_HIGH_10 110 -#define FF_PROFILE_H264_HIGH_10_INTRA (110|FF_PROFILE_H264_INTRA) -#define FF_PROFILE_H264_HIGH_422 122 -#define FF_PROFILE_H264_HIGH_422_INTRA (122|FF_PROFILE_H264_INTRA) -#define FF_PROFILE_H264_HIGH_444 144 -#define FF_PROFILE_H264_HIGH_444_PREDICTIVE 244 -#define FF_PROFILE_H264_HIGH_444_INTRA (244|FF_PROFILE_H264_INTRA) -#define FF_PROFILE_H264_CAVLC_444 44 - -#define FF_PROFILE_VC1_SIMPLE 0 -#define FF_PROFILE_VC1_MAIN 1 -#define FF_PROFILE_VC1_COMPLEX 2 -#define FF_PROFILE_VC1_ADVANCED 3 - -#define FF_PROFILE_MPEG4_SIMPLE 0 -#define FF_PROFILE_MPEG4_SIMPLE_SCALABLE 1 -#define FF_PROFILE_MPEG4_CORE 2 -#define FF_PROFILE_MPEG4_MAIN 3 -#define FF_PROFILE_MPEG4_N_BIT 4 -#define FF_PROFILE_MPEG4_SCALABLE_TEXTURE 5 -#define FF_PROFILE_MPEG4_SIMPLE_FACE_ANIMATION 6 -#define FF_PROFILE_MPEG4_BASIC_ANIMATED_TEXTURE 7 -#define FF_PROFILE_MPEG4_HYBRID 8 -#define FF_PROFILE_MPEG4_ADVANCED_REAL_TIME 9 -#define FF_PROFILE_MPEG4_CORE_SCALABLE 10 -#define FF_PROFILE_MPEG4_ADVANCED_CODING 11 -#define FF_PROFILE_MPEG4_ADVANCED_CORE 12 -#define FF_PROFILE_MPEG4_ADVANCED_SCALABLE_TEXTURE 13 -#define FF_PROFILE_MPEG4_SIMPLE_STUDIO 14 -#define FF_PROFILE_MPEG4_ADVANCED_SIMPLE 15 - -#define FF_PROFILE_JPEG2000_CSTREAM_RESTRICTION_0 0 -#define FF_PROFILE_JPEG2000_CSTREAM_RESTRICTION_1 1 -#define FF_PROFILE_JPEG2000_CSTREAM_NO_RESTRICTION 2 -#define FF_PROFILE_JPEG2000_DCINEMA_2K 3 -#define FF_PROFILE_JPEG2000_DCINEMA_4K 4 - - -#define FF_PROFILE_HEVC_MAIN 1 -#define FF_PROFILE_HEVC_MAIN_10 2 -#define FF_PROFILE_HEVC_MAIN_STILL_PICTURE 3 - - /** - * level - * - encoding: Set by user. - * - decoding: Set by libavcodec. - */ - int level; -#define FF_LEVEL_UNKNOWN -99 - - /** - * Skip loop filtering for selected frames. - * - encoding: unused - * - decoding: Set by user. - */ - enum AVDiscard skip_loop_filter; - - /** - * Skip IDCT/dequantization for selected frames. - * - encoding: unused - * - decoding: Set by user. - */ - enum AVDiscard skip_idct; - - /** - * Skip decoding for selected frames. - * - encoding: unused - * - decoding: Set by user. - */ - enum AVDiscard skip_frame; - - /** - * Header containing style information for text subtitles. - * For SUBTITLE_ASS subtitle type, it should contain the whole ASS - * [Script Info] and [V4+ Styles] section, plus the [Events] line and - * the Format line following. It shouldn't include any Dialogue line. - * - encoding: Set/allocated/freed by user (before avcodec_open2()) - * - decoding: Set/allocated/freed by libavcodec (by avcodec_open2()) - */ - uint8_t *subtitle_header; - int subtitle_header_size; - -#if FF_API_ERROR_RATE - /** - * @deprecated use the 'error_rate' private AVOption of the mpegvideo - * encoders - */ - attribute_deprecated - int error_rate; -#endif - -#if FF_API_CODEC_PKT - /** - * @deprecated this field is not supposed to be accessed from outside lavc - */ - attribute_deprecated - AVPacket *pkt; -#endif - - /** - * VBV delay coded in the last frame (in periods of a 27 MHz clock). - * Used for compliant TS muxing. - * - encoding: Set by libavcodec. - * - decoding: unused. - */ - uint64_t vbv_delay; - - /** - * Timebase in which pkt_dts/pts and AVPacket.dts/pts are. - * Code outside libavcodec should access this field using: - * av_codec_{get,set}_pkt_timebase(avctx) - * - encoding unused. - * - decoding set by user. - */ - AVRational pkt_timebase; - - /** - * AVCodecDescriptor - * Code outside libavcodec should access this field using: - * av_codec_{get,set}_codec_descriptor(avctx) - * - encoding: unused. - * - decoding: set by libavcodec. - */ - const AVCodecDescriptor *codec_descriptor; - -#if !FF_API_LOWRES - /** - * low resolution decoding, 1-> 1/2 size, 2->1/4 size - * - encoding: unused - * - decoding: Set by user. - * Code outside libavcodec should access this field using: - * av_codec_{get,set}_lowres(avctx) - */ - int lowres; -#endif - - /** - * Current statistics for PTS correction. - * - decoding: maintained and used by libavcodec, not intended to be used by user apps - * - encoding: unused - */ - int64_t pts_correction_num_faulty_pts; /// Number of incorrect PTS values so far - int64_t pts_correction_num_faulty_dts; /// Number of incorrect DTS values so far - int64_t pts_correction_last_pts; /// PTS of the last frame - int64_t pts_correction_last_dts; /// DTS of the last frame - - /** - * Character encoding of the input subtitles file. - * - decoding: set by user - * - encoding: unused - */ - char *sub_charenc; - - /** - * Subtitles character encoding mode. Formats or codecs might be adjusting - * this setting (if they are doing the conversion themselves for instance). - * - decoding: set by libavcodec - * - encoding: unused - */ - int sub_charenc_mode; -#define FF_SUB_CHARENC_MODE_DO_NOTHING -1 ///< do nothing (demuxer outputs a stream supposed to be already in UTF-8, or the codec is bitmap for instance) -#define FF_SUB_CHARENC_MODE_AUTOMATIC 0 ///< libavcodec will select the mode itself -#define FF_SUB_CHARENC_MODE_PRE_DECODER 1 ///< the AVPacket data needs to be recoded to UTF-8 before being fed to the decoder, requires iconv - - /** - * Skip processing alpha if supported by codec. - * Note that if the format uses pre-multiplied alpha (common with VP6, - * and recommended due to better video quality/compression) - * the image will look as if alpha-blended onto a black background. - * However for formats that do not use pre-multiplied alpha - * there might be serious artefacts (though e.g. libswscale currently - * assumes pre-multiplied alpha anyway). - * Code outside libavcodec should access this field using AVOptions - * - * - decoding: set by user - * - encoding: unused - */ - int skip_alpha; - - /** - * Number of samples to skip after a discontinuity - * - decoding: unused - * - encoding: set by libavcodec - */ - int seek_preroll; - -#if !FF_API_DEBUG_MV - /** - * debug motion vectors - * Code outside libavcodec should access this field using AVOptions - * - encoding: Set by user. - * - decoding: Set by user. - */ - int debug_mv; -#define FF_DEBUG_VIS_MV_P_FOR 0x00000001 //visualize forward predicted MVs of P frames -#define FF_DEBUG_VIS_MV_B_FOR 0x00000002 //visualize forward predicted MVs of B frames -#define FF_DEBUG_VIS_MV_B_BACK 0x00000004 //visualize backward predicted MVs of B frames -#endif - - /** - * custom intra quantization matrix - * Code outside libavcodec should access this field using av_codec_g/set_chroma_intra_matrix() - * - encoding: Set by user, can be NULL. - * - decoding: unused. - */ - uint16_t *chroma_intra_matrix; -} AVCodecContext; - -AVRational av_codec_get_pkt_timebase (const AVCodecContext *avctx); -void av_codec_set_pkt_timebase (AVCodecContext *avctx, AVRational val); - -const AVCodecDescriptor *av_codec_get_codec_descriptor(const AVCodecContext *avctx); -void av_codec_set_codec_descriptor(AVCodecContext *avctx, const AVCodecDescriptor *desc); - -int av_codec_get_lowres(const AVCodecContext *avctx); -void av_codec_set_lowres(AVCodecContext *avctx, int val); - -int av_codec_get_seek_preroll(const AVCodecContext *avctx); -void av_codec_set_seek_preroll(AVCodecContext *avctx, int val); - -uint16_t *av_codec_get_chroma_intra_matrix(const AVCodecContext *avctx); -void av_codec_set_chroma_intra_matrix(AVCodecContext *avctx, uint16_t *val); - -/** - * AVProfile. - */ -typedef struct AVProfile { - int profile; - const char *name; ///< short name for the profile -} AVProfile; - -typedef struct AVCodecDefault AVCodecDefault; - -struct AVSubtitle; - -/** - * AVCodec. - */ -typedef struct AVCodec { - /** - * Name of the codec implementation. - * The name is globally unique among encoders and among decoders (but an - * encoder and a decoder can share the same name). - * This is the primary way to find a codec from the user perspective. - */ - const char *name; - /** - * Descriptive name for the codec, meant to be more human readable than name. - * You should use the NULL_IF_CONFIG_SMALL() macro to define it. - */ - const char *long_name; - enum AVMediaType type; - enum AVCodecID id; - /** - * Codec capabilities. - * see CODEC_CAP_* - */ - int capabilities; - const AVRational *supported_framerates; ///< array of supported framerates, or NULL if any, array is terminated by {0,0} - const enum AVPixelFormat *pix_fmts; ///< array of supported pixel formats, or NULL if unknown, array is terminated by -1 - const int *supported_samplerates; ///< array of supported audio samplerates, or NULL if unknown, array is terminated by 0 - const enum AVSampleFormat *sample_fmts; ///< array of supported sample formats, or NULL if unknown, array is terminated by -1 - const uint64_t *channel_layouts; ///< array of support channel layouts, or NULL if unknown. array is terminated by 0 -#if FF_API_LOWRES - uint8_t max_lowres; ///< maximum value for lowres supported by the decoder, no direct access, use av_codec_get_max_lowres() -#endif - const AVClass *priv_class; ///< AVClass for the private context - const AVProfile *profiles; ///< array of recognized profiles, or NULL if unknown, array is terminated by {FF_PROFILE_UNKNOWN} - - /***************************************************************** - * No fields below this line are part of the public API. They - * may not be used outside of libavcodec and can be changed and - * removed at will. - * New public fields should be added right above. - ***************************************************************** - */ - int priv_data_size; - struct AVCodec *next; - /** - * @name Frame-level threading support functions - * @{ - */ - /** - * If defined, called on thread contexts when they are created. - * If the codec allocates writable tables in init(), re-allocate them here. - * priv_data will be set to a copy of the original. - */ - int (*init_thread_copy)(AVCodecContext *); - /** - * Copy necessary context variables from a previous thread context to the current one. - * If not defined, the next thread will start automatically; otherwise, the codec - * must call ff_thread_finish_setup(). - * - * dst and src will (rarely) point to the same context, in which case memcpy should be skipped. - */ - int (*update_thread_context)(AVCodecContext *dst, const AVCodecContext *src); - /** @} */ - - /** - * Private codec-specific defaults. - */ - const AVCodecDefault *defaults; - - /** - * Initialize codec static data, called from avcodec_register(). - */ - void (*init_static_data)(struct AVCodec *codec); - - int (*init)(AVCodecContext *); - int (*encode_sub)(AVCodecContext *, uint8_t *buf, int buf_size, - const struct AVSubtitle *sub); - /** - * Encode data to an AVPacket. - * - * @param avctx codec context - * @param avpkt output AVPacket (may contain a user-provided buffer) - * @param[in] frame AVFrame containing the raw data to be encoded - * @param[out] got_packet_ptr encoder sets to 0 or 1 to indicate that a - * non-empty packet was returned in avpkt. - * @return 0 on success, negative error code on failure - */ - int (*encode2)(AVCodecContext *avctx, AVPacket *avpkt, const AVFrame *frame, - int *got_packet_ptr); - int (*decode)(AVCodecContext *, void *outdata, int *outdata_size, AVPacket *avpkt); - int (*close)(AVCodecContext *); - /** - * Flush buffers. - * Will be called when seeking - */ - void (*flush)(AVCodecContext *); -} AVCodec; - -int av_codec_get_max_lowres(const AVCodec *codec); - -struct MpegEncContext; - -/** - * AVHWAccel. - */ -typedef struct AVHWAccel { - /** - * Name of the hardware accelerated codec. - * The name is globally unique among encoders and among decoders (but an - * encoder and a decoder can share the same name). - */ - const char *name; - - /** - * Type of codec implemented by the hardware accelerator. - * - * See AVMEDIA_TYPE_xxx - */ - enum AVMediaType type; - - /** - * Codec implemented by the hardware accelerator. - * - * See AV_CODEC_ID_xxx - */ - enum AVCodecID id; - - /** - * Supported pixel format. - * - * Only hardware accelerated formats are supported here. - */ - enum AVPixelFormat pix_fmt; - - /** - * Hardware accelerated codec capabilities. - * see FF_HWACCEL_CODEC_CAP_* - */ - int capabilities; - - struct AVHWAccel *next; - - /** - * Called at the beginning of each frame or field picture. - * - * Meaningful frame information (codec specific) is guaranteed to - * be parsed at this point. This function is mandatory. - * - * Note that buf can be NULL along with buf_size set to 0. - * Otherwise, this means the whole frame is available at this point. - * - * @param avctx the codec context - * @param buf the frame data buffer base - * @param buf_size the size of the frame in bytes - * @return zero if successful, a negative value otherwise - */ - int (*start_frame)(AVCodecContext *avctx, const uint8_t *buf, uint32_t buf_size); - - /** - * Callback for each slice. - * - * Meaningful slice information (codec specific) is guaranteed to - * be parsed at this point. This function is mandatory. - * The only exception is XvMC, that works on MB level. - * - * @param avctx the codec context - * @param buf the slice data buffer base - * @param buf_size the size of the slice in bytes - * @return zero if successful, a negative value otherwise - */ - int (*decode_slice)(AVCodecContext *avctx, const uint8_t *buf, uint32_t buf_size); - - /** - * Called at the end of each frame or field picture. - * - * The whole picture is parsed at this point and can now be sent - * to the hardware accelerator. This function is mandatory. - * - * @param avctx the codec context - * @return zero if successful, a negative value otherwise - */ - int (*end_frame)(AVCodecContext *avctx); - - /** - * Size of HW accelerator private data. - * - * Private data is allocated with av_mallocz() before - * AVCodecContext.get_buffer() and deallocated after - * AVCodecContext.release_buffer(). - */ - int priv_data_size; - - /** - * Called for every Macroblock in a slice. - * - * XvMC uses it to replace the ff_MPV_decode_mb(). - * Instead of decoding to raw picture, MB parameters are - * stored in an array provided by the video driver. - * - * @param s the mpeg context - */ - void (*decode_mb)(struct MpegEncContext *s); -} AVHWAccel; - -/** - * @defgroup lavc_picture AVPicture - * - * Functions for working with AVPicture - * @{ - */ - -/** - * Picture data structure. - * - * Up to four components can be stored into it, the last component is - * alpha. - */ -typedef struct AVPicture { - uint8_t *data[AV_NUM_DATA_POINTERS]; ///< pointers to the image data planes - int linesize[AV_NUM_DATA_POINTERS]; ///< number of bytes per line -} AVPicture; - -/** - * @} - */ - -enum AVSubtitleType { - SUBTITLE_NONE, - - SUBTITLE_BITMAP, ///< A bitmap, pict will be set - - /** - * Plain text, the text field must be set by the decoder and is - * authoritative. ass and pict fields may contain approximations. - */ - SUBTITLE_TEXT, - - /** - * Formatted text, the ass field must be set by the decoder and is - * authoritative. pict and text fields may contain approximations. - */ - SUBTITLE_ASS, -}; - -#define AV_SUBTITLE_FLAG_FORCED 0x00000001 - -typedef struct AVSubtitleRect { - int x; ///< top left corner of pict, undefined when pict is not set - int y; ///< top left corner of pict, undefined when pict is not set - int w; ///< width of pict, undefined when pict is not set - int h; ///< height of pict, undefined when pict is not set - int nb_colors; ///< number of colors in pict, undefined when pict is not set - - /** - * data+linesize for the bitmap of this subtitle. - * can be set for text/ass as well once they where rendered - */ - AVPicture pict; - enum AVSubtitleType type; - - char *text; ///< 0 terminated plain UTF-8 text - - /** - * 0 terminated ASS/SSA compatible event line. - * The presentation of this is unaffected by the other values in this - * struct. - */ - char *ass; - - int flags; -} AVSubtitleRect; - -typedef struct AVSubtitle { - uint16_t format; /* 0 = graphics */ - uint32_t start_display_time; /* relative to packet pts, in ms */ - uint32_t end_display_time; /* relative to packet pts, in ms */ - unsigned num_rects; - AVSubtitleRect **rects; - int64_t pts; ///< Same as packet pts, in AV_TIME_BASE -} AVSubtitle; - -/** - * If c is NULL, returns the first registered codec, - * if c is non-NULL, returns the next registered codec after c, - * or NULL if c is the last one. - */ -AVCodec *av_codec_next(const AVCodec *c); - -/** - * Return the LIBAVCODEC_VERSION_INT constant. - */ -unsigned avcodec_version(void); - -/** - * Return the libavcodec build-time configuration. - */ -const char *avcodec_configuration(void); - -/** - * Return the libavcodec license. - */ -const char *avcodec_license(void); - -/** - * Register the codec codec and initialize libavcodec. - * - * @warning either this function or avcodec_register_all() must be called - * before any other libavcodec functions. - * - * @see avcodec_register_all() - */ -void avcodec_register(AVCodec *codec); - -/** - * Register all the codecs, parsers and bitstream filters which were enabled at - * configuration time. If you do not call this function you can select exactly - * which formats you want to support, by using the individual registration - * functions. - * - * @see avcodec_register - * @see av_register_codec_parser - * @see av_register_bitstream_filter - */ -void avcodec_register_all(void); - -/** - * Allocate an AVCodecContext and set its fields to default values. The - * resulting struct can be deallocated by calling avcodec_close() on it followed - * by av_free(). - * - * @param codec if non-NULL, allocate private data and initialize defaults - * for the given codec. It is illegal to then call avcodec_open2() - * with a different codec. - * If NULL, then the codec-specific defaults won't be initialized, - * which may result in suboptimal default settings (this is - * important mainly for encoders, e.g. libx264). - * - * @return An AVCodecContext filled with default values or NULL on failure. - * @see avcodec_get_context_defaults - */ -AVCodecContext *avcodec_alloc_context3(const AVCodec *codec); - -/** - * Set the fields of the given AVCodecContext to default values corresponding - * to the given codec (defaults may be codec-dependent). - * - * Do not call this function if a non-NULL codec has been passed - * to avcodec_alloc_context3() that allocated this AVCodecContext. - * If codec is non-NULL, it is illegal to call avcodec_open2() with a - * different codec on this AVCodecContext. - */ -int avcodec_get_context_defaults3(AVCodecContext *s, const AVCodec *codec); - -/** - * Get the AVClass for AVCodecContext. It can be used in combination with - * AV_OPT_SEARCH_FAKE_OBJ for examining options. - * - * @see av_opt_find(). - */ -const AVClass *avcodec_get_class(void); - -/** - * Get the AVClass for AVFrame. It can be used in combination with - * AV_OPT_SEARCH_FAKE_OBJ for examining options. - * - * @see av_opt_find(). - */ -const AVClass *avcodec_get_frame_class(void); - -/** - * Get the AVClass for AVSubtitleRect. It can be used in combination with - * AV_OPT_SEARCH_FAKE_OBJ for examining options. - * - * @see av_opt_find(). - */ -const AVClass *avcodec_get_subtitle_rect_class(void); - -/** - * Copy the settings of the source AVCodecContext into the destination - * AVCodecContext. The resulting destination codec context will be - * unopened, i.e. you are required to call avcodec_open2() before you - * can use this AVCodecContext to decode/encode video/audio data. - * - * @param dest target codec context, should be initialized with - * avcodec_alloc_context3(NULL), but otherwise uninitialized - * @param src source codec context - * @return AVERROR() on error (e.g. memory allocation error), 0 on success - */ -int avcodec_copy_context(AVCodecContext *dest, const AVCodecContext *src); - -#if FF_API_AVFRAME_LAVC -/** - * @deprecated use av_frame_alloc() - */ -attribute_deprecated -AVFrame *avcodec_alloc_frame(void); - -/** - * Set the fields of the given AVFrame to default values. - * - * @param frame The AVFrame of which the fields should be set to default values. - * - * @deprecated use av_frame_unref() - */ -attribute_deprecated -void avcodec_get_frame_defaults(AVFrame *frame); - -/** - * Free the frame and any dynamically allocated objects in it, - * e.g. extended_data. - * - * @param frame frame to be freed. The pointer will be set to NULL. - * - * @warning this function does NOT free the data buffers themselves - * (it does not know how, since they might have been allocated with - * a custom get_buffer()). - * - * @deprecated use av_frame_free() - */ -attribute_deprecated -void avcodec_free_frame(AVFrame **frame); -#endif - -/** - * Initialize the AVCodecContext to use the given AVCodec. Prior to using this - * function the context has to be allocated with avcodec_alloc_context3(). - * - * The functions avcodec_find_decoder_by_name(), avcodec_find_encoder_by_name(), - * avcodec_find_decoder() and avcodec_find_encoder() provide an easy way for - * retrieving a codec. - * - * @warning This function is not thread safe! - * - * @code - * avcodec_register_all(); - * av_dict_set(&opts, "b", "2.5M", 0); - * codec = avcodec_find_decoder(AV_CODEC_ID_H264); - * if (!codec) - * exit(1); - * - * context = avcodec_alloc_context3(codec); - * - * if (avcodec_open2(context, codec, opts) < 0) - * exit(1); - * @endcode - * - * @param avctx The context to initialize. - * @param codec The codec to open this context for. If a non-NULL codec has been - * previously passed to avcodec_alloc_context3() or - * avcodec_get_context_defaults3() for this context, then this - * parameter MUST be either NULL or equal to the previously passed - * codec. - * @param options A dictionary filled with AVCodecContext and codec-private options. - * On return this object will be filled with options that were not found. - * - * @return zero on success, a negative value on error - * @see avcodec_alloc_context3(), avcodec_find_decoder(), avcodec_find_encoder(), - * av_dict_set(), av_opt_find(). - */ -int avcodec_open2(AVCodecContext *avctx, const AVCodec *codec, AVDictionary **options); - -/** - * Close a given AVCodecContext and free all the data associated with it - * (but not the AVCodecContext itself). - * - * Calling this function on an AVCodecContext that hasn't been opened will free - * the codec-specific data allocated in avcodec_alloc_context3() / - * avcodec_get_context_defaults3() with a non-NULL codec. Subsequent calls will - * do nothing. - */ -int avcodec_close(AVCodecContext *avctx); - -/** - * Free all allocated data in the given subtitle struct. - * - * @param sub AVSubtitle to free. - */ -void avsubtitle_free(AVSubtitle *sub); - -/** - * @} - */ - -/** - * @addtogroup lavc_packet - * @{ - */ - -#if FF_API_DESTRUCT_PACKET -/** - * Default packet destructor. - * @deprecated use the AVBuffer API instead - */ -attribute_deprecated -void av_destruct_packet(AVPacket *pkt); -#endif - -/** - * Initialize optional fields of a packet with default values. - * - * Note, this does not touch the data and size members, which have to be - * initialized separately. - * - * @param pkt packet - */ -void av_init_packet(AVPacket *pkt); - -/** - * Allocate the payload of a packet and initialize its fields with - * default values. - * - * @param pkt packet - * @param size wanted payload size - * @return 0 if OK, AVERROR_xxx otherwise - */ -int av_new_packet(AVPacket *pkt, int size); - -/** - * Reduce packet size, correctly zeroing padding - * - * @param pkt packet - * @param size new size - */ -void av_shrink_packet(AVPacket *pkt, int size); - -/** - * Increase packet size, correctly zeroing padding - * - * @param pkt packet - * @param grow_by number of bytes by which to increase the size of the packet - */ -int av_grow_packet(AVPacket *pkt, int grow_by); - -/** - * Initialize a reference-counted packet from av_malloc()ed data. - * - * @param pkt packet to be initialized. This function will set the data, size, - * buf and destruct fields, all others are left untouched. - * @param data Data allocated by av_malloc() to be used as packet data. If this - * function returns successfully, the data is owned by the underlying AVBuffer. - * The caller may not access the data through other means. - * @param size size of data in bytes, without the padding. I.e. the full buffer - * size is assumed to be size + FF_INPUT_BUFFER_PADDING_SIZE. - * - * @return 0 on success, a negative AVERROR on error - */ -int av_packet_from_data(AVPacket *pkt, uint8_t *data, int size); - -/** - * @warning This is a hack - the packet memory allocation stuff is broken. The - * packet is allocated if it was not really allocated. - */ -int av_dup_packet(AVPacket *pkt); - -/** - * Copy packet, including contents - * - * @return 0 on success, negative AVERROR on fail - */ -int av_copy_packet(AVPacket *dst, const AVPacket *src); - -/** - * Copy packet side data - * - * @return 0 on success, negative AVERROR on fail - */ -int av_copy_packet_side_data(AVPacket *dst, const AVPacket *src); - -/** - * Free a packet. - * - * @param pkt packet to free - */ -void av_free_packet(AVPacket *pkt); - -/** - * Allocate new information of a packet. - * - * @param pkt packet - * @param type side information type - * @param size side information size - * @return pointer to fresh allocated data or NULL otherwise - */ -uint8_t* av_packet_new_side_data(AVPacket *pkt, enum AVPacketSideDataType type, - int size); - -/** - * Shrink the already allocated side data buffer - * - * @param pkt packet - * @param type side information type - * @param size new side information size - * @return 0 on success, < 0 on failure - */ -int av_packet_shrink_side_data(AVPacket *pkt, enum AVPacketSideDataType type, - int size); - -/** - * Get side information from packet. - * - * @param pkt packet - * @param type desired side information type - * @param size pointer for side information size to store (optional) - * @return pointer to data if present or NULL otherwise - */ -uint8_t* av_packet_get_side_data(AVPacket *pkt, enum AVPacketSideDataType type, - int *size); - -int av_packet_merge_side_data(AVPacket *pkt); - -int av_packet_split_side_data(AVPacket *pkt); - -/** - * Pack a dictionary for use in side_data. - * - * @param dict The dictionary to pack. - * @param size pointer to store the size of the returned data - * @return pointer to data if successful, NULL otherwise - */ -uint8_t *av_packet_pack_dictionary(AVDictionary *dict, int *size); -/** - * Unpack a dictionary from side_data. - * - * @param data data from side_data - * @param size size of the data - * @param dict the metadata storage dictionary - * @return 0 on success, < 0 on failure - */ -int av_packet_unpack_dictionary(const uint8_t *data, int size, AVDictionary **dict); - - -/** - * Convenience function to free all the side data stored. - * All the other fields stay untouched. - * - * @param pkt packet - */ -void av_packet_free_side_data(AVPacket *pkt); - -/** - * Setup a new reference to the data described by a given packet - * - * If src is reference-counted, setup dst as a new reference to the - * buffer in src. Otherwise allocate a new buffer in dst and copy the - * data from src into it. - * - * All the other fields are copied from src. - * - * @see av_packet_unref - * - * @param dst Destination packet - * @param src Source packet - * - * @return 0 on success, a negative AVERROR on error. - */ -int av_packet_ref(AVPacket *dst, const AVPacket *src); - -/** - * Wipe the packet. - * - * Unreference the buffer referenced by the packet and reset the - * remaining packet fields to their default values. - * - * @param pkt The packet to be unreferenced. - */ -void av_packet_unref(AVPacket *pkt); - -/** - * Move every field in src to dst and reset src. - * - * @see av_packet_unref - * - * @param src Source packet, will be reset - * @param dst Destination packet - */ -void av_packet_move_ref(AVPacket *dst, AVPacket *src); - -/** - * Copy only "properties" fields from src to dst. - * - * Properties for the purpose of this function are all the fields - * beside those related to the packet data (buf, data, size) - * - * @param dst Destination packet - * @param src Source packet - * - * @return 0 on success AVERROR on failure. - * - */ -int av_packet_copy_props(AVPacket *dst, const AVPacket *src); - -/** - * @} - */ - -/** - * @addtogroup lavc_decoding - * @{ - */ - -/** - * Find a registered decoder with a matching codec ID. - * - * @param id AVCodecID of the requested decoder - * @return A decoder if one was found, NULL otherwise. - */ -AVCodec *avcodec_find_decoder(enum AVCodecID id); - -/** - * Find a registered decoder with the specified name. - * - * @param name name of the requested decoder - * @return A decoder if one was found, NULL otherwise. - */ -AVCodec *avcodec_find_decoder_by_name(const char *name); - -#if FF_API_GET_BUFFER -attribute_deprecated int avcodec_default_get_buffer(AVCodecContext *s, AVFrame *pic); -attribute_deprecated void avcodec_default_release_buffer(AVCodecContext *s, AVFrame *pic); -attribute_deprecated int avcodec_default_reget_buffer(AVCodecContext *s, AVFrame *pic); -#endif - -/** - * The default callback for AVCodecContext.get_buffer2(). It is made public so - * it can be called by custom get_buffer2() implementations for decoders without - * CODEC_CAP_DR1 set. - */ -int avcodec_default_get_buffer2(AVCodecContext *s, AVFrame *frame, int flags); - -#if FF_API_EMU_EDGE -/** - * Return the amount of padding in pixels which the get_buffer callback must - * provide around the edge of the image for codecs which do not have the - * CODEC_FLAG_EMU_EDGE flag. - * - * @return Required padding in pixels. - * - * @deprecated CODEC_FLAG_EMU_EDGE is deprecated, so this function is no longer - * needed - */ -attribute_deprecated -unsigned avcodec_get_edge_width(void); -#endif - -/** - * Modify width and height values so that they will result in a memory - * buffer that is acceptable for the codec if you do not use any horizontal - * padding. - * - * May only be used if a codec with CODEC_CAP_DR1 has been opened. - */ -void avcodec_align_dimensions(AVCodecContext *s, int *width, int *height); - -/** - * Modify width and height values so that they will result in a memory - * buffer that is acceptable for the codec if you also ensure that all - * line sizes are a multiple of the respective linesize_align[i]. - * - * May only be used if a codec with CODEC_CAP_DR1 has been opened. - */ -void avcodec_align_dimensions2(AVCodecContext *s, int *width, int *height, - int linesize_align[AV_NUM_DATA_POINTERS]); - -/** - * Converts AVChromaLocation to swscale x/y chroma position. - * - * The positions represent the chroma (0,0) position in a coordinates system - * with luma (0,0) representing the origin and luma(1,1) representing 256,256 - * - * @param xpos horizontal chroma sample position - * @param ypos vertical chroma sample position - */ -int avcodec_enum_to_chroma_pos(int *xpos, int *ypos, enum AVChromaLocation pos); - -/** - * Converts swscale x/y chroma position to AVChromaLocation. - * - * The positions represent the chroma (0,0) position in a coordinates system - * with luma (0,0) representing the origin and luma(1,1) representing 256,256 - * - * @param xpos horizontal chroma sample position - * @param ypos vertical chroma sample position - */ -enum AVChromaLocation avcodec_chroma_pos_to_enum(int xpos, int ypos); - -#if FF_API_OLD_DECODE_AUDIO -/** - * Wrapper function which calls avcodec_decode_audio4. - * - * @deprecated Use avcodec_decode_audio4 instead. - * - * Decode the audio frame of size avpkt->size from avpkt->data into samples. - * Some decoders may support multiple frames in a single AVPacket, such - * decoders would then just decode the first frame. In this case, - * avcodec_decode_audio3 has to be called again with an AVPacket that contains - * the remaining data in order to decode the second frame etc. - * If no frame - * could be outputted, frame_size_ptr is zero. Otherwise, it is the - * decompressed frame size in bytes. - * - * @warning You must set frame_size_ptr to the allocated size of the - * output buffer before calling avcodec_decode_audio3(). - * - * @warning The input buffer must be FF_INPUT_BUFFER_PADDING_SIZE larger than - * the actual read bytes because some optimized bitstream readers read 32 or 64 - * bits at once and could read over the end. - * - * @warning The end of the input buffer avpkt->data should be set to 0 to ensure that - * no overreading happens for damaged MPEG streams. - * - * @warning You must not provide a custom get_buffer() when using - * avcodec_decode_audio3(). Doing so will override it with - * avcodec_default_get_buffer. Use avcodec_decode_audio4() instead, - * which does allow the application to provide a custom get_buffer(). - * - * @note You might have to align the input buffer avpkt->data and output buffer - * samples. The alignment requirements depend on the CPU: On some CPUs it isn't - * necessary at all, on others it won't work at all if not aligned and on others - * it will work but it will have an impact on performance. - * - * In practice, avpkt->data should have 4 byte alignment at minimum and - * samples should be 16 byte aligned unless the CPU doesn't need it - * (AltiVec and SSE do). - * - * @note Codecs which have the CODEC_CAP_DELAY capability set have a delay - * between input and output, these need to be fed with avpkt->data=NULL, - * avpkt->size=0 at the end to return the remaining frames. - * - * @param avctx the codec context - * @param[out] samples the output buffer, sample type in avctx->sample_fmt - * If the sample format is planar, each channel plane will - * be the same size, with no padding between channels. - * @param[in,out] frame_size_ptr the output buffer size in bytes - * @param[in] avpkt The input AVPacket containing the input buffer. - * You can create such packet with av_init_packet() and by then setting - * data and size, some decoders might in addition need other fields. - * All decoders are designed to use the least fields possible though. - * @return On error a negative value is returned, otherwise the number of bytes - * used or zero if no frame data was decompressed (used) from the input AVPacket. - */ -attribute_deprecated int avcodec_decode_audio3(AVCodecContext *avctx, int16_t *samples, - int *frame_size_ptr, - AVPacket *avpkt); -#endif - -/** - * Decode the audio frame of size avpkt->size from avpkt->data into frame. - * - * Some decoders may support multiple frames in a single AVPacket. Such - * decoders would then just decode the first frame and the return value would be - * less than the packet size. In this case, avcodec_decode_audio4 has to be - * called again with an AVPacket containing the remaining data in order to - * decode the second frame, etc... Even if no frames are returned, the packet - * needs to be fed to the decoder with remaining data until it is completely - * consumed or an error occurs. - * - * Some decoders (those marked with CODEC_CAP_DELAY) have a delay between input - * and output. This means that for some packets they will not immediately - * produce decoded output and need to be flushed at the end of decoding to get - * all the decoded data. Flushing is done by calling this function with packets - * with avpkt->data set to NULL and avpkt->size set to 0 until it stops - * returning samples. It is safe to flush even those decoders that are not - * marked with CODEC_CAP_DELAY, then no samples will be returned. - * - * @warning The input buffer, avpkt->data must be FF_INPUT_BUFFER_PADDING_SIZE - * larger than the actual read bytes because some optimized bitstream - * readers read 32 or 64 bits at once and could read over the end. - * - * @param avctx the codec context - * @param[out] frame The AVFrame in which to store decoded audio samples. - * The decoder will allocate a buffer for the decoded frame by - * calling the AVCodecContext.get_buffer2() callback. - * When AVCodecContext.refcounted_frames is set to 1, the frame is - * reference counted and the returned reference belongs to the - * caller. The caller must release the frame using av_frame_unref() - * when the frame is no longer needed. The caller may safely write - * to the frame if av_frame_is_writable() returns 1. - * When AVCodecContext.refcounted_frames is set to 0, the returned - * reference belongs to the decoder and is valid only until the - * next call to this function or until closing or flushing the - * decoder. The caller may not write to it. - * @param[out] got_frame_ptr Zero if no frame could be decoded, otherwise it is - * non-zero. Note that this field being set to zero - * does not mean that an error has occurred. For - * decoders with CODEC_CAP_DELAY set, no given decode - * call is guaranteed to produce a frame. - * @param[in] avpkt The input AVPacket containing the input buffer. - * At least avpkt->data and avpkt->size should be set. Some - * decoders might also require additional fields to be set. - * @return A negative error code is returned if an error occurred during - * decoding, otherwise the number of bytes consumed from the input - * AVPacket is returned. - */ -int avcodec_decode_audio4(AVCodecContext *avctx, AVFrame *frame, - int *got_frame_ptr, const AVPacket *avpkt); - -/** - * Decode the video frame of size avpkt->size from avpkt->data into picture. - * Some decoders may support multiple frames in a single AVPacket, such - * decoders would then just decode the first frame. - * - * @warning The input buffer must be FF_INPUT_BUFFER_PADDING_SIZE larger than - * the actual read bytes because some optimized bitstream readers read 32 or 64 - * bits at once and could read over the end. - * - * @warning The end of the input buffer buf should be set to 0 to ensure that - * no overreading happens for damaged MPEG streams. - * - * @note Codecs which have the CODEC_CAP_DELAY capability set have a delay - * between input and output, these need to be fed with avpkt->data=NULL, - * avpkt->size=0 at the end to return the remaining frames. - * - * @param avctx the codec context - * @param[out] picture The AVFrame in which the decoded video frame will be stored. - * Use av_frame_alloc() to get an AVFrame. The codec will - * allocate memory for the actual bitmap by calling the - * AVCodecContext.get_buffer2() callback. - * When AVCodecContext.refcounted_frames is set to 1, the frame is - * reference counted and the returned reference belongs to the - * caller. The caller must release the frame using av_frame_unref() - * when the frame is no longer needed. The caller may safely write - * to the frame if av_frame_is_writable() returns 1. - * When AVCodecContext.refcounted_frames is set to 0, the returned - * reference belongs to the decoder and is valid only until the - * next call to this function or until closing or flushing the - * decoder. The caller may not write to it. - * - * @param[in] avpkt The input AVPacket containing the input buffer. - * You can create such packet with av_init_packet() and by then setting - * data and size, some decoders might in addition need other fields like - * flags&AV_PKT_FLAG_KEY. All decoders are designed to use the least - * fields possible. - * @param[in,out] got_picture_ptr Zero if no frame could be decompressed, otherwise, it is nonzero. - * @return On error a negative value is returned, otherwise the number of bytes - * used or zero if no frame could be decompressed. - */ -int avcodec_decode_video2(AVCodecContext *avctx, AVFrame *picture, - int *got_picture_ptr, - const AVPacket *avpkt); - -/** - * Decode a subtitle message. - * Return a negative value on error, otherwise return the number of bytes used. - * If no subtitle could be decompressed, got_sub_ptr is zero. - * Otherwise, the subtitle is stored in *sub. - * Note that CODEC_CAP_DR1 is not available for subtitle codecs. This is for - * simplicity, because the performance difference is expect to be negligible - * and reusing a get_buffer written for video codecs would probably perform badly - * due to a potentially very different allocation pattern. - * - * Some decoders (those marked with CODEC_CAP_DELAY) have a delay between input - * and output. This means that for some packets they will not immediately - * produce decoded output and need to be flushed at the end of decoding to get - * all the decoded data. Flushing is done by calling this function with packets - * with avpkt->data set to NULL and avpkt->size set to 0 until it stops - * returning subtitles. It is safe to flush even those decoders that are not - * marked with CODEC_CAP_DELAY, then no subtitles will be returned. - * - * @param avctx the codec context - * @param[out] sub The AVSubtitle in which the decoded subtitle will be stored, must be - freed with avsubtitle_free if *got_sub_ptr is set. - * @param[in,out] got_sub_ptr Zero if no subtitle could be decompressed, otherwise, it is nonzero. - * @param[in] avpkt The input AVPacket containing the input buffer. - */ -int avcodec_decode_subtitle2(AVCodecContext *avctx, AVSubtitle *sub, - int *got_sub_ptr, - AVPacket *avpkt); - -/** - * @defgroup lavc_parsing Frame parsing - * @{ - */ - -enum AVPictureStructure { - AV_PICTURE_STRUCTURE_UNKNOWN, //< unknown - AV_PICTURE_STRUCTURE_TOP_FIELD, //< coded as top field - AV_PICTURE_STRUCTURE_BOTTOM_FIELD, //< coded as bottom field - AV_PICTURE_STRUCTURE_FRAME, //< coded as frame -}; - -typedef struct AVCodecParserContext { - void *priv_data; - struct AVCodecParser *parser; - int64_t frame_offset; /* offset of the current frame */ - int64_t cur_offset; /* current offset - (incremented by each av_parser_parse()) */ - int64_t next_frame_offset; /* offset of the next frame */ - /* video info */ - int pict_type; /* XXX: Put it back in AVCodecContext. */ - /** - * This field is used for proper frame duration computation in lavf. - * It signals, how much longer the frame duration of the current frame - * is compared to normal frame duration. - * - * frame_duration = (1 + repeat_pict) * time_base - * - * It is used by codecs like H.264 to display telecined material. - */ - int repeat_pict; /* XXX: Put it back in AVCodecContext. */ - int64_t pts; /* pts of the current frame */ - int64_t dts; /* dts of the current frame */ - - /* private data */ - int64_t last_pts; - int64_t last_dts; - int fetch_timestamp; - -#define AV_PARSER_PTS_NB 4 - int cur_frame_start_index; - int64_t cur_frame_offset[AV_PARSER_PTS_NB]; - int64_t cur_frame_pts[AV_PARSER_PTS_NB]; - int64_t cur_frame_dts[AV_PARSER_PTS_NB]; - - int flags; -#define PARSER_FLAG_COMPLETE_FRAMES 0x0001 -#define PARSER_FLAG_ONCE 0x0002 -/// Set if the parser has a valid file offset -#define PARSER_FLAG_FETCHED_OFFSET 0x0004 -#define PARSER_FLAG_USE_CODEC_TS 0x1000 - - int64_t offset; ///< byte offset from starting packet start - int64_t cur_frame_end[AV_PARSER_PTS_NB]; - - /** - * Set by parser to 1 for key frames and 0 for non-key frames. - * It is initialized to -1, so if the parser doesn't set this flag, - * old-style fallback using AV_PICTURE_TYPE_I picture type as key frames - * will be used. - */ - int key_frame; - - /** - * Time difference in stream time base units from the pts of this - * packet to the point at which the output from the decoder has converged - * independent from the availability of previous frames. That is, the - * frames are virtually identical no matter if decoding started from - * the very first frame or from this keyframe. - * Is AV_NOPTS_VALUE if unknown. - * This field is not the display duration of the current frame. - * This field has no meaning if the packet does not have AV_PKT_FLAG_KEY - * set. - * - * The purpose of this field is to allow seeking in streams that have no - * keyframes in the conventional sense. It corresponds to the - * recovery point SEI in H.264 and match_time_delta in NUT. It is also - * essential for some types of subtitle streams to ensure that all - * subtitles are correctly displayed after seeking. - */ - int64_t convergence_duration; - - // Timestamp generation support: - /** - * Synchronization point for start of timestamp generation. - * - * Set to >0 for sync point, 0 for no sync point and <0 for undefined - * (default). - * - * For example, this corresponds to presence of H.264 buffering period - * SEI message. - */ - int dts_sync_point; - - /** - * Offset of the current timestamp against last timestamp sync point in - * units of AVCodecContext.time_base. - * - * Set to INT_MIN when dts_sync_point unused. Otherwise, it must - * contain a valid timestamp offset. - * - * Note that the timestamp of sync point has usually a nonzero - * dts_ref_dts_delta, which refers to the previous sync point. Offset of - * the next frame after timestamp sync point will be usually 1. - * - * For example, this corresponds to H.264 cpb_removal_delay. - */ - int dts_ref_dts_delta; - - /** - * Presentation delay of current frame in units of AVCodecContext.time_base. - * - * Set to INT_MIN when dts_sync_point unused. Otherwise, it must - * contain valid non-negative timestamp delta (presentation time of a frame - * must not lie in the past). - * - * This delay represents the difference between decoding and presentation - * time of the frame. - * - * For example, this corresponds to H.264 dpb_output_delay. - */ - int pts_dts_delta; - - /** - * Position of the packet in file. - * - * Analogous to cur_frame_pts/dts - */ - int64_t cur_frame_pos[AV_PARSER_PTS_NB]; - - /** - * Byte position of currently parsed frame in stream. - */ - int64_t pos; - - /** - * Previous frame byte position. - */ - int64_t last_pos; - - /** - * Duration of the current frame. - * For audio, this is in units of 1 / AVCodecContext.sample_rate. - * For all other types, this is in units of AVCodecContext.time_base. - */ - int duration; - - enum AVFieldOrder field_order; - - /** - * Indicate whether a picture is coded as a frame, top field or bottom field. - * - * For example, H.264 field_pic_flag equal to 0 corresponds to - * AV_PICTURE_STRUCTURE_FRAME. An H.264 picture with field_pic_flag - * equal to 1 and bottom_field_flag equal to 0 corresponds to - * AV_PICTURE_STRUCTURE_TOP_FIELD. - */ - enum AVPictureStructure picture_structure; - - /** - * Picture number incremented in presentation or output order. - * This field may be reinitialized at the first picture of a new sequence. - * - * For example, this corresponds to H.264 PicOrderCnt. - */ - int output_picture_number; -} AVCodecParserContext; - -typedef struct AVCodecParser { - int codec_ids[5]; /* several codec IDs are permitted */ - int priv_data_size; - int (*parser_init)(AVCodecParserContext *s); - int (*parser_parse)(AVCodecParserContext *s, - AVCodecContext *avctx, - const uint8_t **poutbuf, int *poutbuf_size, - const uint8_t *buf, int buf_size); - void (*parser_close)(AVCodecParserContext *s); - int (*split)(AVCodecContext *avctx, const uint8_t *buf, int buf_size); - struct AVCodecParser *next; -} AVCodecParser; - -AVCodecParser *av_parser_next(AVCodecParser *c); - -void av_register_codec_parser(AVCodecParser *parser); -AVCodecParserContext *av_parser_init(int codec_id); - -/** - * Parse a packet. - * - * @param s parser context. - * @param avctx codec context. - * @param poutbuf set to pointer to parsed buffer or NULL if not yet finished. - * @param poutbuf_size set to size of parsed buffer or zero if not yet finished. - * @param buf input buffer. - * @param buf_size input length, to signal EOF, this should be 0 (so that the last frame can be output). - * @param pts input presentation timestamp. - * @param dts input decoding timestamp. - * @param pos input byte position in stream. - * @return the number of bytes of the input bitstream used. - * - * Example: - * @code - * while(in_len){ - * len = av_parser_parse2(myparser, AVCodecContext, &data, &size, - * in_data, in_len, - * pts, dts, pos); - * in_data += len; - * in_len -= len; - * - * if(size) - * decode_frame(data, size); - * } - * @endcode - */ -int av_parser_parse2(AVCodecParserContext *s, - AVCodecContext *avctx, - uint8_t **poutbuf, int *poutbuf_size, - const uint8_t *buf, int buf_size, - int64_t pts, int64_t dts, - int64_t pos); - -/** - * @return 0 if the output buffer is a subset of the input, 1 if it is allocated and must be freed - * @deprecated use AVBitStreamFilter - */ -int av_parser_change(AVCodecParserContext *s, - AVCodecContext *avctx, - uint8_t **poutbuf, int *poutbuf_size, - const uint8_t *buf, int buf_size, int keyframe); -void av_parser_close(AVCodecParserContext *s); - -/** - * @} - * @} - */ - -/** - * @addtogroup lavc_encoding - * @{ - */ - -/** - * Find a registered encoder with a matching codec ID. - * - * @param id AVCodecID of the requested encoder - * @return An encoder if one was found, NULL otherwise. - */ -AVCodec *avcodec_find_encoder(enum AVCodecID id); - -/** - * Find a registered encoder with the specified name. - * - * @param name name of the requested encoder - * @return An encoder if one was found, NULL otherwise. - */ -AVCodec *avcodec_find_encoder_by_name(const char *name); - -#if FF_API_OLD_ENCODE_AUDIO -/** - * Encode an audio frame from samples into buf. - * - * @deprecated Use avcodec_encode_audio2 instead. - * - * @note The output buffer should be at least FF_MIN_BUFFER_SIZE bytes large. - * However, for codecs with avctx->frame_size equal to 0 (e.g. PCM) the user - * will know how much space is needed because it depends on the value passed - * in buf_size as described below. In that case a lower value can be used. - * - * @param avctx the codec context - * @param[out] buf the output buffer - * @param[in] buf_size the output buffer size - * @param[in] samples the input buffer containing the samples - * The number of samples read from this buffer is frame_size*channels, - * both of which are defined in avctx. - * For codecs which have avctx->frame_size equal to 0 (e.g. PCM) the number of - * samples read from samples is equal to: - * buf_size * 8 / (avctx->channels * av_get_bits_per_sample(avctx->codec_id)) - * This also implies that av_get_bits_per_sample() must not return 0 for these - * codecs. - * @return On error a negative value is returned, on success zero or the number - * of bytes used to encode the data read from the input buffer. - */ -int attribute_deprecated avcodec_encode_audio(AVCodecContext *avctx, - uint8_t *buf, int buf_size, - const short *samples); -#endif - -/** - * Encode a frame of audio. - * - * Takes input samples from frame and writes the next output packet, if - * available, to avpkt. The output packet does not necessarily contain data for - * the most recent frame, as encoders can delay, split, and combine input frames - * internally as needed. - * - * @param avctx codec context - * @param avpkt output AVPacket. - * The user can supply an output buffer by setting - * avpkt->data and avpkt->size prior to calling the - * function, but if the size of the user-provided data is not - * large enough, encoding will fail. If avpkt->data and - * avpkt->size are set, avpkt->destruct must also be set. All - * other AVPacket fields will be reset by the encoder using - * av_init_packet(). If avpkt->data is NULL, the encoder will - * allocate it. The encoder will set avpkt->size to the size - * of the output packet. - * - * If this function fails or produces no output, avpkt will be - * freed using av_free_packet() (i.e. avpkt->destruct will be - * called to free the user supplied buffer). - * @param[in] frame AVFrame containing the raw audio data to be encoded. - * May be NULL when flushing an encoder that has the - * CODEC_CAP_DELAY capability set. - * If CODEC_CAP_VARIABLE_FRAME_SIZE is set, then each frame - * can have any number of samples. - * If it is not set, frame->nb_samples must be equal to - * avctx->frame_size for all frames except the last. - * The final frame may be smaller than avctx->frame_size. - * @param[out] got_packet_ptr This field is set to 1 by libavcodec if the - * output packet is non-empty, and to 0 if it is - * empty. If the function returns an error, the - * packet can be assumed to be invalid, and the - * value of got_packet_ptr is undefined and should - * not be used. - * @return 0 on success, negative error code on failure - */ -int avcodec_encode_audio2(AVCodecContext *avctx, AVPacket *avpkt, - const AVFrame *frame, int *got_packet_ptr); - -#if FF_API_OLD_ENCODE_VIDEO -/** - * @deprecated use avcodec_encode_video2() instead. - * - * Encode a video frame from pict into buf. - * The input picture should be - * stored using a specific format, namely avctx.pix_fmt. - * - * @param avctx the codec context - * @param[out] buf the output buffer for the bitstream of encoded frame - * @param[in] buf_size the size of the output buffer in bytes - * @param[in] pict the input picture to encode - * @return On error a negative value is returned, on success zero or the number - * of bytes used from the output buffer. - */ -attribute_deprecated -int avcodec_encode_video(AVCodecContext *avctx, uint8_t *buf, int buf_size, - const AVFrame *pict); -#endif - -/** - * Encode a frame of video. - * - * Takes input raw video data from frame and writes the next output packet, if - * available, to avpkt. The output packet does not necessarily contain data for - * the most recent frame, as encoders can delay and reorder input frames - * internally as needed. - * - * @param avctx codec context - * @param avpkt output AVPacket. - * The user can supply an output buffer by setting - * avpkt->data and avpkt->size prior to calling the - * function, but if the size of the user-provided data is not - * large enough, encoding will fail. All other AVPacket fields - * will be reset by the encoder using av_init_packet(). If - * avpkt->data is NULL, the encoder will allocate it. - * The encoder will set avpkt->size to the size of the - * output packet. The returned data (if any) belongs to the - * caller, he is responsible for freeing it. - * - * If this function fails or produces no output, avpkt will be - * freed using av_free_packet() (i.e. avpkt->destruct will be - * called to free the user supplied buffer). - * @param[in] frame AVFrame containing the raw video data to be encoded. - * May be NULL when flushing an encoder that has the - * CODEC_CAP_DELAY capability set. - * @param[out] got_packet_ptr This field is set to 1 by libavcodec if the - * output packet is non-empty, and to 0 if it is - * empty. If the function returns an error, the - * packet can be assumed to be invalid, and the - * value of got_packet_ptr is undefined and should - * not be used. - * @return 0 on success, negative error code on failure - */ -int avcodec_encode_video2(AVCodecContext *avctx, AVPacket *avpkt, - const AVFrame *frame, int *got_packet_ptr); - -int avcodec_encode_subtitle(AVCodecContext *avctx, uint8_t *buf, int buf_size, - const AVSubtitle *sub); - - -/** - * @} - */ - -#if FF_API_AVCODEC_RESAMPLE -/** - * @defgroup lavc_resample Audio resampling - * @ingroup libavc - * @deprecated use libswresample instead - * - * @{ - */ -struct ReSampleContext; -struct AVResampleContext; - -typedef struct ReSampleContext ReSampleContext; - -/** - * Initialize audio resampling context. - * - * @param output_channels number of output channels - * @param input_channels number of input channels - * @param output_rate output sample rate - * @param input_rate input sample rate - * @param sample_fmt_out requested output sample format - * @param sample_fmt_in input sample format - * @param filter_length length of each FIR filter in the filterbank relative to the cutoff frequency - * @param log2_phase_count log2 of the number of entries in the polyphase filterbank - * @param linear if 1 then the used FIR filter will be linearly interpolated - between the 2 closest, if 0 the closest will be used - * @param cutoff cutoff frequency, 1.0 corresponds to half the output sampling rate - * @return allocated ReSampleContext, NULL if error occurred - */ -attribute_deprecated -ReSampleContext *av_audio_resample_init(int output_channels, int input_channels, - int output_rate, int input_rate, - enum AVSampleFormat sample_fmt_out, - enum AVSampleFormat sample_fmt_in, - int filter_length, int log2_phase_count, - int linear, double cutoff); - -attribute_deprecated -int audio_resample(ReSampleContext *s, short *output, short *input, int nb_samples); - -/** - * Free resample context. - * - * @param s a non-NULL pointer to a resample context previously - * created with av_audio_resample_init() - */ -attribute_deprecated -void audio_resample_close(ReSampleContext *s); - - -/** - * Initialize an audio resampler. - * Note, if either rate is not an integer then simply scale both rates up so they are. - * @param filter_length length of each FIR filter in the filterbank relative to the cutoff freq - * @param log2_phase_count log2 of the number of entries in the polyphase filterbank - * @param linear If 1 then the used FIR filter will be linearly interpolated - between the 2 closest, if 0 the closest will be used - * @param cutoff cutoff frequency, 1.0 corresponds to half the output sampling rate - */ -attribute_deprecated -struct AVResampleContext *av_resample_init(int out_rate, int in_rate, int filter_length, int log2_phase_count, int linear, double cutoff); - -/** - * Resample an array of samples using a previously configured context. - * @param src an array of unconsumed samples - * @param consumed the number of samples of src which have been consumed are returned here - * @param src_size the number of unconsumed samples available - * @param dst_size the amount of space in samples available in dst - * @param update_ctx If this is 0 then the context will not be modified, that way several channels can be resampled with the same context. - * @return the number of samples written in dst or -1 if an error occurred - */ -attribute_deprecated -int av_resample(struct AVResampleContext *c, short *dst, short *src, int *consumed, int src_size, int dst_size, int update_ctx); - - -/** - * Compensate samplerate/timestamp drift. The compensation is done by changing - * the resampler parameters, so no audible clicks or similar distortions occur - * @param compensation_distance distance in output samples over which the compensation should be performed - * @param sample_delta number of output samples which should be output less - * - * example: av_resample_compensate(c, 10, 500) - * here instead of 510 samples only 500 samples would be output - * - * note, due to rounding the actual compensation might be slightly different, - * especially if the compensation_distance is large and the in_rate used during init is small - */ -attribute_deprecated -void av_resample_compensate(struct AVResampleContext *c, int sample_delta, int compensation_distance); -attribute_deprecated -void av_resample_close(struct AVResampleContext *c); - -/** - * @} - */ -#endif - -/** - * @addtogroup lavc_picture - * @{ - */ - -/** - * Allocate memory for the pixels of a picture and setup the AVPicture - * fields for it. - * - * Call avpicture_free() to free it. - * - * @param picture the picture structure to be filled in - * @param pix_fmt the pixel format of the picture - * @param width the width of the picture - * @param height the height of the picture - * @return zero if successful, a negative error code otherwise - * - * @see av_image_alloc(), avpicture_fill() - */ -int avpicture_alloc(AVPicture *picture, enum AVPixelFormat pix_fmt, int width, int height); - -/** - * Free a picture previously allocated by avpicture_alloc(). - * The data buffer used by the AVPicture is freed, but the AVPicture structure - * itself is not. - * - * @param picture the AVPicture to be freed - */ -void avpicture_free(AVPicture *picture); - -/** - * Setup the picture fields based on the specified image parameters - * and the provided image data buffer. - * - * The picture fields are filled in by using the image data buffer - * pointed to by ptr. - * - * If ptr is NULL, the function will fill only the picture linesize - * array and return the required size for the image buffer. - * - * To allocate an image buffer and fill the picture data in one call, - * use avpicture_alloc(). - * - * @param picture the picture to be filled in - * @param ptr buffer where the image data is stored, or NULL - * @param pix_fmt the pixel format of the image - * @param width the width of the image in pixels - * @param height the height of the image in pixels - * @return the size in bytes required for src, a negative error code - * in case of failure - * - * @see av_image_fill_arrays() - */ -int avpicture_fill(AVPicture *picture, const uint8_t *ptr, - enum AVPixelFormat pix_fmt, int width, int height); - -/** - * Copy pixel data from an AVPicture into a buffer. - * - * avpicture_get_size() can be used to compute the required size for - * the buffer to fill. - * - * @param src source picture with filled data - * @param pix_fmt picture pixel format - * @param width picture width - * @param height picture height - * @param dest destination buffer - * @param dest_size destination buffer size in bytes - * @return the number of bytes written to dest, or a negative value - * (error code) on error, for example if the destination buffer is not - * big enough - * - * @see av_image_copy_to_buffer() - */ -int avpicture_layout(const AVPicture *src, enum AVPixelFormat pix_fmt, - int width, int height, - unsigned char *dest, int dest_size); - -/** - * Calculate the size in bytes that a picture of the given width and height - * would occupy if stored in the given picture format. - * - * @param pix_fmt picture pixel format - * @param width picture width - * @param height picture height - * @return the computed picture buffer size or a negative error code - * in case of error - * - * @see av_image_get_buffer_size(). - */ -int avpicture_get_size(enum AVPixelFormat pix_fmt, int width, int height); - -#if FF_API_DEINTERLACE -/** - * deinterlace - if not supported return -1 - * - * @deprecated - use yadif (in libavfilter) instead - */ -attribute_deprecated -int avpicture_deinterlace(AVPicture *dst, const AVPicture *src, - enum AVPixelFormat pix_fmt, int width, int height); -#endif -/** - * Copy image src to dst. Wraps av_image_copy(). - */ -void av_picture_copy(AVPicture *dst, const AVPicture *src, - enum AVPixelFormat pix_fmt, int width, int height); - -/** - * Crop image top and left side. - */ -int av_picture_crop(AVPicture *dst, const AVPicture *src, - enum AVPixelFormat pix_fmt, int top_band, int left_band); - -/** - * Pad image. - */ -int av_picture_pad(AVPicture *dst, const AVPicture *src, int height, int width, enum AVPixelFormat pix_fmt, - int padtop, int padbottom, int padleft, int padright, int *color); - -/** - * @} - */ - -/** - * @defgroup lavc_misc Utility functions - * @ingroup libavc - * - * Miscellaneous utility functions related to both encoding and decoding - * (or neither). - * @{ - */ - -/** - * @defgroup lavc_misc_pixfmt Pixel formats - * - * Functions for working with pixel formats. - * @{ - */ - -/** - * Utility function to access log2_chroma_w log2_chroma_h from - * the pixel format AVPixFmtDescriptor. - * - * This function asserts that pix_fmt is valid. See av_pix_fmt_get_chroma_sub_sample - * for one that returns a failure code and continues in case of invalid - * pix_fmts. - * - * @param[in] pix_fmt the pixel format - * @param[out] h_shift store log2_chroma_w - * @param[out] v_shift store log2_chroma_h - * - * @see av_pix_fmt_get_chroma_sub_sample - */ - -void avcodec_get_chroma_sub_sample(enum AVPixelFormat pix_fmt, int *h_shift, int *v_shift); - -/** - * Return a value representing the fourCC code associated to the - * pixel format pix_fmt, or 0 if no associated fourCC code can be - * found. - */ -unsigned int avcodec_pix_fmt_to_codec_tag(enum AVPixelFormat pix_fmt); - -/** - * @deprecated see av_get_pix_fmt_loss() - */ -int avcodec_get_pix_fmt_loss(enum AVPixelFormat dst_pix_fmt, enum AVPixelFormat src_pix_fmt, - int has_alpha); - -/** - * Find the best pixel format to convert to given a certain source pixel - * format. When converting from one pixel format to another, information loss - * may occur. For example, when converting from RGB24 to GRAY, the color - * information will be lost. Similarly, other losses occur when converting from - * some formats to other formats. avcodec_find_best_pix_fmt_of_2() searches which of - * the given pixel formats should be used to suffer the least amount of loss. - * The pixel formats from which it chooses one, are determined by the - * pix_fmt_list parameter. - * - * - * @param[in] pix_fmt_list AV_PIX_FMT_NONE terminated array of pixel formats to choose from - * @param[in] src_pix_fmt source pixel format - * @param[in] has_alpha Whether the source pixel format alpha channel is used. - * @param[out] loss_ptr Combination of flags informing you what kind of losses will occur. - * @return The best pixel format to convert to or -1 if none was found. - */ -enum AVPixelFormat avcodec_find_best_pix_fmt_of_list(const enum AVPixelFormat *pix_fmt_list, - enum AVPixelFormat src_pix_fmt, - int has_alpha, int *loss_ptr); - -/** - * @deprecated see av_find_best_pix_fmt_of_2() - */ -enum AVPixelFormat avcodec_find_best_pix_fmt_of_2(enum AVPixelFormat dst_pix_fmt1, enum AVPixelFormat dst_pix_fmt2, - enum AVPixelFormat src_pix_fmt, int has_alpha, int *loss_ptr); - -attribute_deprecated -#if AV_HAVE_INCOMPATIBLE_LIBAV_ABI -enum AVPixelFormat avcodec_find_best_pix_fmt2(const enum AVPixelFormat *pix_fmt_list, - enum AVPixelFormat src_pix_fmt, - int has_alpha, int *loss_ptr); -#else -enum AVPixelFormat avcodec_find_best_pix_fmt2(enum AVPixelFormat dst_pix_fmt1, enum AVPixelFormat dst_pix_fmt2, - enum AVPixelFormat src_pix_fmt, int has_alpha, int *loss_ptr); -#endif - - -enum AVPixelFormat avcodec_default_get_format(struct AVCodecContext *s, const enum AVPixelFormat * fmt); - -/** - * @} - */ - -#if FF_API_SET_DIMENSIONS -/** - * @deprecated this function is not supposed to be used from outside of lavc - */ -attribute_deprecated -void avcodec_set_dimensions(AVCodecContext *s, int width, int height); -#endif - -/** - * Put a string representing the codec tag codec_tag in buf. - * - * @param buf buffer to place codec tag in - * @param buf_size size in bytes of buf - * @param codec_tag codec tag to assign - * @return the length of the string that would have been generated if - * enough space had been available, excluding the trailing null - */ -size_t av_get_codec_tag_string(char *buf, size_t buf_size, unsigned int codec_tag); - -void avcodec_string(char *buf, int buf_size, AVCodecContext *enc, int encode); - -/** - * Return a name for the specified profile, if available. - * - * @param codec the codec that is searched for the given profile - * @param profile the profile value for which a name is requested - * @return A name for the profile if found, NULL otherwise. - */ -const char *av_get_profile_name(const AVCodec *codec, int profile); - -int avcodec_default_execute(AVCodecContext *c, int (*func)(AVCodecContext *c2, void *arg2),void *arg, int *ret, int count, int size); -int avcodec_default_execute2(AVCodecContext *c, int (*func)(AVCodecContext *c2, void *arg2, int, int),void *arg, int *ret, int count); -//FIXME func typedef - -/** - * Fill AVFrame audio data and linesize pointers. - * - * The buffer buf must be a preallocated buffer with a size big enough - * to contain the specified samples amount. The filled AVFrame data - * pointers will point to this buffer. - * - * AVFrame extended_data channel pointers are allocated if necessary for - * planar audio. - * - * @param frame the AVFrame - * frame->nb_samples must be set prior to calling the - * function. This function fills in frame->data, - * frame->extended_data, frame->linesize[0]. - * @param nb_channels channel count - * @param sample_fmt sample format - * @param buf buffer to use for frame data - * @param buf_size size of buffer - * @param align plane size sample alignment (0 = default) - * @return >=0 on success, negative error code on failure - * @todo return the size in bytes required to store the samples in - * case of success, at the next libavutil bump - */ -int avcodec_fill_audio_frame(AVFrame *frame, int nb_channels, - enum AVSampleFormat sample_fmt, const uint8_t *buf, - int buf_size, int align); - -/** - * Reset the internal decoder state / flush internal buffers. Should be called - * e.g. when seeking or when switching to a different stream. - * - * @note when refcounted frames are not used (i.e. avctx->refcounted_frames is 0), - * this invalidates the frames previously returned from the decoder. When - * refcounted frames are used, the decoder just releases any references it might - * keep internally, but the caller's reference remains valid. - */ -void avcodec_flush_buffers(AVCodecContext *avctx); - -/** - * Return codec bits per sample. - * - * @param[in] codec_id the codec - * @return Number of bits per sample or zero if unknown for the given codec. - */ -int av_get_bits_per_sample(enum AVCodecID codec_id); - -/** - * Return the PCM codec associated with a sample format. - * @param be endianness, 0 for little, 1 for big, - * -1 (or anything else) for native - * @return AV_CODEC_ID_PCM_* or AV_CODEC_ID_NONE - */ -enum AVCodecID av_get_pcm_codec(enum AVSampleFormat fmt, int be); - -/** - * Return codec bits per sample. - * Only return non-zero if the bits per sample is exactly correct, not an - * approximation. - * - * @param[in] codec_id the codec - * @return Number of bits per sample or zero if unknown for the given codec. - */ -int av_get_exact_bits_per_sample(enum AVCodecID codec_id); - -/** - * Return audio frame duration. - * - * @param avctx codec context - * @param frame_bytes size of the frame, or 0 if unknown - * @return frame duration, in samples, if known. 0 if not able to - * determine. - */ -int av_get_audio_frame_duration(AVCodecContext *avctx, int frame_bytes); - - -typedef struct AVBitStreamFilterContext { - void *priv_data; - struct AVBitStreamFilter *filter; - AVCodecParserContext *parser; - struct AVBitStreamFilterContext *next; -} AVBitStreamFilterContext; - - -typedef struct AVBitStreamFilter { - const char *name; - int priv_data_size; - int (*filter)(AVBitStreamFilterContext *bsfc, - AVCodecContext *avctx, const char *args, - uint8_t **poutbuf, int *poutbuf_size, - const uint8_t *buf, int buf_size, int keyframe); - void (*close)(AVBitStreamFilterContext *bsfc); - struct AVBitStreamFilter *next; -} AVBitStreamFilter; - -/** - * Register a bitstream filter. - * - * The filter will be accessible to the application code through - * av_bitstream_filter_next() or can be directly initialized with - * av_bitstream_filter_init(). - * - * @see avcodec_register_all() - */ -void av_register_bitstream_filter(AVBitStreamFilter *bsf); - -/** - * Create and initialize a bitstream filter context given a bitstream - * filter name. - * - * The returned context must be freed with av_bitstream_filter_close(). - * - * @param name the name of the bitstream filter - * @return a bitstream filter context if a matching filter was found - * and successfully initialized, NULL otherwise - */ -AVBitStreamFilterContext *av_bitstream_filter_init(const char *name); - -/** - * Filter bitstream. - * - * This function filters the buffer buf with size buf_size, and places the - * filtered buffer in the buffer pointed to by poutbuf. - * - * The output buffer must be freed by the caller. - * - * @param bsfc bitstream filter context created by av_bitstream_filter_init() - * @param avctx AVCodecContext accessed by the filter, may be NULL. - * If specified, this must point to the encoder context of the - * output stream the packet is sent to. - * @param args arguments which specify the filter configuration, may be NULL - * @param poutbuf pointer which is updated to point to the filtered buffer - * @param poutbuf_size pointer which is updated to the filtered buffer size in bytes - * @param buf buffer containing the data to filter - * @param buf_size size in bytes of buf - * @param keyframe set to non-zero if the buffer to filter corresponds to a key-frame packet data - * @return >= 0 in case of success, or a negative error code in case of failure - * - * If the return value is positive, an output buffer is allocated and - * is availble in *poutbuf, and is distinct from the input buffer. - * - * If the return value is 0, the output buffer is not allocated and - * should be considered identical to the input buffer, or in case - * *poutbuf was set it points to the input buffer (not necessarily to - * its starting address). - */ -int av_bitstream_filter_filter(AVBitStreamFilterContext *bsfc, - AVCodecContext *avctx, const char *args, - uint8_t **poutbuf, int *poutbuf_size, - const uint8_t *buf, int buf_size, int keyframe); - -/** - * Release bitstream filter context. - * - * @param bsf the bitstream filter context created with - * av_bitstream_filter_init(), can be NULL - */ -void av_bitstream_filter_close(AVBitStreamFilterContext *bsf); - -/** - * If f is NULL, return the first registered bitstream filter, - * if f is non-NULL, return the next registered bitstream filter - * after f, or NULL if f is the last one. - * - * This function can be used to iterate over all registered bitstream - * filters. - */ -AVBitStreamFilter *av_bitstream_filter_next(AVBitStreamFilter *f); - -/* memory */ - -/** - * Same behaviour av_fast_malloc but the buffer has additional - * FF_INPUT_BUFFER_PADDING_SIZE at the end which will always be 0. - * - * In addition the whole buffer will initially and after resizes - * be 0-initialized so that no uninitialized data will ever appear. - */ -void av_fast_padded_malloc(void *ptr, unsigned int *size, size_t min_size); - -/** - * Same behaviour av_fast_padded_malloc except that buffer will always - * be 0-initialized after call. - */ -void av_fast_padded_mallocz(void *ptr, unsigned int *size, size_t min_size); - -/** - * Encode extradata length to a buffer. Used by xiph codecs. - * - * @param s buffer to write to; must be at least (v/255+1) bytes long - * @param v size of extradata in bytes - * @return number of bytes written to the buffer. - */ -unsigned int av_xiphlacing(unsigned char *s, unsigned int v); - -#if FF_API_MISSING_SAMPLE -/** - * Log a generic warning message about a missing feature. This function is - * intended to be used internally by FFmpeg (libavcodec, libavformat, etc.) - * only, and would normally not be used by applications. - * @param[in] avc a pointer to an arbitrary struct of which the first field is - * a pointer to an AVClass struct - * @param[in] feature string containing the name of the missing feature - * @param[in] want_sample indicates if samples are wanted which exhibit this feature. - * If want_sample is non-zero, additional verbage will be added to the log - * message which tells the user how to report samples to the development - * mailing list. - * @deprecated Use avpriv_report_missing_feature() instead. - */ -attribute_deprecated -void av_log_missing_feature(void *avc, const char *feature, int want_sample); - -/** - * Log a generic warning message asking for a sample. This function is - * intended to be used internally by FFmpeg (libavcodec, libavformat, etc.) - * only, and would normally not be used by applications. - * @param[in] avc a pointer to an arbitrary struct of which the first field is - * a pointer to an AVClass struct - * @param[in] msg string containing an optional message, or NULL if no message - * @deprecated Use avpriv_request_sample() instead. - */ -attribute_deprecated -void av_log_ask_for_sample(void *avc, const char *msg, ...) av_printf_format(2, 3); -#endif /* FF_API_MISSING_SAMPLE */ - -/** - * Register the hardware accelerator hwaccel. - */ -void av_register_hwaccel(AVHWAccel *hwaccel); - -/** - * If hwaccel is NULL, returns the first registered hardware accelerator, - * if hwaccel is non-NULL, returns the next registered hardware accelerator - * after hwaccel, or NULL if hwaccel is the last one. - */ -AVHWAccel *av_hwaccel_next(AVHWAccel *hwaccel); - - -/** - * Lock operation used by lockmgr - */ -enum AVLockOp { - AV_LOCK_CREATE, ///< Create a mutex - AV_LOCK_OBTAIN, ///< Lock the mutex - AV_LOCK_RELEASE, ///< Unlock the mutex - AV_LOCK_DESTROY, ///< Free mutex resources -}; - -/** - * Register a user provided lock manager supporting the operations - * specified by AVLockOp. mutex points to a (void *) where the - * lockmgr should store/get a pointer to a user allocated mutex. It's - * NULL upon AV_LOCK_CREATE and != NULL for all other ops. - * - * @param cb User defined callback. Note: FFmpeg may invoke calls to this - * callback during the call to av_lockmgr_register(). - * Thus, the application must be prepared to handle that. - * If cb is set to NULL the lockmgr will be unregistered. - * Also note that during unregistration the previously registered - * lockmgr callback may also be invoked. - */ -int av_lockmgr_register(int (*cb)(void **mutex, enum AVLockOp op)); - -/** - * Get the type of the given codec. - */ -enum AVMediaType avcodec_get_type(enum AVCodecID codec_id); - -/** - * Get the name of a codec. - * @return a static string identifying the codec; never NULL - */ -const char *avcodec_get_name(enum AVCodecID id); - -/** - * @return a positive value if s is open (i.e. avcodec_open2() was called on it - * with no corresponding avcodec_close()), 0 otherwise. - */ -int avcodec_is_open(AVCodecContext *s); - -/** - * @return a non-zero number if codec is an encoder, zero otherwise - */ -int av_codec_is_encoder(const AVCodec *codec); - -/** - * @return a non-zero number if codec is a decoder, zero otherwise - */ -int av_codec_is_decoder(const AVCodec *codec); - -/** - * @return descriptor for given codec ID or NULL if no descriptor exists. - */ -const AVCodecDescriptor *avcodec_descriptor_get(enum AVCodecID id); - -/** - * Iterate over all codec descriptors known to libavcodec. - * - * @param prev previous descriptor. NULL to get the first descriptor. - * - * @return next descriptor or NULL after the last descriptor - */ -const AVCodecDescriptor *avcodec_descriptor_next(const AVCodecDescriptor *prev); - -/** - * @return codec descriptor with the given name or NULL if no such descriptor - * exists. - */ -const AVCodecDescriptor *avcodec_descriptor_get_by_name(const char *name); - -/** - * @} - */ - -#endif /* AVCODEC_AVCODEC_H */ diff --git a/dji_sdk_manifold_read_cam/include/libavcodec/avfft.h b/dji_sdk_manifold_read_cam/include/libavcodec/avfft.h deleted file mode 100644 index 0c0f9b8..0000000 --- a/dji_sdk_manifold_read_cam/include/libavcodec/avfft.h +++ /dev/null @@ -1,118 +0,0 @@ -/* - * This file is part of FFmpeg. - * - * FFmpeg is free software; you can redistribute it and/or - * modify it under the terms of the GNU Lesser General Public - * License as published by the Free Software Foundation; either - * version 2.1 of the License, or (at your option) any later version. - * - * FFmpeg is distributed in the hope that it will be useful, - * but WITHOUT ANY WARRANTY; without even the implied warranty of - * MERCHANTABILITY or FITNESS FOR A PARTICULAR PURPOSE. See the GNU - * Lesser General Public License for more details. - * - * You should have received a copy of the GNU Lesser General Public - * License along with FFmpeg; if not, write to the Free Software - * Foundation, Inc., 51 Franklin Street, Fifth Floor, Boston, MA 02110-1301 USA - */ - -#ifndef AVCODEC_AVFFT_H -#define AVCODEC_AVFFT_H - -/** - * @file - * @ingroup lavc_fft - * FFT functions - */ - -/** - * @defgroup lavc_fft FFT functions - * @ingroup lavc_misc - * - * @{ - */ - -typedef float FFTSample; - -typedef struct FFTComplex { - FFTSample re, im; -} FFTComplex; - -typedef struct FFTContext FFTContext; - -/** - * Set up a complex FFT. - * @param nbits log2 of the length of the input array - * @param inverse if 0 perform the forward transform, if 1 perform the inverse - */ -FFTContext *av_fft_init(int nbits, int inverse); - -/** - * Do the permutation needed BEFORE calling ff_fft_calc(). - */ -void av_fft_permute(FFTContext *s, FFTComplex *z); - -/** - * Do a complex FFT with the parameters defined in av_fft_init(). The - * input data must be permuted before. No 1.0/sqrt(n) normalization is done. - */ -void av_fft_calc(FFTContext *s, FFTComplex *z); - -void av_fft_end(FFTContext *s); - -FFTContext *av_mdct_init(int nbits, int inverse, double scale); -void av_imdct_calc(FFTContext *s, FFTSample *output, const FFTSample *input); -void av_imdct_half(FFTContext *s, FFTSample *output, const FFTSample *input); -void av_mdct_calc(FFTContext *s, FFTSample *output, const FFTSample *input); -void av_mdct_end(FFTContext *s); - -/* Real Discrete Fourier Transform */ - -enum RDFTransformType { - DFT_R2C, - IDFT_C2R, - IDFT_R2C, - DFT_C2R, -}; - -typedef struct RDFTContext RDFTContext; - -/** - * Set up a real FFT. - * @param nbits log2 of the length of the input array - * @param trans the type of transform - */ -RDFTContext *av_rdft_init(int nbits, enum RDFTransformType trans); -void av_rdft_calc(RDFTContext *s, FFTSample *data); -void av_rdft_end(RDFTContext *s); - -/* Discrete Cosine Transform */ - -typedef struct DCTContext DCTContext; - -enum DCTTransformType { - DCT_II = 0, - DCT_III, - DCT_I, - DST_I, -}; - -/** - * Set up DCT. - * - * @param nbits size of the input array: - * (1 << nbits) for DCT-II, DCT-III and DST-I - * (1 << nbits) + 1 for DCT-I - * @param type the type of transform - * - * @note the first element of the input of DST-I is ignored - */ -DCTContext *av_dct_init(int nbits, enum DCTTransformType type); -void av_dct_calc(DCTContext *s, FFTSample *data); -void av_dct_end (DCTContext *s); - -/** - * @} - */ - -#endif /* AVCODEC_AVFFT_H */ diff --git a/dji_sdk_manifold_read_cam/include/libavcodec/dxva2.h b/dji_sdk_manifold_read_cam/include/libavcodec/dxva2.h deleted file mode 100644 index 2639d89..0000000 --- a/dji_sdk_manifold_read_cam/include/libavcodec/dxva2.h +++ /dev/null @@ -1,96 +0,0 @@ -/* - * DXVA2 HW acceleration - * - * copyright (c) 2009 Laurent Aimar - * - * This file is part of FFmpeg. - * - * FFmpeg is free software; you can redistribute it and/or - * modify it under the terms of the GNU Lesser General Public - * License as published by the Free Software Foundation; either - * version 2.1 of the License, or (at your option) any later version. - * - * FFmpeg is distributed in the hope that it will be useful, - * but WITHOUT ANY WARRANTY; without even the implied warranty of - * MERCHANTABILITY or FITNESS FOR A PARTICULAR PURPOSE. See the GNU - * Lesser General Public License for more details. - * - * You should have received a copy of the GNU Lesser General Public - * License along with FFmpeg; if not, write to the Free Software - * Foundation, Inc., 51 Franklin Street, Fifth Floor, Boston, MA 02110-1301 USA - */ - -#ifndef AVCODEC_DXVA_H -#define AVCODEC_DXVA_H - -/** - * @file - * @ingroup lavc_codec_hwaccel_dxva2 - * Public libavcodec DXVA2 header. - */ - -#if defined(_WIN32_WINNT) && _WIN32_WINNT < 0x0600 -#undef _WIN32_WINNT -#endif - -#if !defined(_WIN32_WINNT) -#define _WIN32_WINNT 0x0600 -#endif - -#include -#include -#include - -/** - * @defgroup lavc_codec_hwaccel_dxva2 DXVA2 - * @ingroup lavc_codec_hwaccel - * - * @{ - */ - -#define FF_DXVA2_WORKAROUND_SCALING_LIST_ZIGZAG 1 ///< Work around for DXVA2 and old UVD/UVD+ ATI video cards -#define FF_DXVA2_WORKAROUND_INTEL_CLEARVIDEO 2 ///< Work around for DXVA2 and old Intel GPUs with ClearVideo interface - -/** - * This structure is used to provides the necessary configurations and data - * to the DXVA2 FFmpeg HWAccel implementation. - * - * The application must make it available as AVCodecContext.hwaccel_context. - */ -struct dxva_context { - /** - * DXVA2 decoder object - */ - IDirectXVideoDecoder *decoder; - - /** - * DXVA2 configuration used to create the decoder - */ - const DXVA2_ConfigPictureDecode *cfg; - - /** - * The number of surface in the surface array - */ - unsigned surface_count; - - /** - * The array of Direct3D surfaces used to create the decoder - */ - LPDIRECT3DSURFACE9 *surface; - - /** - * A bit field configuring the workarounds needed for using the decoder - */ - uint64_t workaround; - - /** - * Private to the FFmpeg AVHWAccel implementation - */ - unsigned report_id; -}; - -/** - * @} - */ - -#endif /* AVCODEC_DXVA_H */ diff --git a/dji_sdk_manifold_read_cam/include/libavcodec/old_codec_ids.h b/dji_sdk_manifold_read_cam/include/libavcodec/old_codec_ids.h deleted file mode 100644 index b956264..0000000 --- a/dji_sdk_manifold_read_cam/include/libavcodec/old_codec_ids.h +++ /dev/null @@ -1,399 +0,0 @@ -/* - * This file is part of FFmpeg. - * - * FFmpeg is free software; you can redistribute it and/or - * modify it under the terms of the GNU Lesser General Public - * License as published by the Free Software Foundation; either - * version 2.1 of the License, or (at your option) any later version. - * - * FFmpeg is distributed in the hope that it will be useful, - * but WITHOUT ANY WARRANTY; without even the implied warranty of - * MERCHANTABILITY or FITNESS FOR A PARTICULAR PURPOSE. See the GNU - * Lesser General Public License for more details. - * - * You should have received a copy of the GNU Lesser General Public - * License along with FFmpeg; if not, write to the Free Software - * Foundation, Inc., 51 Franklin Street, Fifth Floor, Boston, MA 02110-1301 USA - */ - -#ifndef AVCODEC_OLD_CODEC_IDS_H -#define AVCODEC_OLD_CODEC_IDS_H - -#include "libavutil/common.h" - -/* - * This header exists to prevent new codec IDs from being accidentally added to - * the deprecated list. - * Do not include it directly. It will be removed on next major bump - * - * Do not add new items to this list. Use the AVCodecID enum instead. - */ - - CODEC_ID_NONE = AV_CODEC_ID_NONE, - - /* video codecs */ - CODEC_ID_MPEG1VIDEO, - CODEC_ID_MPEG2VIDEO, ///< preferred ID for MPEG-1/2 video decoding -#if FF_API_XVMC - CODEC_ID_MPEG2VIDEO_XVMC, -#endif - CODEC_ID_H261, - CODEC_ID_H263, - CODEC_ID_RV10, - CODEC_ID_RV20, - CODEC_ID_MJPEG, - CODEC_ID_MJPEGB, - CODEC_ID_LJPEG, - CODEC_ID_SP5X, - CODEC_ID_JPEGLS, - CODEC_ID_MPEG4, - CODEC_ID_RAWVIDEO, - CODEC_ID_MSMPEG4V1, - CODEC_ID_MSMPEG4V2, - CODEC_ID_MSMPEG4V3, - CODEC_ID_WMV1, - CODEC_ID_WMV2, - CODEC_ID_H263P, - CODEC_ID_H263I, - CODEC_ID_FLV1, - CODEC_ID_SVQ1, - CODEC_ID_SVQ3, - CODEC_ID_DVVIDEO, - CODEC_ID_HUFFYUV, - CODEC_ID_CYUV, - CODEC_ID_H264, - CODEC_ID_INDEO3, - CODEC_ID_VP3, - CODEC_ID_THEORA, - CODEC_ID_ASV1, - CODEC_ID_ASV2, - CODEC_ID_FFV1, - CODEC_ID_4XM, - CODEC_ID_VCR1, - CODEC_ID_CLJR, - CODEC_ID_MDEC, - CODEC_ID_ROQ, - CODEC_ID_INTERPLAY_VIDEO, - CODEC_ID_XAN_WC3, - CODEC_ID_XAN_WC4, - CODEC_ID_RPZA, - CODEC_ID_CINEPAK, - CODEC_ID_WS_VQA, - CODEC_ID_MSRLE, - CODEC_ID_MSVIDEO1, - CODEC_ID_IDCIN, - CODEC_ID_8BPS, - CODEC_ID_SMC, - CODEC_ID_FLIC, - CODEC_ID_TRUEMOTION1, - CODEC_ID_VMDVIDEO, - CODEC_ID_MSZH, - CODEC_ID_ZLIB, - CODEC_ID_QTRLE, - CODEC_ID_TSCC, - CODEC_ID_ULTI, - CODEC_ID_QDRAW, - CODEC_ID_VIXL, - CODEC_ID_QPEG, - CODEC_ID_PNG, - CODEC_ID_PPM, - CODEC_ID_PBM, - CODEC_ID_PGM, - CODEC_ID_PGMYUV, - CODEC_ID_PAM, - CODEC_ID_FFVHUFF, - CODEC_ID_RV30, - CODEC_ID_RV40, - CODEC_ID_VC1, - CODEC_ID_WMV3, - CODEC_ID_LOCO, - CODEC_ID_WNV1, - CODEC_ID_AASC, - CODEC_ID_INDEO2, - CODEC_ID_FRAPS, - CODEC_ID_TRUEMOTION2, - CODEC_ID_BMP, - CODEC_ID_CSCD, - CODEC_ID_MMVIDEO, - CODEC_ID_ZMBV, - CODEC_ID_AVS, - CODEC_ID_SMACKVIDEO, - CODEC_ID_NUV, - CODEC_ID_KMVC, - CODEC_ID_FLASHSV, - CODEC_ID_CAVS, - CODEC_ID_JPEG2000, - CODEC_ID_VMNC, - CODEC_ID_VP5, - CODEC_ID_VP6, - CODEC_ID_VP6F, - CODEC_ID_TARGA, - CODEC_ID_DSICINVIDEO, - CODEC_ID_TIERTEXSEQVIDEO, - CODEC_ID_TIFF, - CODEC_ID_GIF, - CODEC_ID_DXA, - CODEC_ID_DNXHD, - CODEC_ID_THP, - CODEC_ID_SGI, - CODEC_ID_C93, - CODEC_ID_BETHSOFTVID, - CODEC_ID_PTX, - CODEC_ID_TXD, - CODEC_ID_VP6A, - CODEC_ID_AMV, - CODEC_ID_VB, - CODEC_ID_PCX, - CODEC_ID_SUNRAST, - CODEC_ID_INDEO4, - CODEC_ID_INDEO5, - CODEC_ID_MIMIC, - CODEC_ID_RL2, - CODEC_ID_ESCAPE124, - CODEC_ID_DIRAC, - CODEC_ID_BFI, - CODEC_ID_CMV, - CODEC_ID_MOTIONPIXELS, - CODEC_ID_TGV, - CODEC_ID_TGQ, - CODEC_ID_TQI, - CODEC_ID_AURA, - CODEC_ID_AURA2, - CODEC_ID_V210X, - CODEC_ID_TMV, - CODEC_ID_V210, - CODEC_ID_DPX, - CODEC_ID_MAD, - CODEC_ID_FRWU, - CODEC_ID_FLASHSV2, - CODEC_ID_CDGRAPHICS, - CODEC_ID_R210, - CODEC_ID_ANM, - CODEC_ID_BINKVIDEO, - CODEC_ID_IFF_ILBM, - CODEC_ID_IFF_BYTERUN1, - CODEC_ID_KGV1, - CODEC_ID_YOP, - CODEC_ID_VP8, - CODEC_ID_PICTOR, - CODEC_ID_ANSI, - CODEC_ID_A64_MULTI, - CODEC_ID_A64_MULTI5, - CODEC_ID_R10K, - CODEC_ID_MXPEG, - CODEC_ID_LAGARITH, - CODEC_ID_PRORES, - CODEC_ID_JV, - CODEC_ID_DFA, - CODEC_ID_WMV3IMAGE, - CODEC_ID_VC1IMAGE, - CODEC_ID_UTVIDEO, - CODEC_ID_BMV_VIDEO, - CODEC_ID_VBLE, - CODEC_ID_DXTORY, - CODEC_ID_V410, - CODEC_ID_XWD, - CODEC_ID_CDXL, - CODEC_ID_XBM, - CODEC_ID_ZEROCODEC, - CODEC_ID_MSS1, - CODEC_ID_MSA1, - CODEC_ID_TSCC2, - CODEC_ID_MTS2, - CODEC_ID_CLLC, - CODEC_ID_Y41P = MKBETAG('Y','4','1','P'), - CODEC_ID_ESCAPE130 = MKBETAG('E','1','3','0'), - CODEC_ID_EXR = MKBETAG('0','E','X','R'), - CODEC_ID_AVRP = MKBETAG('A','V','R','P'), - - CODEC_ID_G2M = MKBETAG( 0 ,'G','2','M'), - CODEC_ID_AVUI = MKBETAG('A','V','U','I'), - CODEC_ID_AYUV = MKBETAG('A','Y','U','V'), - CODEC_ID_V308 = MKBETAG('V','3','0','8'), - CODEC_ID_V408 = MKBETAG('V','4','0','8'), - CODEC_ID_YUV4 = MKBETAG('Y','U','V','4'), - CODEC_ID_SANM = MKBETAG('S','A','N','M'), - CODEC_ID_PAF_VIDEO = MKBETAG('P','A','F','V'), - CODEC_ID_SNOW = AV_CODEC_ID_SNOW, - - /* various PCM "codecs" */ - CODEC_ID_FIRST_AUDIO = 0x10000, ///< A dummy id pointing at the start of audio codecs - CODEC_ID_PCM_S16LE = 0x10000, - CODEC_ID_PCM_S16BE, - CODEC_ID_PCM_U16LE, - CODEC_ID_PCM_U16BE, - CODEC_ID_PCM_S8, - CODEC_ID_PCM_U8, - CODEC_ID_PCM_MULAW, - CODEC_ID_PCM_ALAW, - CODEC_ID_PCM_S32LE, - CODEC_ID_PCM_S32BE, - CODEC_ID_PCM_U32LE, - CODEC_ID_PCM_U32BE, - CODEC_ID_PCM_S24LE, - CODEC_ID_PCM_S24BE, - CODEC_ID_PCM_U24LE, - CODEC_ID_PCM_U24BE, - CODEC_ID_PCM_S24DAUD, - CODEC_ID_PCM_ZORK, - CODEC_ID_PCM_S16LE_PLANAR, - CODEC_ID_PCM_DVD, - CODEC_ID_PCM_F32BE, - CODEC_ID_PCM_F32LE, - CODEC_ID_PCM_F64BE, - CODEC_ID_PCM_F64LE, - CODEC_ID_PCM_BLURAY, - CODEC_ID_PCM_LXF, - CODEC_ID_S302M, - CODEC_ID_PCM_S8_PLANAR, - - /* various ADPCM codecs */ - CODEC_ID_ADPCM_IMA_QT = 0x11000, - CODEC_ID_ADPCM_IMA_WAV, - CODEC_ID_ADPCM_IMA_DK3, - CODEC_ID_ADPCM_IMA_DK4, - CODEC_ID_ADPCM_IMA_WS, - CODEC_ID_ADPCM_IMA_SMJPEG, - CODEC_ID_ADPCM_MS, - CODEC_ID_ADPCM_4XM, - CODEC_ID_ADPCM_XA, - CODEC_ID_ADPCM_ADX, - CODEC_ID_ADPCM_EA, - CODEC_ID_ADPCM_G726, - CODEC_ID_ADPCM_CT, - CODEC_ID_ADPCM_SWF, - CODEC_ID_ADPCM_YAMAHA, - CODEC_ID_ADPCM_SBPRO_4, - CODEC_ID_ADPCM_SBPRO_3, - CODEC_ID_ADPCM_SBPRO_2, - CODEC_ID_ADPCM_THP, - CODEC_ID_ADPCM_IMA_AMV, - CODEC_ID_ADPCM_EA_R1, - CODEC_ID_ADPCM_EA_R3, - CODEC_ID_ADPCM_EA_R2, - CODEC_ID_ADPCM_IMA_EA_SEAD, - CODEC_ID_ADPCM_IMA_EA_EACS, - CODEC_ID_ADPCM_EA_XAS, - CODEC_ID_ADPCM_EA_MAXIS_XA, - CODEC_ID_ADPCM_IMA_ISS, - CODEC_ID_ADPCM_G722, - CODEC_ID_ADPCM_IMA_APC, - CODEC_ID_VIMA = MKBETAG('V','I','M','A'), - - /* AMR */ - CODEC_ID_AMR_NB = 0x12000, - CODEC_ID_AMR_WB, - - /* RealAudio codecs*/ - CODEC_ID_RA_144 = 0x13000, - CODEC_ID_RA_288, - - /* various DPCM codecs */ - CODEC_ID_ROQ_DPCM = 0x14000, - CODEC_ID_INTERPLAY_DPCM, - CODEC_ID_XAN_DPCM, - CODEC_ID_SOL_DPCM, - - /* audio codecs */ - CODEC_ID_MP2 = 0x15000, - CODEC_ID_MP3, ///< preferred ID for decoding MPEG audio layer 1, 2 or 3 - CODEC_ID_AAC, - CODEC_ID_AC3, - CODEC_ID_DTS, - CODEC_ID_VORBIS, - CODEC_ID_DVAUDIO, - CODEC_ID_WMAV1, - CODEC_ID_WMAV2, - CODEC_ID_MACE3, - CODEC_ID_MACE6, - CODEC_ID_VMDAUDIO, - CODEC_ID_FLAC, - CODEC_ID_MP3ADU, - CODEC_ID_MP3ON4, - CODEC_ID_SHORTEN, - CODEC_ID_ALAC, - CODEC_ID_WESTWOOD_SND1, - CODEC_ID_GSM, ///< as in Berlin toast format - CODEC_ID_QDM2, - CODEC_ID_COOK, - CODEC_ID_TRUESPEECH, - CODEC_ID_TTA, - CODEC_ID_SMACKAUDIO, - CODEC_ID_QCELP, - CODEC_ID_WAVPACK, - CODEC_ID_DSICINAUDIO, - CODEC_ID_IMC, - CODEC_ID_MUSEPACK7, - CODEC_ID_MLP, - CODEC_ID_GSM_MS, /* as found in WAV */ - CODEC_ID_ATRAC3, - CODEC_ID_VOXWARE, - CODEC_ID_APE, - CODEC_ID_NELLYMOSER, - CODEC_ID_MUSEPACK8, - CODEC_ID_SPEEX, - CODEC_ID_WMAVOICE, - CODEC_ID_WMAPRO, - CODEC_ID_WMALOSSLESS, - CODEC_ID_ATRAC3P, - CODEC_ID_EAC3, - CODEC_ID_SIPR, - CODEC_ID_MP1, - CODEC_ID_TWINVQ, - CODEC_ID_TRUEHD, - CODEC_ID_MP4ALS, - CODEC_ID_ATRAC1, - CODEC_ID_BINKAUDIO_RDFT, - CODEC_ID_BINKAUDIO_DCT, - CODEC_ID_AAC_LATM, - CODEC_ID_QDMC, - CODEC_ID_CELT, - CODEC_ID_G723_1, - CODEC_ID_G729, - CODEC_ID_8SVX_EXP, - CODEC_ID_8SVX_FIB, - CODEC_ID_BMV_AUDIO, - CODEC_ID_RALF, - CODEC_ID_IAC, - CODEC_ID_ILBC, - CODEC_ID_FFWAVESYNTH = MKBETAG('F','F','W','S'), - CODEC_ID_SONIC = MKBETAG('S','O','N','C'), - CODEC_ID_SONIC_LS = MKBETAG('S','O','N','L'), - CODEC_ID_PAF_AUDIO = MKBETAG('P','A','F','A'), - CODEC_ID_OPUS = MKBETAG('O','P','U','S'), - - /* subtitle codecs */ - CODEC_ID_FIRST_SUBTITLE = 0x17000, ///< A dummy ID pointing at the start of subtitle codecs. - CODEC_ID_DVD_SUBTITLE = 0x17000, - CODEC_ID_DVB_SUBTITLE, - CODEC_ID_TEXT, ///< raw UTF-8 text - CODEC_ID_XSUB, - CODEC_ID_SSA, - CODEC_ID_MOV_TEXT, - CODEC_ID_HDMV_PGS_SUBTITLE, - CODEC_ID_DVB_TELETEXT, - CODEC_ID_SRT, - CODEC_ID_MICRODVD = MKBETAG('m','D','V','D'), - CODEC_ID_EIA_608 = MKBETAG('c','6','0','8'), - CODEC_ID_JACOSUB = MKBETAG('J','S','U','B'), - CODEC_ID_SAMI = MKBETAG('S','A','M','I'), - CODEC_ID_REALTEXT = MKBETAG('R','T','X','T'), - CODEC_ID_SUBVIEWER = MKBETAG('S','u','b','V'), - - /* other specific kind of codecs (generally used for attachments) */ - CODEC_ID_FIRST_UNKNOWN = 0x18000, ///< A dummy ID pointing at the start of various fake codecs. - CODEC_ID_TTF = 0x18000, - CODEC_ID_BINTEXT = MKBETAG('B','T','X','T'), - CODEC_ID_XBIN = MKBETAG('X','B','I','N'), - CODEC_ID_IDF = MKBETAG( 0 ,'I','D','F'), - CODEC_ID_OTF = MKBETAG( 0 ,'O','T','F'), - - CODEC_ID_PROBE = 0x19000, ///< codec_id is not known (like CODEC_ID_NONE) but lavf should attempt to identify it - - CODEC_ID_MPEG2TS = 0x20000, /**< _FAKE_ codec to indicate a raw MPEG-2 TS - * stream (only used by libavformat) */ - CODEC_ID_MPEG4SYSTEMS = 0x20001, /**< _FAKE_ codec to indicate a MPEG-4 Systems - * stream (only used by libavformat) */ - CODEC_ID_FFMETADATA = 0x21000, ///< Dummy codec for streams containing only metadata information. - -#endif /* AVCODEC_OLD_CODEC_IDS_H */ diff --git a/dji_sdk_manifold_read_cam/include/libavcodec/vaapi.h b/dji_sdk_manifold_read_cam/include/libavcodec/vaapi.h deleted file mode 100644 index 815a27e..0000000 --- a/dji_sdk_manifold_read_cam/include/libavcodec/vaapi.h +++ /dev/null @@ -1,173 +0,0 @@ -/* - * Video Acceleration API (shared data between FFmpeg and the video player) - * HW decode acceleration for MPEG-2, MPEG-4, H.264 and VC-1 - * - * Copyright (C) 2008-2009 Splitted-Desktop Systems - * - * This file is part of FFmpeg. - * - * FFmpeg is free software; you can redistribute it and/or - * modify it under the terms of the GNU Lesser General Public - * License as published by the Free Software Foundation; either - * version 2.1 of the License, or (at your option) any later version. - * - * FFmpeg is distributed in the hope that it will be useful, - * but WITHOUT ANY WARRANTY; without even the implied warranty of - * MERCHANTABILITY or FITNESS FOR A PARTICULAR PURPOSE. See the GNU - * Lesser General Public License for more details. - * - * You should have received a copy of the GNU Lesser General Public - * License along with FFmpeg; if not, write to the Free Software - * Foundation, Inc., 51 Franklin Street, Fifth Floor, Boston, MA 02110-1301 USA - */ - -#ifndef AVCODEC_VAAPI_H -#define AVCODEC_VAAPI_H - -/** - * @file - * @ingroup lavc_codec_hwaccel_vaapi - * Public libavcodec VA API header. - */ - -#include - -/** - * @defgroup lavc_codec_hwaccel_vaapi VA API Decoding - * @ingroup lavc_codec_hwaccel - * @{ - */ - -/** - * This structure is used to share data between the FFmpeg library and - * the client video application. - * This shall be zero-allocated and available as - * AVCodecContext.hwaccel_context. All user members can be set once - * during initialization or through each AVCodecContext.get_buffer() - * function call. In any case, they must be valid prior to calling - * decoding functions. - */ -struct vaapi_context { - /** - * Window system dependent data - * - * - encoding: unused - * - decoding: Set by user - */ - void *display; - - /** - * Configuration ID - * - * - encoding: unused - * - decoding: Set by user - */ - uint32_t config_id; - - /** - * Context ID (video decode pipeline) - * - * - encoding: unused - * - decoding: Set by user - */ - uint32_t context_id; - - /** - * VAPictureParameterBuffer ID - * - * - encoding: unused - * - decoding: Set by libavcodec - */ - uint32_t pic_param_buf_id; - - /** - * VAIQMatrixBuffer ID - * - * - encoding: unused - * - decoding: Set by libavcodec - */ - uint32_t iq_matrix_buf_id; - - /** - * VABitPlaneBuffer ID (for VC-1 decoding) - * - * - encoding: unused - * - decoding: Set by libavcodec - */ - uint32_t bitplane_buf_id; - - /** - * Slice parameter/data buffer IDs - * - * - encoding: unused - * - decoding: Set by libavcodec - */ - uint32_t *slice_buf_ids; - - /** - * Number of effective slice buffer IDs to send to the HW - * - * - encoding: unused - * - decoding: Set by libavcodec - */ - unsigned int n_slice_buf_ids; - - /** - * Size of pre-allocated slice_buf_ids - * - * - encoding: unused - * - decoding: Set by libavcodec - */ - unsigned int slice_buf_ids_alloc; - - /** - * Pointer to VASliceParameterBuffers - * - * - encoding: unused - * - decoding: Set by libavcodec - */ - void *slice_params; - - /** - * Size of a VASliceParameterBuffer element - * - * - encoding: unused - * - decoding: Set by libavcodec - */ - unsigned int slice_param_size; - - /** - * Size of pre-allocated slice_params - * - * - encoding: unused - * - decoding: Set by libavcodec - */ - unsigned int slice_params_alloc; - - /** - * Number of slices currently filled in - * - * - encoding: unused - * - decoding: Set by libavcodec - */ - unsigned int slice_count; - - /** - * Pointer to slice data buffer base - * - encoding: unused - * - decoding: Set by libavcodec - */ - const uint8_t *slice_data; - - /** - * Current size of slice data - * - * - encoding: unused - * - decoding: Set by libavcodec - */ - uint32_t slice_data_size; -}; - -/* @} */ - -#endif /* AVCODEC_VAAPI_H */ diff --git a/dji_sdk_manifold_read_cam/include/libavcodec/vda.h b/dji_sdk_manifold_read_cam/include/libavcodec/vda.h deleted file mode 100644 index 2f68188..0000000 --- a/dji_sdk_manifold_read_cam/include/libavcodec/vda.h +++ /dev/null @@ -1,168 +0,0 @@ -/* - * VDA HW acceleration - * - * copyright (c) 2011 Sebastien Zwickert - * - * This file is part of FFmpeg. - * - * FFmpeg is free software; you can redistribute it and/or - * modify it under the terms of the GNU Lesser General Public - * License as published by the Free Software Foundation; either - * version 2.1 of the License, or (at your option) any later version. - * - * FFmpeg is distributed in the hope that it will be useful, - * but WITHOUT ANY WARRANTY; without even the implied warranty of - * MERCHANTABILITY or FITNESS FOR A PARTICULAR PURPOSE. See the GNU - * Lesser General Public License for more details. - * - * You should have received a copy of the GNU Lesser General Public - * License along with FFmpeg; if not, write to the Free Software - * Foundation, Inc., 51 Franklin Street, Fifth Floor, Boston, MA 02110-1301 USA - */ - -#ifndef AVCODEC_VDA_H -#define AVCODEC_VDA_H - -/** - * @file - * @ingroup lavc_codec_hwaccel_vda - * Public libavcodec VDA header. - */ - -#include - -// emmintrin.h is unable to compile with -std=c99 -Werror=missing-prototypes -// http://openradar.appspot.com/8026390 -#undef __GNUC_STDC_INLINE__ - -#define Picture QuickdrawPicture -#include -#undef Picture - -#include "libavcodec/version.h" - -// extra flags not defined in VDADecoder.h -enum { - kVDADecodeInfo_Asynchronous = 1UL << 0, - kVDADecodeInfo_FrameDropped = 1UL << 1 -}; - -/** - * @defgroup lavc_codec_hwaccel_vda VDA - * @ingroup lavc_codec_hwaccel - * - * @{ - */ - -/** - * This structure is used to provide the necessary configurations and data - * to the VDA FFmpeg HWAccel implementation. - * - * The application must make it available as AVCodecContext.hwaccel_context. - */ -struct vda_context { - /** - * VDA decoder object. - * - * - encoding: unused - * - decoding: Set/Unset by libavcodec. - */ - VDADecoder decoder; - - /** - * The Core Video pixel buffer that contains the current image data. - * - * encoding: unused - * decoding: Set by libavcodec. Unset by user. - */ - CVPixelBufferRef cv_buffer; - - /** - * Use the hardware decoder in synchronous mode. - * - * encoding: unused - * decoding: Set by user. - */ - int use_sync_decoding; - - /** - * The frame width. - * - * - encoding: unused - * - decoding: Set/Unset by user. - */ - int width; - - /** - * The frame height. - * - * - encoding: unused - * - decoding: Set/Unset by user. - */ - int height; - - /** - * The frame format. - * - * - encoding: unused - * - decoding: Set/Unset by user. - */ - int format; - - /** - * The pixel format for output image buffers. - * - * - encoding: unused - * - decoding: Set/Unset by user. - */ - OSType cv_pix_fmt_type; - - /** - * The current bitstream buffer. - * - * - encoding: unused - * - decoding: Set/Unset by libavcodec. - */ - uint8_t *priv_bitstream; - - /** - * The current size of the bitstream. - * - * - encoding: unused - * - decoding: Set/Unset by libavcodec. - */ - int priv_bitstream_size; - - /** - * The reference size used for fast reallocation. - * - * - encoding: unused - * - decoding: Set/Unset by libavcodec. - */ - int priv_allocated_size; - - /** - * Use av_buffer to manage buffer. - * When the flag is set, the CVPixelBuffers returned by the decoder will - * be released automatically, so you have to retain them if necessary. - * Not setting this flag may cause memory leak. - * - * encoding: unused - * decoding: Set by user. - */ - int use_ref_buffer; -}; - -/** Create the video decoder. */ -int ff_vda_create_decoder(struct vda_context *vda_ctx, - uint8_t *extradata, - int extradata_size); - -/** Destroy the video decoder. */ -int ff_vda_destroy_decoder(struct vda_context *vda_ctx); - -/** - * @} - */ - -#endif /* AVCODEC_VDA_H */ diff --git a/dji_sdk_manifold_read_cam/include/libavcodec/vdpau.h b/dji_sdk_manifold_read_cam/include/libavcodec/vdpau.h deleted file mode 100644 index e25cc42..0000000 --- a/dji_sdk_manifold_read_cam/include/libavcodec/vdpau.h +++ /dev/null @@ -1,215 +0,0 @@ -/* - * The Video Decode and Presentation API for UNIX (VDPAU) is used for - * hardware-accelerated decoding of MPEG-1/2, H.264 and VC-1. - * - * Copyright (C) 2008 NVIDIA - * - * This file is part of FFmpeg. - * - * FFmpeg is free software; you can redistribute it and/or - * modify it under the terms of the GNU Lesser General Public - * License as published by the Free Software Foundation; either - * version 2.1 of the License, or (at your option) any later version. - * - * FFmpeg is distributed in the hope that it will be useful, - * but WITHOUT ANY WARRANTY; without even the implied warranty of - * MERCHANTABILITY or FITNESS FOR A PARTICULAR PURPOSE. See the GNU - * Lesser General Public License for more details. - * - * You should have received a copy of the GNU Lesser General Public - * License along with FFmpeg; if not, write to the Free Software - * Foundation, Inc., 51 Franklin Street, Fifth Floor, Boston, MA 02110-1301 USA - */ - -#ifndef AVCODEC_VDPAU_H -#define AVCODEC_VDPAU_H - -/** - * @file - * @ingroup lavc_codec_hwaccel_vdpau - * Public libavcodec VDPAU header. - */ - - -/** - * @defgroup lavc_codec_hwaccel_vdpau VDPAU Decoder and Renderer - * @ingroup lavc_codec_hwaccel - * - * VDPAU hardware acceleration has two modules - * - VDPAU decoding - * - VDPAU presentation - * - * The VDPAU decoding module parses all headers using FFmpeg - * parsing mechanisms and uses VDPAU for the actual decoding. - * - * As per the current implementation, the actual decoding - * and rendering (API calls) are done as part of the VDPAU - * presentation (vo_vdpau.c) module. - * - * @{ - */ - -#include -#include -#include "libavutil/avconfig.h" -#include "libavutil/attributes.h" - -#include "avcodec.h" -#include "version.h" - -#if FF_API_BUFS_VDPAU -union AVVDPAUPictureInfo { - VdpPictureInfoH264 h264; - VdpPictureInfoMPEG1Or2 mpeg; - VdpPictureInfoVC1 vc1; - VdpPictureInfoMPEG4Part2 mpeg4; -}; -#endif - -struct AVCodecContext; -struct AVFrame; - -typedef int (*AVVDPAU_Render2)(struct AVCodecContext *, struct AVFrame *, - const VdpPictureInfo *, uint32_t, - const VdpBitstreamBuffer *); - -/** - * This structure is used to share data between the libavcodec library and - * the client video application. - * The user shall allocate the structure via the av_alloc_vdpau_hwaccel - * function and make it available as - * AVCodecContext.hwaccel_context. Members can be set by the user once - * during initialization or through each AVCodecContext.get_buffer() - * function call. In any case, they must be valid prior to calling - * decoding functions. - * - * The size of this structure is not a part of the public ABI and must not - * be used outside of libavcodec. Use av_vdpau_alloc_context() to allocate an - * AVVDPAUContext. - */ -typedef struct AVVDPAUContext { - /** - * VDPAU decoder handle - * - * Set by user. - */ - VdpDecoder decoder; - - /** - * VDPAU decoder render callback - * - * Set by the user. - */ - VdpDecoderRender *render; - -#if FF_API_BUFS_VDPAU - /** - * VDPAU picture information - * - * Set by libavcodec. - */ - attribute_deprecated - union AVVDPAUPictureInfo info; - - /** - * Allocated size of the bitstream_buffers table. - * - * Set by libavcodec. - */ - attribute_deprecated - int bitstream_buffers_allocated; - - /** - * Useful bitstream buffers in the bitstream buffers table. - * - * Set by libavcodec. - */ - attribute_deprecated - int bitstream_buffers_used; - - /** - * Table of bitstream buffers. - * The user is responsible for freeing this buffer using av_freep(). - * - * Set by libavcodec. - */ - attribute_deprecated - VdpBitstreamBuffer *bitstream_buffers; -#endif - AVVDPAU_Render2 render2; -} AVVDPAUContext; - -/** - * @brief allocation function for AVVDPAUContext - * - * Allows extending the struct without breaking API/ABI - */ -AVVDPAUContext *av_alloc_vdpaucontext(void); - -AVVDPAU_Render2 av_vdpau_hwaccel_get_render2(const AVVDPAUContext *); -void av_vdpau_hwaccel_set_render2(AVVDPAUContext *, AVVDPAU_Render2); - -/** - * Allocate an AVVDPAUContext. - * - * @return Newly-allocated AVVDPAUContext or NULL on failure. - */ -AVVDPAUContext *av_vdpau_alloc_context(void); - -/** - * Get a decoder profile that should be used for initializing a VDPAU decoder. - * Should be called from the AVCodecContext.get_format() callback. - * - * @param avctx the codec context being used for decoding the stream - * @param profile a pointer into which the result will be written on success. - * The contents of profile are undefined if this function returns - * an error. - * - * @return 0 on success (non-negative), a negative AVERROR on failure. - */ -int av_vdpau_get_profile(AVCodecContext *avctx, VdpDecoderProfile *profile); - -#if FF_API_CAP_VDPAU -/** @brief The videoSurface is used for rendering. */ -#define FF_VDPAU_STATE_USED_FOR_RENDER 1 - -/** - * @brief The videoSurface is needed for reference/prediction. - * The codec manipulates this. - */ -#define FF_VDPAU_STATE_USED_FOR_REFERENCE 2 - -/** - * @brief This structure is used as a callback between the FFmpeg - * decoder (vd_) and presentation (vo_) module. - * This is used for defining a video frame containing surface, - * picture parameter, bitstream information etc which are passed - * between the FFmpeg decoder and its clients. - */ -struct vdpau_render_state { - VdpVideoSurface surface; ///< Used as rendered surface, never changed. - - int state; ///< Holds FF_VDPAU_STATE_* values. - -#if AV_HAVE_INCOMPATIBLE_LIBAV_ABI - /** picture parameter information for all supported codecs */ - union AVVDPAUPictureInfo info; -#endif - - /** Describe size/location of the compressed video data. - Set to 0 when freeing bitstream_buffers. */ - int bitstream_buffers_allocated; - int bitstream_buffers_used; - /** The user is responsible for freeing this buffer using av_freep(). */ - VdpBitstreamBuffer *bitstream_buffers; - -#if !AV_HAVE_INCOMPATIBLE_LIBAV_ABI - /** picture parameter information for all supported codecs */ - union AVVDPAUPictureInfo info; -#endif -}; -#endif - -/* @}*/ - -#endif /* AVCODEC_VDPAU_H */ diff --git a/dji_sdk_manifold_read_cam/include/libavcodec/version.h b/dji_sdk_manifold_read_cam/include/libavcodec/version.h deleted file mode 100644 index 5294d8e..0000000 --- a/dji_sdk_manifold_read_cam/include/libavcodec/version.h +++ /dev/null @@ -1,166 +0,0 @@ -/* - * - * This file is part of FFmpeg. - * - * FFmpeg is free software; you can redistribute it and/or - * modify it under the terms of the GNU Lesser General Public - * License as published by the Free Software Foundation; either - * version 2.1 of the License, or (at your option) any later version. - * - * FFmpeg is distributed in the hope that it will be useful, - * but WITHOUT ANY WARRANTY; without even the implied warranty of - * MERCHANTABILITY or FITNESS FOR A PARTICULAR PURPOSE. See the GNU - * Lesser General Public License for more details. - * - * You should have received a copy of the GNU Lesser General Public - * License along with FFmpeg; if not, write to the Free Software - * Foundation, Inc., 51 Franklin Street, Fifth Floor, Boston, MA 02110-1301 USA - */ - -#ifndef AVCODEC_VERSION_H -#define AVCODEC_VERSION_H - -/** - * @file - * @ingroup libavc - * Libavcodec version macros. - */ - -#include "libavutil/version.h" - -#define LIBAVCODEC_VERSION_MAJOR 55 -#define LIBAVCODEC_VERSION_MINOR 60 -#define LIBAVCODEC_VERSION_MICRO 103 - -#define LIBAVCODEC_VERSION_INT AV_VERSION_INT(LIBAVCODEC_VERSION_MAJOR, \ - LIBAVCODEC_VERSION_MINOR, \ - LIBAVCODEC_VERSION_MICRO) -#define LIBAVCODEC_VERSION AV_VERSION(LIBAVCODEC_VERSION_MAJOR, \ - LIBAVCODEC_VERSION_MINOR, \ - LIBAVCODEC_VERSION_MICRO) -#define LIBAVCODEC_BUILD LIBAVCODEC_VERSION_INT - -#define LIBAVCODEC_IDENT "Lavc" AV_STRINGIFY(LIBAVCODEC_VERSION) - -/** - * FF_API_* defines may be placed below to indicate public API that will be - * dropped at a future version bump. The defines themselves are not part of - * the public API and may change, break or disappear at any time. - */ - -#ifndef FF_API_REQUEST_CHANNELS -#define FF_API_REQUEST_CHANNELS (LIBAVCODEC_VERSION_MAJOR < 56) -#endif -#ifndef FF_API_OLD_DECODE_AUDIO -#define FF_API_OLD_DECODE_AUDIO (LIBAVCODEC_VERSION_MAJOR < 56) -#endif -#ifndef FF_API_OLD_ENCODE_AUDIO -#define FF_API_OLD_ENCODE_AUDIO (LIBAVCODEC_VERSION_MAJOR < 56) -#endif -#ifndef FF_API_OLD_ENCODE_VIDEO -#define FF_API_OLD_ENCODE_VIDEO (LIBAVCODEC_VERSION_MAJOR < 56) -#endif -#ifndef FF_API_CODEC_ID -#define FF_API_CODEC_ID (LIBAVCODEC_VERSION_MAJOR < 56) -#endif -#ifndef FF_API_AUDIO_CONVERT -#define FF_API_AUDIO_CONVERT (LIBAVCODEC_VERSION_MAJOR < 56) -#endif -#ifndef FF_API_AVCODEC_RESAMPLE -#define FF_API_AVCODEC_RESAMPLE FF_API_AUDIO_CONVERT -#endif -#ifndef FF_API_DEINTERLACE -#define FF_API_DEINTERLACE (LIBAVCODEC_VERSION_MAJOR < 56) -#endif -#ifndef FF_API_DESTRUCT_PACKET -#define FF_API_DESTRUCT_PACKET (LIBAVCODEC_VERSION_MAJOR < 56) -#endif -#ifndef FF_API_GET_BUFFER -#define FF_API_GET_BUFFER (LIBAVCODEC_VERSION_MAJOR < 56) -#endif -#ifndef FF_API_MISSING_SAMPLE -#define FF_API_MISSING_SAMPLE (LIBAVCODEC_VERSION_MAJOR < 56) -#endif -#ifndef FF_API_LOWRES -#define FF_API_LOWRES (LIBAVCODEC_VERSION_MAJOR < 56) -#endif -#ifndef FF_API_CAP_VDPAU -#define FF_API_CAP_VDPAU (LIBAVCODEC_VERSION_MAJOR < 56) -#endif -#ifndef FF_API_BUFS_VDPAU -#define FF_API_BUFS_VDPAU (LIBAVCODEC_VERSION_MAJOR < 56) -#endif -#ifndef FF_API_VOXWARE -#define FF_API_VOXWARE (LIBAVCODEC_VERSION_MAJOR < 56) -#endif -#ifndef FF_API_SET_DIMENSIONS -#define FF_API_SET_DIMENSIONS (LIBAVCODEC_VERSION_MAJOR < 56) -#endif -#ifndef FF_API_DEBUG_MV -#define FF_API_DEBUG_MV (LIBAVCODEC_VERSION_MAJOR < 56) -#endif -#ifndef FF_API_AC_VLC -#define FF_API_AC_VLC (LIBAVCODEC_VERSION_MAJOR < 56) -#endif -#ifndef FF_API_OLD_MSMPEG4 -#define FF_API_OLD_MSMPEG4 (LIBAVCODEC_VERSION_MAJOR < 56) -#endif -#ifndef FF_API_ASPECT_EXTENDED -#define FF_API_ASPECT_EXTENDED (LIBAVCODEC_VERSION_MAJOR < 56) -#endif -#ifndef FF_API_THREAD_OPAQUE -#define FF_API_THREAD_OPAQUE (LIBAVCODEC_VERSION_MAJOR < 56) -#endif -#ifndef FF_API_CODEC_PKT -#define FF_API_CODEC_PKT (LIBAVCODEC_VERSION_MAJOR < 56) -#endif -#ifndef FF_API_ARCH_ALPHA -#define FF_API_ARCH_ALPHA (LIBAVCODEC_VERSION_MAJOR < 56) -#endif -#ifndef FF_API_XVMC -#define FF_API_XVMC (LIBAVCODEC_VERSION_MAJOR < 56) -#endif -#ifndef FF_API_ERROR_RATE -#define FF_API_ERROR_RATE (LIBAVCODEC_VERSION_MAJOR < 56) -#endif -#ifndef FF_API_QSCALE_TYPE -#define FF_API_QSCALE_TYPE (LIBAVCODEC_VERSION_MAJOR < 56) -#endif -#ifndef FF_API_MB_TYPE -#define FF_API_MB_TYPE (LIBAVCODEC_VERSION_MAJOR < 56) -#endif -#ifndef FF_API_MAX_BFRAMES -#define FF_API_MAX_BFRAMES (LIBAVCODEC_VERSION_MAJOR < 56) -#endif -#ifndef FF_API_FAST_MALLOC -#define FF_API_FAST_MALLOC (LIBAVCODEC_VERSION_MAJOR < 56) -#endif -#ifndef FF_API_NEG_LINESIZES -#define FF_API_NEG_LINESIZES (LIBAVCODEC_VERSION_MAJOR < 56) -#endif -#ifndef FF_API_EMU_EDGE -#define FF_API_EMU_EDGE (LIBAVCODEC_VERSION_MAJOR < 56) -#endif -#ifndef FF_API_ARCH_SH4 -#define FF_API_ARCH_SH4 (LIBAVCODEC_VERSION_MAJOR < 56) -#endif -#ifndef FF_API_ARCH_SPARC -#define FF_API_ARCH_SPARC (LIBAVCODEC_VERSION_MAJOR < 56) -#endif -#ifndef FF_API_INPUT_PRESERVED -#define FF_API_INPUT_PRESERVED (LIBAVCODEC_VERSION_MAJOR < 57) -#endif -#ifndef FF_API_NORMALIZE_AQP -#define FF_API_NORMALIZE_AQP (LIBAVCODEC_VERSION_MAJOR < 57) -#endif -#ifndef FF_API_GMC -#define FF_API_GMC (LIBAVCODEC_VERSION_MAJOR < 57) -#endif -#ifndef FF_API_MV0 -#define FF_API_MV0 (LIBAVCODEC_VERSION_MAJOR < 57) -#endif -#ifndef FF_API_CODEC_NAME -#define FF_API_CODEC_NAME (LIBAVCODEC_VERSION_MAJOR < 57) -#endif - -#endif /* AVCODEC_VERSION_H */ diff --git a/dji_sdk_manifold_read_cam/include/libavcodec/xvmc.h b/dji_sdk_manifold_read_cam/include/libavcodec/xvmc.h deleted file mode 100644 index c2e187c..0000000 --- a/dji_sdk_manifold_read_cam/include/libavcodec/xvmc.h +++ /dev/null @@ -1,170 +0,0 @@ -/* - * Copyright (C) 2003 Ivan Kalvachev - * - * This file is part of FFmpeg. - * - * FFmpeg is free software; you can redistribute it and/or - * modify it under the terms of the GNU Lesser General Public - * License as published by the Free Software Foundation; either - * version 2.1 of the License, or (at your option) any later version. - * - * FFmpeg is distributed in the hope that it will be useful, - * but WITHOUT ANY WARRANTY; without even the implied warranty of - * MERCHANTABILITY or FITNESS FOR A PARTICULAR PURPOSE. See the GNU - * Lesser General Public License for more details. - * - * You should have received a copy of the GNU Lesser General Public - * License along with FFmpeg; if not, write to the Free Software - * Foundation, Inc., 51 Franklin Street, Fifth Floor, Boston, MA 02110-1301 USA - */ - -#ifndef AVCODEC_XVMC_H -#define AVCODEC_XVMC_H - -/** - * @file - * @ingroup lavc_codec_hwaccel_xvmc - * Public libavcodec XvMC header. - */ - -#include - -#include "libavutil/attributes.h" -#include "version.h" -#include "avcodec.h" - -/** - * @defgroup lavc_codec_hwaccel_xvmc XvMC - * @ingroup lavc_codec_hwaccel - * - * @{ - */ - -#define AV_XVMC_ID 0x1DC711C0 /**< special value to ensure that regular pixel routines haven't corrupted the struct - the number is 1337 speak for the letters IDCT MCo (motion compensation) */ - -attribute_deprecated struct xvmc_pix_fmt { - /** The field contains the special constant value AV_XVMC_ID. - It is used as a test that the application correctly uses the API, - and that there is no corruption caused by pixel routines. - - application - set during initialization - - libavcodec - unchanged - */ - int xvmc_id; - - /** Pointer to the block array allocated by XvMCCreateBlocks(). - The array has to be freed by XvMCDestroyBlocks(). - Each group of 64 values represents one data block of differential - pixel information (in MoCo mode) or coefficients for IDCT. - - application - set the pointer during initialization - - libavcodec - fills coefficients/pixel data into the array - */ - short* data_blocks; - - /** Pointer to the macroblock description array allocated by - XvMCCreateMacroBlocks() and freed by XvMCDestroyMacroBlocks(). - - application - set the pointer during initialization - - libavcodec - fills description data into the array - */ - XvMCMacroBlock* mv_blocks; - - /** Number of macroblock descriptions that can be stored in the mv_blocks - array. - - application - set during initialization - - libavcodec - unchanged - */ - int allocated_mv_blocks; - - /** Number of blocks that can be stored at once in the data_blocks array. - - application - set during initialization - - libavcodec - unchanged - */ - int allocated_data_blocks; - - /** Indicate that the hardware would interpret data_blocks as IDCT - coefficients and perform IDCT on them. - - application - set during initialization - - libavcodec - unchanged - */ - int idct; - - /** In MoCo mode it indicates that intra macroblocks are assumed to be in - unsigned format; same as the XVMC_INTRA_UNSIGNED flag. - - application - set during initialization - - libavcodec - unchanged - */ - int unsigned_intra; - - /** Pointer to the surface allocated by XvMCCreateSurface(). - It has to be freed by XvMCDestroySurface() on application exit. - It identifies the frame and its state on the video hardware. - - application - set during initialization - - libavcodec - unchanged - */ - XvMCSurface* p_surface; - -/** Set by the decoder before calling ff_draw_horiz_band(), - needed by the XvMCRenderSurface function. */ -//@{ - /** Pointer to the surface used as past reference - - application - unchanged - - libavcodec - set - */ - XvMCSurface* p_past_surface; - - /** Pointer to the surface used as future reference - - application - unchanged - - libavcodec - set - */ - XvMCSurface* p_future_surface; - - /** top/bottom field or frame - - application - unchanged - - libavcodec - set - */ - unsigned int picture_structure; - - /** XVMC_SECOND_FIELD - 1st or 2nd field in the sequence - - application - unchanged - - libavcodec - set - */ - unsigned int flags; -//}@ - - /** Number of macroblock descriptions in the mv_blocks array - that have already been passed to the hardware. - - application - zeroes it on get_buffer(). - A successful ff_draw_horiz_band() may increment it - with filled_mb_block_num or zero both. - - libavcodec - unchanged - */ - int start_mv_blocks_num; - - /** Number of new macroblock descriptions in the mv_blocks array (after - start_mv_blocks_num) that are filled by libavcodec and have to be - passed to the hardware. - - application - zeroes it on get_buffer() or after successful - ff_draw_horiz_band(). - - libavcodec - increment with one of each stored MB - */ - int filled_mv_blocks_num; - - /** Number of the next free data block; one data block consists of - 64 short values in the data_blocks array. - All blocks before this one have already been claimed by placing their - position into the corresponding block description structure field, - that are part of the mv_blocks array. - - application - zeroes it on get_buffer(). - A successful ff_draw_horiz_band() may zero it together - with start_mb_blocks_num. - - libavcodec - each decoded macroblock increases it by the number - of coded blocks it contains. - */ - int next_free_data_block_num; -}; - -/** - * @} - */ - -#endif /* AVCODEC_XVMC_H */ diff --git a/dji_sdk_manifold_read_cam/include/libavdevice/avdevice.h b/dji_sdk_manifold_read_cam/include/libavdevice/avdevice.h deleted file mode 100644 index a395228..0000000 --- a/dji_sdk_manifold_read_cam/include/libavdevice/avdevice.h +++ /dev/null @@ -1,487 +0,0 @@ -/* - * This file is part of FFmpeg. - * - * FFmpeg is free software; you can redistribute it and/or - * modify it under the terms of the GNU Lesser General Public - * License as published by the Free Software Foundation; either - * version 2.1 of the License, or (at your option) any later version. - * - * FFmpeg is distributed in the hope that it will be useful, - * but WITHOUT ANY WARRANTY; without even the implied warranty of - * MERCHANTABILITY or FITNESS FOR A PARTICULAR PURPOSE. See the GNU - * Lesser General Public License for more details. - * - * You should have received a copy of the GNU Lesser General Public - * License along with FFmpeg; if not, write to the Free Software - * Foundation, Inc., 51 Franklin Street, Fifth Floor, Boston, MA 02110-1301 USA - */ - -#ifndef AVDEVICE_AVDEVICE_H -#define AVDEVICE_AVDEVICE_H - -#include "version.h" - -/** - * @file - * @ingroup lavd - * Main libavdevice API header - */ - -/** - * @defgroup lavd Special devices muxing/demuxing library - * @{ - * Libavdevice is a complementary library to @ref libavf "libavformat". It - * provides various "special" platform-specific muxers and demuxers, e.g. for - * grabbing devices, audio capture and playback etc. As a consequence, the - * (de)muxers in libavdevice are of the AVFMT_NOFILE type (they use their own - * I/O functions). The filename passed to avformat_open_input() often does not - * refer to an actually existing file, but has some special device-specific - * meaning - e.g. for x11grab it is the display name. - * - * To use libavdevice, simply call avdevice_register_all() to register all - * compiled muxers and demuxers. They all use standard libavformat API. - * @} - */ - -#include "libavutil/log.h" -#include "libavutil/opt.h" -#include "libavutil/dict.h" -#include "libavformat/avformat.h" - -/** - * Return the LIBAVDEVICE_VERSION_INT constant. - */ -unsigned avdevice_version(void); - -/** - * Return the libavdevice build-time configuration. - */ -const char *avdevice_configuration(void); - -/** - * Return the libavdevice license. - */ -const char *avdevice_license(void); - -/** - * Initialize libavdevice and register all the input and output devices. - * @warning This function is not thread safe. - */ -void avdevice_register_all(void); - -/** - * Audio input devices iterator. - * - * If d is NULL, returns the first registered input audio/video device, - * if d is non-NULL, returns the next registered input audio/video device after d - * or NULL if d is the last one. - */ -AVInputFormat *av_input_audio_device_next(AVInputFormat *d); - -/** - * Video input devices iterator. - * - * If d is NULL, returns the first registered input audio/video device, - * if d is non-NULL, returns the next registered input audio/video device after d - * or NULL if d is the last one. - */ -AVInputFormat *av_input_video_device_next(AVInputFormat *d); - -/** - * Audio output devices iterator. - * - * If d is NULL, returns the first registered output audio/video device, - * if d is non-NULL, returns the next registered output audio/video device after d - * or NULL if d is the last one. - */ -AVOutputFormat *av_output_audio_device_next(AVOutputFormat *d); - -/** - * Video output devices iterator. - * - * If d is NULL, returns the first registered output audio/video device, - * if d is non-NULL, returns the next registered output audio/video device after d - * or NULL if d is the last one. - */ -AVOutputFormat *av_output_video_device_next(AVOutputFormat *d); - -typedef struct AVDeviceRect { - int x; /**< x coordinate of top left corner */ - int y; /**< y coordinate of top left corner */ - int width; /**< width */ - int height; /**< height */ -} AVDeviceRect; - -/** - * Message types used by avdevice_app_to_dev_control_message(). - */ -enum AVAppToDevMessageType { - /** - * Dummy message. - */ - AV_APP_TO_DEV_NONE = MKBETAG('N','O','N','E'), - - /** - * Window size change message. - * - * Message is sent to the device every time the application changes the size - * of the window device renders to. - * Message should also be sent right after window is created. - * - * data: AVDeviceRect: new window size. - */ - AV_APP_TO_DEV_WINDOW_SIZE = MKBETAG('G','E','O','M'), - - /** - * Repaint request message. - * - * Message is sent to the device when window has to be repainted. - * - * data: AVDeviceRect: area required to be repainted. - * NULL: whole area is required to be repainted. - */ - AV_APP_TO_DEV_WINDOW_REPAINT = MKBETAG('R','E','P','A'), - - /** - * Request pause/play. - * - * Application requests pause/unpause playback. - * Mostly usable with devices that have internal buffer. - * By default devices are not paused. - * - * data: NULL - */ - AV_APP_TO_DEV_PAUSE = MKBETAG('P', 'A', 'U', ' '), - AV_APP_TO_DEV_PLAY = MKBETAG('P', 'L', 'A', 'Y'), - AV_APP_TO_DEV_TOGGLE_PAUSE = MKBETAG('P', 'A', 'U', 'T'), - - /** - * Volume control message. - * - * Set volume level. It may be device-dependent if volume - * is changed per stream or system wide. Per stream volume - * change is expected when possible. - * - * data: double: new volume with range of 0.0 - 1.0. - */ - AV_APP_TO_DEV_SET_VOLUME = MKBETAG('S', 'V', 'O', 'L'), - - /** - * Mute control messages. - * - * Change mute state. It may be device-dependent if mute status - * is changed per stream or system wide. Per stream mute status - * change is expected when possible. - * - * data: NULL. - */ - AV_APP_TO_DEV_MUTE = MKBETAG(' ', 'M', 'U', 'T'), - AV_APP_TO_DEV_UNMUTE = MKBETAG('U', 'M', 'U', 'T'), - AV_APP_TO_DEV_TOGGLE_MUTE = MKBETAG('T', 'M', 'U', 'T'), - - /** - * Get volume/mute messages. - * - * Force the device to send AV_DEV_TO_APP_VOLUME_LEVEL_CHANGED or - * AV_DEV_TO_APP_MUTE_STATE_CHANGED command respectively. - * - * data: NULL. - */ - AV_APP_TO_DEV_GET_VOLUME = MKBETAG('G', 'V', 'O', 'L'), - AV_APP_TO_DEV_GET_MUTE = MKBETAG('G', 'M', 'U', 'T'), -}; - -/** - * Message types used by avdevice_dev_to_app_control_message(). - */ -enum AVDevToAppMessageType { - /** - * Dummy message. - */ - AV_DEV_TO_APP_NONE = MKBETAG('N','O','N','E'), - - /** - * Create window buffer message. - * - * Device requests to create a window buffer. Exact meaning is device- - * and application-dependent. Message is sent before rendering first - * frame and all one-shot initializations should be done here. - * Application is allowed to ignore preferred window buffer size. - * - * @note: Application is obligated to inform about window buffer size - * with AV_APP_TO_DEV_WINDOW_SIZE message. - * - * data: AVDeviceRect: preferred size of the window buffer. - * NULL: no preferred size of the window buffer. - */ - AV_DEV_TO_APP_CREATE_WINDOW_BUFFER = MKBETAG('B','C','R','E'), - - /** - * Prepare window buffer message. - * - * Device requests to prepare a window buffer for rendering. - * Exact meaning is device- and application-dependent. - * Message is sent before rendering of each frame. - * - * data: NULL. - */ - AV_DEV_TO_APP_PREPARE_WINDOW_BUFFER = MKBETAG('B','P','R','E'), - - /** - * Display window buffer message. - * - * Device requests to display a window buffer. - * Message is sent when new frame is ready to be displayed. - * Usually buffers need to be swapped in handler of this message. - * - * data: NULL. - */ - AV_DEV_TO_APP_DISPLAY_WINDOW_BUFFER = MKBETAG('B','D','I','S'), - - /** - * Destroy window buffer message. - * - * Device requests to destroy a window buffer. - * Message is sent when device is about to be destroyed and window - * buffer is not required anymore. - * - * data: NULL. - */ - AV_DEV_TO_APP_DESTROY_WINDOW_BUFFER = MKBETAG('B','D','E','S'), - - /** - * Buffer fullness status messages. - * - * Device signals buffer overflow/underflow. - * - * data: NULL. - */ - AV_DEV_TO_APP_BUFFER_OVERFLOW = MKBETAG('B','O','F','L'), - AV_DEV_TO_APP_BUFFER_UNDERFLOW = MKBETAG('B','U','F','L'), - - /** - * Buffer readable/writable. - * - * Device informs that buffer is readable/writable. - * When possible, device informs how many bytes can be read/write. - * - * @warning Device may not inform when number of bytes than can be read/write changes. - * - * data: int64_t: amount of bytes available to read/write. - * NULL: amount of bytes available to read/write is not known. - */ - AV_DEV_TO_APP_BUFFER_READABLE = MKBETAG('B','R','D',' '), - AV_DEV_TO_APP_BUFFER_WRITABLE = MKBETAG('B','W','R',' '), - - /** - * Mute state change message. - * - * Device informs that mute state has changed. - * - * data: int: 0 for not muted state, non-zero for muted state. - */ - AV_DEV_TO_APP_MUTE_STATE_CHANGED = MKBETAG('C','M','U','T'), - - /** - * Volume level change message. - * - * Device informs that volume level has changed. - * - * data: double: new volume with range of 0.0 - 1.0. - */ - AV_DEV_TO_APP_VOLUME_LEVEL_CHANGED = MKBETAG('C','V','O','L'), -}; - -/** - * Send control message from application to device. - * - * @param s device context. - * @param type message type. - * @param data message data. Exact type depends on message type. - * @param data_size size of message data. - * @return >= 0 on success, negative on error. - * AVERROR(ENOSYS) when device doesn't implement handler of the message. - */ -int avdevice_app_to_dev_control_message(struct AVFormatContext *s, - enum AVAppToDevMessageType type, - void *data, size_t data_size); - -/** - * Send control message from device to application. - * - * @param s device context. - * @param type message type. - * @param data message data. Can be NULL. - * @param data_size size of message data. - * @return >= 0 on success, negative on error. - * AVERROR(ENOSYS) when application doesn't implement handler of the message. - */ -int avdevice_dev_to_app_control_message(struct AVFormatContext *s, - enum AVDevToAppMessageType type, - void *data, size_t data_size); - -/** - * Following API allows user to probe device capabilities (supported codecs, - * pixel formats, sample formats, resolutions, channel counts, etc). - * It is build on top op AVOption API. - * Queried capabilities allows to set up converters of video or audio - * parameters that fit to the device. - * - * List of capabilities that can be queried: - * - Capabilities valid for both audio and video devices: - * - codec: supported audio/video codecs. - * type: AV_OPT_TYPE_INT (AVCodecID value) - * - Capabilities valid for audio devices: - * - sample_format: supported sample formats. - * type: AV_OPT_TYPE_INT (AVSampleFormat value) - * - sample_rate: supported sample rates. - * type: AV_OPT_TYPE_INT - * - channels: supported number of channels. - * type: AV_OPT_TYPE_INT - * - channel_layout: supported channel layouts. - * type: AV_OPT_TYPE_INT64 - * - Capabilities valid for video devices: - * - pixel_format: supported pixel formats. - * type: AV_OPT_TYPE_INT (AVPixelFormat value) - * - window_size: supported window sizes (describes size of the window size presented to the user). - * type: AV_OPT_TYPE_IMAGE_SIZE - * - frame_size: supported frame sizes (describes size of provided video frames). - * type: AV_OPT_TYPE_IMAGE_SIZE - * - fps: supported fps values - * type: AV_OPT_TYPE_RATIONAL - * - * Value of the capability may be set by user using av_opt_set() function - * and AVDeviceCapabilitiesQuery object. Following queries will - * limit results to the values matching already set capabilities. - * For example, setting a codec may impact number of formats or fps values - * returned during next query. Setting invalid value may limit results to zero. - * - * Example of the usage basing on opengl output device: - * - * @code - * AVFormatContext *oc = NULL; - * AVDeviceCapabilitiesQuery *caps = NULL; - * AVOptionRanges *ranges; - * int ret; - * - * if ((ret = avformat_alloc_output_context2(&oc, NULL, "opengl", NULL)) < 0) - * goto fail; - * if (avdevice_capabilities_create(&caps, oc, NULL) < 0) - * goto fail; - * - * //query codecs - * if (av_opt_query_ranges(&ranges, caps, "codec", AV_OPT_MULTI_COMPONENT_RANGE)) < 0) - * goto fail; - * //pick codec here and set it - * av_opt_set(caps, "codec", AV_CODEC_ID_RAWVIDEO, 0); - * - * //query format - * if (av_opt_query_ranges(&ranges, caps, "pixel_format", AV_OPT_MULTI_COMPONENT_RANGE)) < 0) - * goto fail; - * //pick format here and set it - * av_opt_set(caps, "pixel_format", AV_PIX_FMT_YUV420P, 0); - * - * //query and set more capabilities - * - * fail: - * //clean up code - * avdevice_capabilities_free(&query, oc); - * avformat_free_context(oc); - * @endcode - */ - -/** - * Structure describes device capabilities. - * - * It is used by devices in conjunction with av_device_capabilities AVOption table - * to implement capabilities probing API based on AVOption API. Should not be used directly. - */ -typedef struct AVDeviceCapabilitiesQuery { - const AVClass *av_class; - AVFormatContext *device_context; - enum AVCodecID codec; - enum AVSampleFormat sample_format; - enum AVPixelFormat pixel_format; - int sample_rate; - int channels; - int64_t channel_layout; - int window_width; - int window_height; - int frame_width; - int frame_height; - AVRational fps; -} AVDeviceCapabilitiesQuery; - -/** - * AVOption table used by devices to implement device capabilities API. Should not be used by a user. - */ -extern const AVOption av_device_capabilities[]; - -/** - * Initialize capabilities probing API based on AVOption API. - * - * avdevice_capabilities_free() must be called when query capabilities API is - * not used anymore. - * - * @param[out] caps Device capabilities data. Pointer to a NULL pointer must be passed. - * @param s Context of the device. - * @param device_options An AVDictionary filled with device-private options. - * On return this parameter will be destroyed and replaced with a dict - * containing options that were not found. May be NULL. - * The same options must be passed later to avformat_write_header() for output - * devices or avformat_open_input() for input devices, or at any other place - * that affects device-private options. - * - * @return >= 0 on success, negative otherwise. - */ -int avdevice_capabilities_create(AVDeviceCapabilitiesQuery **caps, AVFormatContext *s, - AVDictionary **device_options); - -/** - * Free resources created by avdevice_capabilities_create() - * - * @param caps Device capabilities data to be freed. - * @param s Context of the device. - */ -void avdevice_capabilities_free(AVDeviceCapabilitiesQuery **caps, AVFormatContext *s); - -/** - * Structure describes basic parameters of the device. - */ -typedef struct AVDeviceInfo { - char *device_name; /**< device name, format depends on device */ - char *device_description; /**< human friendly name */ -} AVDeviceInfo; - -/** - * List of devices. - */ -typedef struct AVDeviceInfoList { - AVDeviceInfo **devices; /**< list of autodetected devices */ - int nb_devices; /**< number of autodetected devices */ - int default_device; /**< index of default device or -1 if no default */ -} AVDeviceInfoList; - -/** - * List devices. - * - * Returns available device names and their parameters. - * - * @note: Some devices may accept system-dependent device names that cannot be - * autodetected. The list returned by this function cannot be assumed to - * be always completed. - * - * @param s device context. - * @param[out] device_list list of autodetected devices. - * @return count of autodetected devices, negative on error. - */ -int avdevice_list_devices(struct AVFormatContext *s, AVDeviceInfoList **device_list); - -/** - * Convenient function to free result of avdevice_list_devices(). - * - * @param devices device list to be freed. - */ -void avdevice_free_list_devices(AVDeviceInfoList **device_list); - -#endif /* AVDEVICE_AVDEVICE_H */ diff --git a/dji_sdk_manifold_read_cam/include/libavdevice/version.h b/dji_sdk_manifold_read_cam/include/libavdevice/version.h deleted file mode 100644 index 163a4c6..0000000 --- a/dji_sdk_manifold_read_cam/include/libavdevice/version.h +++ /dev/null @@ -1,50 +0,0 @@ -/* - * This file is part of FFmpeg. - * - * FFmpeg is free software; you can redistribute it and/or - * modify it under the terms of the GNU Lesser General Public - * License as published by the Free Software Foundation; either - * version 2.1 of the License, or (at your option) any later version. - * - * FFmpeg is distributed in the hope that it will be useful, - * but WITHOUT ANY WARRANTY; without even the implied warranty of - * MERCHANTABILITY or FITNESS FOR A PARTICULAR PURPOSE. See the GNU - * Lesser General Public License for more details. - * - * You should have received a copy of the GNU Lesser General Public - * License along with FFmpeg; if not, write to the Free Software - * Foundation, Inc., 51 Franklin Street, Fifth Floor, Boston, MA 02110-1301 USA - */ - -#ifndef AVDEVICE_VERSION_H -#define AVDEVICE_VERSION_H - -/** - * @file - * @ingroup lavd - * Libavdevice version macros - */ - -#include "libavutil/version.h" - -#define LIBAVDEVICE_VERSION_MAJOR 55 -#define LIBAVDEVICE_VERSION_MINOR 13 -#define LIBAVDEVICE_VERSION_MICRO 101 - -#define LIBAVDEVICE_VERSION_INT AV_VERSION_INT(LIBAVDEVICE_VERSION_MAJOR, \ - LIBAVDEVICE_VERSION_MINOR, \ - LIBAVDEVICE_VERSION_MICRO) -#define LIBAVDEVICE_VERSION AV_VERSION(LIBAVDEVICE_VERSION_MAJOR, \ - LIBAVDEVICE_VERSION_MINOR, \ - LIBAVDEVICE_VERSION_MICRO) -#define LIBAVDEVICE_BUILD LIBAVDEVICE_VERSION_INT - -#define LIBAVDEVICE_IDENT "Lavd" AV_STRINGIFY(LIBAVDEVICE_VERSION) - -/** - * FF_API_* defines may be placed below to indicate public API that will be - * dropped at a future version bump. The defines themselves are not part of - * the public API and may change, break or disappear at any time. - */ - -#endif /* AVDEVICE_VERSION_H */ diff --git a/dji_sdk_manifold_read_cam/include/libavfilter/asrc_abuffer.h b/dji_sdk_manifold_read_cam/include/libavfilter/asrc_abuffer.h deleted file mode 100644 index aa34461..0000000 --- a/dji_sdk_manifold_read_cam/include/libavfilter/asrc_abuffer.h +++ /dev/null @@ -1,91 +0,0 @@ -/* - * This file is part of FFmpeg. - * - * FFmpeg is free software; you can redistribute it and/or - * modify it under the terms of the GNU Lesser General Public - * License as published by the Free Software Foundation; either - * version 2.1 of the License, or (at your option) any later version. - * - * FFmpeg is distributed in the hope that it will be useful, - * but WITHOUT ANY WARRANTY; without even the implied warranty of - * MERCHANTABILITY or FITNESS FOR A PARTICULAR PURPOSE. See the GNU - * Lesser General Public License for more details. - * - * You should have received a copy of the GNU Lesser General Public - * License along with FFmpeg; if not, write to the Free Software - * Foundation, Inc., 51 Franklin Street, Fifth Floor, Boston, MA 02110-1301 USA - */ - -#ifndef AVFILTER_ASRC_ABUFFER_H -#define AVFILTER_ASRC_ABUFFER_H - -#include "avfilter.h" - -/** - * @file - * memory buffer source for audio - * - * @deprecated use buffersrc.h instead. - */ - -/** - * Queue an audio buffer to the audio buffer source. - * - * @param abuffersrc audio source buffer context - * @param data pointers to the samples planes - * @param linesize linesizes of each audio buffer plane - * @param nb_samples number of samples per channel - * @param sample_fmt sample format of the audio data - * @param ch_layout channel layout of the audio data - * @param planar flag to indicate if audio data is planar or packed - * @param pts presentation timestamp of the audio buffer - * @param flags unused - * - * @deprecated use av_buffersrc_add_ref() instead. - */ -attribute_deprecated -int av_asrc_buffer_add_samples(AVFilterContext *abuffersrc, - uint8_t *data[8], int linesize[8], - int nb_samples, int sample_rate, - int sample_fmt, int64_t ch_layout, int planar, - int64_t pts, int av_unused flags); - -/** - * Queue an audio buffer to the audio buffer source. - * - * This is similar to av_asrc_buffer_add_samples(), but the samples - * are stored in a buffer with known size. - * - * @param abuffersrc audio source buffer context - * @param buf pointer to the samples data, packed is assumed - * @param size the size in bytes of the buffer, it must contain an - * integer number of samples - * @param sample_fmt sample format of the audio data - * @param ch_layout channel layout of the audio data - * @param pts presentation timestamp of the audio buffer - * @param flags unused - * - * @deprecated use av_buffersrc_add_ref() instead. - */ -attribute_deprecated -int av_asrc_buffer_add_buffer(AVFilterContext *abuffersrc, - uint8_t *buf, int buf_size, - int sample_rate, - int sample_fmt, int64_t ch_layout, int planar, - int64_t pts, int av_unused flags); - -/** - * Queue an audio buffer to the audio buffer source. - * - * @param abuffersrc audio source buffer context - * @param samplesref buffer ref to queue - * @param flags unused - * - * @deprecated use av_buffersrc_add_ref() instead. - */ -attribute_deprecated -int av_asrc_buffer_add_audio_buffer_ref(AVFilterContext *abuffersrc, - AVFilterBufferRef *samplesref, - int av_unused flags); - -#endif /* AVFILTER_ASRC_ABUFFER_H */ diff --git a/dji_sdk_manifold_read_cam/include/libavfilter/avcodec.h b/dji_sdk_manifold_read_cam/include/libavfilter/avcodec.h deleted file mode 100644 index 8bbdad2..0000000 --- a/dji_sdk_manifold_read_cam/include/libavfilter/avcodec.h +++ /dev/null @@ -1,110 +0,0 @@ -/* - * This file is part of FFmpeg. - * - * FFmpeg is free software; you can redistribute it and/or - * modify it under the terms of the GNU Lesser General Public - * License as published by the Free Software Foundation; either - * version 2.1 of the License, or (at your option) any later version. - * - * FFmpeg is distributed in the hope that it will be useful, - * but WITHOUT ANY WARRANTY; without even the implied warranty of - * MERCHANTABILITY or FITNESS FOR A PARTICULAR PURPOSE. See the GNU - * Lesser General Public License for more details. - * - * You should have received a copy of the GNU Lesser General Public - * License along with FFmpeg; if not, write to the Free Software - * Foundation, Inc., 51 Franklin Street, Fifth Floor, Boston, MA 02110-1301 USA - */ - -#ifndef AVFILTER_AVCODEC_H -#define AVFILTER_AVCODEC_H - -/** - * @file - * libavcodec/libavfilter gluing utilities - * - * This should be included in an application ONLY if the installed - * libavfilter has been compiled with libavcodec support, otherwise - * symbols defined below will not be available. - */ - -#include "avfilter.h" - -#if FF_API_AVFILTERBUFFER -/** - * Create and return a picref reference from the data and properties - * contained in frame. - * - * @param perms permissions to assign to the new buffer reference - * @deprecated avfilter APIs work natively with AVFrame instead. - */ -attribute_deprecated -AVFilterBufferRef *avfilter_get_video_buffer_ref_from_frame(const AVFrame *frame, int perms); - - -/** - * Create and return a picref reference from the data and properties - * contained in frame. - * - * @param perms permissions to assign to the new buffer reference - * @deprecated avfilter APIs work natively with AVFrame instead. - */ -attribute_deprecated -AVFilterBufferRef *avfilter_get_audio_buffer_ref_from_frame(const AVFrame *frame, - int perms); - -/** - * Create and return a buffer reference from the data and properties - * contained in frame. - * - * @param perms permissions to assign to the new buffer reference - * @deprecated avfilter APIs work natively with AVFrame instead. - */ -attribute_deprecated -AVFilterBufferRef *avfilter_get_buffer_ref_from_frame(enum AVMediaType type, - const AVFrame *frame, - int perms); -#endif - -#if FF_API_FILL_FRAME -/** - * Fill an AVFrame with the information stored in samplesref. - * - * @param frame an already allocated AVFrame - * @param samplesref an audio buffer reference - * @return >= 0 in case of success, a negative AVERROR code in case of - * failure - * @deprecated Use avfilter_copy_buf_props() instead. - */ -attribute_deprecated -int avfilter_fill_frame_from_audio_buffer_ref(AVFrame *frame, - const AVFilterBufferRef *samplesref); - -/** - * Fill an AVFrame with the information stored in picref. - * - * @param frame an already allocated AVFrame - * @param picref a video buffer reference - * @return >= 0 in case of success, a negative AVERROR code in case of - * failure - * @deprecated Use avfilter_copy_buf_props() instead. - */ -attribute_deprecated -int avfilter_fill_frame_from_video_buffer_ref(AVFrame *frame, - const AVFilterBufferRef *picref); - -/** - * Fill an AVFrame with information stored in ref. - * - * @param frame an already allocated AVFrame - * @param ref a video or audio buffer reference - * @return >= 0 in case of success, a negative AVERROR code in case of - * failure - * @deprecated Use avfilter_copy_buf_props() instead. - */ -attribute_deprecated -int avfilter_fill_frame_from_buffer_ref(AVFrame *frame, - const AVFilterBufferRef *ref); -#endif - -#endif /* AVFILTER_AVCODEC_H */ diff --git a/dji_sdk_manifold_read_cam/include/libavfilter/avfilter.h b/dji_sdk_manifold_read_cam/include/libavfilter/avfilter.h deleted file mode 100644 index b5220b9..0000000 --- a/dji_sdk_manifold_read_cam/include/libavfilter/avfilter.h +++ /dev/null @@ -1,1531 +0,0 @@ -/* - * filter layer - * Copyright (c) 2007 Bobby Bingham - * - * This file is part of FFmpeg. - * - * FFmpeg is free software; you can redistribute it and/or - * modify it under the terms of the GNU Lesser General Public - * License as published by the Free Software Foundation; either - * version 2.1 of the License, or (at your option) any later version. - * - * FFmpeg is distributed in the hope that it will be useful, - * but WITHOUT ANY WARRANTY; without even the implied warranty of - * MERCHANTABILITY or FITNESS FOR A PARTICULAR PURPOSE. See the GNU - * Lesser General Public License for more details. - * - * You should have received a copy of the GNU Lesser General Public - * License along with FFmpeg; if not, write to the Free Software - * Foundation, Inc., 51 Franklin Street, Fifth Floor, Boston, MA 02110-1301 USA - */ - -#ifndef AVFILTER_AVFILTER_H -#define AVFILTER_AVFILTER_H - -/** - * @file - * @ingroup lavfi - * Main libavfilter public API header - */ - -/** - * @defgroup lavfi Libavfilter - graph-based frame editing library - * @{ - */ - -#include - -#include "libavutil/attributes.h" -#include "libavutil/avutil.h" -#include "libavutil/dict.h" -#include "libavutil/frame.h" -#include "libavutil/log.h" -#include "libavutil/samplefmt.h" -#include "libavutil/pixfmt.h" -#include "libavutil/rational.h" - -#include "libavfilter/version.h" - -/** - * Return the LIBAVFILTER_VERSION_INT constant. - */ -unsigned avfilter_version(void); - -/** - * Return the libavfilter build-time configuration. - */ -const char *avfilter_configuration(void); - -/** - * Return the libavfilter license. - */ -const char *avfilter_license(void); - -typedef struct AVFilterContext AVFilterContext; -typedef struct AVFilterLink AVFilterLink; -typedef struct AVFilterPad AVFilterPad; -typedef struct AVFilterFormats AVFilterFormats; - -#if FF_API_AVFILTERBUFFER -/** - * A reference-counted buffer data type used by the filter system. Filters - * should not store pointers to this structure directly, but instead use the - * AVFilterBufferRef structure below. - */ -typedef struct AVFilterBuffer { - uint8_t *data[8]; ///< buffer data for each plane/channel - - /** - * pointers to the data planes/channels. - * - * For video, this should simply point to data[]. - * - * For planar audio, each channel has a separate data pointer, and - * linesize[0] contains the size of each channel buffer. - * For packed audio, there is just one data pointer, and linesize[0] - * contains the total size of the buffer for all channels. - * - * Note: Both data and extended_data will always be set, but for planar - * audio with more channels that can fit in data, extended_data must be used - * in order to access all channels. - */ - uint8_t **extended_data; - int linesize[8]; ///< number of bytes per line - - /** private data to be used by a custom free function */ - void *priv; - /** - * A pointer to the function to deallocate this buffer if the default - * function is not sufficient. This could, for example, add the memory - * back into a memory pool to be reused later without the overhead of - * reallocating it from scratch. - */ - void (*free)(struct AVFilterBuffer *buf); - - int format; ///< media format - int w, h; ///< width and height of the allocated buffer - unsigned refcount; ///< number of references to this buffer -} AVFilterBuffer; - -#define AV_PERM_READ 0x01 ///< can read from the buffer -#define AV_PERM_WRITE 0x02 ///< can write to the buffer -#define AV_PERM_PRESERVE 0x04 ///< nobody else can overwrite the buffer -#define AV_PERM_REUSE 0x08 ///< can output the buffer multiple times, with the same contents each time -#define AV_PERM_REUSE2 0x10 ///< can output the buffer multiple times, modified each time -#define AV_PERM_NEG_LINESIZES 0x20 ///< the buffer requested can have negative linesizes -#define AV_PERM_ALIGN 0x40 ///< the buffer must be aligned - -#define AVFILTER_ALIGN 16 //not part of ABI - -/** - * Audio specific properties in a reference to an AVFilterBuffer. Since - * AVFilterBufferRef is common to different media formats, audio specific - * per reference properties must be separated out. - */ -typedef struct AVFilterBufferRefAudioProps { - uint64_t channel_layout; ///< channel layout of audio buffer - int nb_samples; ///< number of audio samples per channel - int sample_rate; ///< audio buffer sample rate - int channels; ///< number of channels (do not access directly) -} AVFilterBufferRefAudioProps; - -/** - * Video specific properties in a reference to an AVFilterBuffer. Since - * AVFilterBufferRef is common to different media formats, video specific - * per reference properties must be separated out. - */ -typedef struct AVFilterBufferRefVideoProps { - int w; ///< image width - int h; ///< image height - AVRational sample_aspect_ratio; ///< sample aspect ratio - int interlaced; ///< is frame interlaced - int top_field_first; ///< field order - enum AVPictureType pict_type; ///< picture type of the frame - int key_frame; ///< 1 -> keyframe, 0-> not - int qp_table_linesize; ///< qp_table stride - int qp_table_size; ///< qp_table size - int8_t *qp_table; ///< array of Quantization Parameters -} AVFilterBufferRefVideoProps; - -/** - * A reference to an AVFilterBuffer. Since filters can manipulate the origin of - * a buffer to, for example, crop image without any memcpy, the buffer origin - * and dimensions are per-reference properties. Linesize is also useful for - * image flipping, frame to field filters, etc, and so is also per-reference. - * - * TODO: add anything necessary for frame reordering - */ -typedef struct AVFilterBufferRef { - AVFilterBuffer *buf; ///< the buffer that this is a reference to - uint8_t *data[8]; ///< picture/audio data for each plane - /** - * pointers to the data planes/channels. - * - * For video, this should simply point to data[]. - * - * For planar audio, each channel has a separate data pointer, and - * linesize[0] contains the size of each channel buffer. - * For packed audio, there is just one data pointer, and linesize[0] - * contains the total size of the buffer for all channels. - * - * Note: Both data and extended_data will always be set, but for planar - * audio with more channels that can fit in data, extended_data must be used - * in order to access all channels. - */ - uint8_t **extended_data; - int linesize[8]; ///< number of bytes per line - - AVFilterBufferRefVideoProps *video; ///< video buffer specific properties - AVFilterBufferRefAudioProps *audio; ///< audio buffer specific properties - - /** - * presentation timestamp. The time unit may change during - * filtering, as it is specified in the link and the filter code - * may need to rescale the PTS accordingly. - */ - int64_t pts; - int64_t pos; ///< byte position in stream, -1 if unknown - - int format; ///< media format - - int perms; ///< permissions, see the AV_PERM_* flags - - enum AVMediaType type; ///< media type of buffer data - - AVDictionary *metadata; ///< dictionary containing metadata key=value tags -} AVFilterBufferRef; - -/** - * Copy properties of src to dst, without copying the actual data - */ -attribute_deprecated -void avfilter_copy_buffer_ref_props(AVFilterBufferRef *dst, const AVFilterBufferRef *src); - -/** - * Add a new reference to a buffer. - * - * @param ref an existing reference to the buffer - * @param pmask a bitmask containing the allowable permissions in the new - * reference - * @return a new reference to the buffer with the same properties as the - * old, excluding any permissions denied by pmask - */ -attribute_deprecated -AVFilterBufferRef *avfilter_ref_buffer(AVFilterBufferRef *ref, int pmask); - -/** - * Remove a reference to a buffer. If this is the last reference to the - * buffer, the buffer itself is also automatically freed. - * - * @param ref reference to the buffer, may be NULL - * - * @note it is recommended to use avfilter_unref_bufferp() instead of this - * function - */ -attribute_deprecated -void avfilter_unref_buffer(AVFilterBufferRef *ref); - -/** - * Remove a reference to a buffer and set the pointer to NULL. - * If this is the last reference to the buffer, the buffer itself - * is also automatically freed. - * - * @param ref pointer to the buffer reference - */ -attribute_deprecated -void avfilter_unref_bufferp(AVFilterBufferRef **ref); -#endif - -/** - * Get the number of channels of a buffer reference. - */ -attribute_deprecated -int avfilter_ref_get_channels(AVFilterBufferRef *ref); - -#if FF_API_AVFILTERPAD_PUBLIC -/** - * A filter pad used for either input or output. - * - * See doc/filter_design.txt for details on how to implement the methods. - * - * @warning this struct might be removed from public API. - * users should call avfilter_pad_get_name() and avfilter_pad_get_type() - * to access the name and type fields; there should be no need to access - * any other fields from outside of libavfilter. - */ -struct AVFilterPad { - /** - * Pad name. The name is unique among inputs and among outputs, but an - * input may have the same name as an output. This may be NULL if this - * pad has no need to ever be referenced by name. - */ - const char *name; - - /** - * AVFilterPad type. - */ - enum AVMediaType type; - - /** - * Input pads: - * Minimum required permissions on incoming buffers. Any buffer with - * insufficient permissions will be automatically copied by the filter - * system to a new buffer which provides the needed access permissions. - * - * Output pads: - * Guaranteed permissions on outgoing buffers. Any buffer pushed on the - * link must have at least these permissions; this fact is checked by - * asserts. It can be used to optimize buffer allocation. - */ - attribute_deprecated int min_perms; - - /** - * Input pads: - * Permissions which are not accepted on incoming buffers. Any buffer - * which has any of these permissions set will be automatically copied - * by the filter system to a new buffer which does not have those - * permissions. This can be used to easily disallow buffers with - * AV_PERM_REUSE. - * - * Output pads: - * Permissions which are automatically removed on outgoing buffers. It - * can be used to optimize buffer allocation. - */ - attribute_deprecated int rej_perms; - - /** - * @deprecated unused - */ - int (*start_frame)(AVFilterLink *link, AVFilterBufferRef *picref); - - /** - * Callback function to get a video buffer. If NULL, the filter system will - * use ff_default_get_video_buffer(). - * - * Input video pads only. - */ - AVFrame *(*get_video_buffer)(AVFilterLink *link, int w, int h); - - /** - * Callback function to get an audio buffer. If NULL, the filter system will - * use ff_default_get_audio_buffer(). - * - * Input audio pads only. - */ - AVFrame *(*get_audio_buffer)(AVFilterLink *link, int nb_samples); - - /** - * @deprecated unused - */ - int (*end_frame)(AVFilterLink *link); - - /** - * @deprecated unused - */ - int (*draw_slice)(AVFilterLink *link, int y, int height, int slice_dir); - - /** - * Filtering callback. This is where a filter receives a frame with - * audio/video data and should do its processing. - * - * Input pads only. - * - * @return >= 0 on success, a negative AVERROR on error. This function - * must ensure that frame is properly unreferenced on error if it - * hasn't been passed on to another filter. - */ - int (*filter_frame)(AVFilterLink *link, AVFrame *frame); - - /** - * Frame poll callback. This returns the number of immediately available - * samples. It should return a positive value if the next request_frame() - * is guaranteed to return one frame (with no delay). - * - * Defaults to just calling the source poll_frame() method. - * - * Output pads only. - */ - int (*poll_frame)(AVFilterLink *link); - - /** - * Frame request callback. A call to this should result in at least one - * frame being output over the given link. This should return zero on - * success, and another value on error. - * See ff_request_frame() for the error codes with a specific - * meaning. - * - * Output pads only. - */ - int (*request_frame)(AVFilterLink *link); - - /** - * Link configuration callback. - * - * For output pads, this should set the following link properties: - * video: width, height, sample_aspect_ratio, time_base - * audio: sample_rate. - * - * This should NOT set properties such as format, channel_layout, etc which - * are negotiated between filters by the filter system using the - * query_formats() callback before this function is called. - * - * For input pads, this should check the properties of the link, and update - * the filter's internal state as necessary. - * - * For both input and output pads, this should return zero on success, - * and another value on error. - */ - int (*config_props)(AVFilterLink *link); - - /** - * The filter expects a fifo to be inserted on its input link, - * typically because it has a delay. - * - * input pads only. - */ - int needs_fifo; - - /** - * The filter expects writable frames from its input link, - * duplicating data buffers if needed. - * - * input pads only. - */ - int needs_writable; -}; -#endif - -/** - * Get the number of elements in a NULL-terminated array of AVFilterPads (e.g. - * AVFilter.inputs/outputs). - */ -int avfilter_pad_count(const AVFilterPad *pads); - -/** - * Get the name of an AVFilterPad. - * - * @param pads an array of AVFilterPads - * @param pad_idx index of the pad in the array it; is the caller's - * responsibility to ensure the index is valid - * - * @return name of the pad_idx'th pad in pads - */ -const char *avfilter_pad_get_name(const AVFilterPad *pads, int pad_idx); - -/** - * Get the type of an AVFilterPad. - * - * @param pads an array of AVFilterPads - * @param pad_idx index of the pad in the array; it is the caller's - * responsibility to ensure the index is valid - * - * @return type of the pad_idx'th pad in pads - */ -enum AVMediaType avfilter_pad_get_type(const AVFilterPad *pads, int pad_idx); - -/** - * The number of the filter inputs is not determined just by AVFilter.inputs. - * The filter might add additional inputs during initialization depending on the - * options supplied to it. - */ -#define AVFILTER_FLAG_DYNAMIC_INPUTS (1 << 0) -/** - * The number of the filter outputs is not determined just by AVFilter.outputs. - * The filter might add additional outputs during initialization depending on - * the options supplied to it. - */ -#define AVFILTER_FLAG_DYNAMIC_OUTPUTS (1 << 1) -/** - * The filter supports multithreading by splitting frames into multiple parts - * and processing them concurrently. - */ -#define AVFILTER_FLAG_SLICE_THREADS (1 << 2) -/** - * Some filters support a generic "enable" expression option that can be used - * to enable or disable a filter in the timeline. Filters supporting this - * option have this flag set. When the enable expression is false, the default - * no-op filter_frame() function is called in place of the filter_frame() - * callback defined on each input pad, thus the frame is passed unchanged to - * the next filters. - */ -#define AVFILTER_FLAG_SUPPORT_TIMELINE_GENERIC (1 << 16) -/** - * Same as AVFILTER_FLAG_SUPPORT_TIMELINE_GENERIC, except that the filter will - * have its filter_frame() callback(s) called as usual even when the enable - * expression is false. The filter will disable filtering within the - * filter_frame() callback(s) itself, for example executing code depending on - * the AVFilterContext->is_disabled value. - */ -#define AVFILTER_FLAG_SUPPORT_TIMELINE_INTERNAL (1 << 17) -/** - * Handy mask to test whether the filter supports or no the timeline feature - * (internally or generically). - */ -#define AVFILTER_FLAG_SUPPORT_TIMELINE (AVFILTER_FLAG_SUPPORT_TIMELINE_GENERIC | AVFILTER_FLAG_SUPPORT_TIMELINE_INTERNAL) - -/** - * Filter definition. This defines the pads a filter contains, and all the - * callback functions used to interact with the filter. - */ -typedef struct AVFilter { - /** - * Filter name. Must be non-NULL and unique among filters. - */ - const char *name; - - /** - * A description of the filter. May be NULL. - * - * You should use the NULL_IF_CONFIG_SMALL() macro to define it. - */ - const char *description; - - /** - * List of inputs, terminated by a zeroed element. - * - * NULL if there are no (static) inputs. Instances of filters with - * AVFILTER_FLAG_DYNAMIC_INPUTS set may have more inputs than present in - * this list. - */ - const AVFilterPad *inputs; - /** - * List of outputs, terminated by a zeroed element. - * - * NULL if there are no (static) outputs. Instances of filters with - * AVFILTER_FLAG_DYNAMIC_OUTPUTS set may have more outputs than present in - * this list. - */ - const AVFilterPad *outputs; - - /** - * A class for the private data, used to declare filter private AVOptions. - * This field is NULL for filters that do not declare any options. - * - * If this field is non-NULL, the first member of the filter private data - * must be a pointer to AVClass, which will be set by libavfilter generic - * code to this class. - */ - const AVClass *priv_class; - - /** - * A combination of AVFILTER_FLAG_* - */ - int flags; - - /***************************************************************** - * All fields below this line are not part of the public API. They - * may not be used outside of libavfilter and can be changed and - * removed at will. - * New public fields should be added right above. - ***************************************************************** - */ - - /** - * Filter initialization function. - * - * This callback will be called only once during the filter lifetime, after - * all the options have been set, but before links between filters are - * established and format negotiation is done. - * - * Basic filter initialization should be done here. Filters with dynamic - * inputs and/or outputs should create those inputs/outputs here based on - * provided options. No more changes to this filter's inputs/outputs can be - * done after this callback. - * - * This callback must not assume that the filter links exist or frame - * parameters are known. - * - * @ref AVFilter.uninit "uninit" is guaranteed to be called even if - * initialization fails, so this callback does not have to clean up on - * failure. - * - * @return 0 on success, a negative AVERROR on failure - */ - int (*init)(AVFilterContext *ctx); - - /** - * Should be set instead of @ref AVFilter.init "init" by the filters that - * want to pass a dictionary of AVOptions to nested contexts that are - * allocated during init. - * - * On return, the options dict should be freed and replaced with one that - * contains all the options which could not be processed by this filter (or - * with NULL if all the options were processed). - * - * Otherwise the semantics is the same as for @ref AVFilter.init "init". - */ - int (*init_dict)(AVFilterContext *ctx, AVDictionary **options); - - /** - * Filter uninitialization function. - * - * Called only once right before the filter is freed. Should deallocate any - * memory held by the filter, release any buffer references, etc. It does - * not need to deallocate the AVFilterContext.priv memory itself. - * - * This callback may be called even if @ref AVFilter.init "init" was not - * called or failed, so it must be prepared to handle such a situation. - */ - void (*uninit)(AVFilterContext *ctx); - - /** - * Query formats supported by the filter on its inputs and outputs. - * - * This callback is called after the filter is initialized (so the inputs - * and outputs are fixed), shortly before the format negotiation. This - * callback may be called more than once. - * - * This callback must set AVFilterLink.out_formats on every input link and - * AVFilterLink.in_formats on every output link to a list of pixel/sample - * formats that the filter supports on that link. For audio links, this - * filter must also set @ref AVFilterLink.in_samplerates "in_samplerates" / - * @ref AVFilterLink.out_samplerates "out_samplerates" and - * @ref AVFilterLink.in_channel_layouts "in_channel_layouts" / - * @ref AVFilterLink.out_channel_layouts "out_channel_layouts" analogously. - * - * This callback may be NULL for filters with one input, in which case - * libavfilter assumes that it supports all input formats and preserves - * them on output. - * - * @return zero on success, a negative value corresponding to an - * AVERROR code otherwise - */ - int (*query_formats)(AVFilterContext *); - - int priv_size; ///< size of private data to allocate for the filter - - /** - * Used by the filter registration system. Must not be touched by any other - * code. - */ - struct AVFilter *next; - - /** - * Make the filter instance process a command. - * - * @param cmd the command to process, for handling simplicity all commands must be alphanumeric only - * @param arg the argument for the command - * @param res a buffer with size res_size where the filter(s) can return a response. This must not change when the command is not supported. - * @param flags if AVFILTER_CMD_FLAG_FAST is set and the command would be - * time consuming then a filter should treat it like an unsupported command - * - * @returns >=0 on success otherwise an error code. - * AVERROR(ENOSYS) on unsupported commands - */ - int (*process_command)(AVFilterContext *, const char *cmd, const char *arg, char *res, int res_len, int flags); - - /** - * Filter initialization function, alternative to the init() - * callback. Args contains the user-supplied parameters, opaque is - * used for providing binary data. - */ - int (*init_opaque)(AVFilterContext *ctx, void *opaque); -} AVFilter; - -/** - * Process multiple parts of the frame concurrently. - */ -#define AVFILTER_THREAD_SLICE (1 << 0) - -typedef struct AVFilterInternal AVFilterInternal; - -/** An instance of a filter */ -struct AVFilterContext { - const AVClass *av_class; ///< needed for av_log() and filters common options - - const AVFilter *filter; ///< the AVFilter of which this is an instance - - char *name; ///< name of this filter instance - - AVFilterPad *input_pads; ///< array of input pads - AVFilterLink **inputs; ///< array of pointers to input links -#if FF_API_FOO_COUNT - attribute_deprecated unsigned input_count; ///< @deprecated use nb_inputs -#endif - unsigned nb_inputs; ///< number of input pads - - AVFilterPad *output_pads; ///< array of output pads - AVFilterLink **outputs; ///< array of pointers to output links -#if FF_API_FOO_COUNT - attribute_deprecated unsigned output_count; ///< @deprecated use nb_outputs -#endif - unsigned nb_outputs; ///< number of output pads - - void *priv; ///< private data for use by the filter - - struct AVFilterGraph *graph; ///< filtergraph this filter belongs to - - /** - * Type of multithreading being allowed/used. A combination of - * AVFILTER_THREAD_* flags. - * - * May be set by the caller before initializing the filter to forbid some - * or all kinds of multithreading for this filter. The default is allowing - * everything. - * - * When the filter is initialized, this field is combined using bit AND with - * AVFilterGraph.thread_type to get the final mask used for determining - * allowed threading types. I.e. a threading type needs to be set in both - * to be allowed. - * - * After the filter is initialized, libavfilter sets this field to the - * threading type that is actually used (0 for no multithreading). - */ - int thread_type; - - /** - * An opaque struct for libavfilter internal use. - */ - AVFilterInternal *internal; - - struct AVFilterCommand *command_queue; - - char *enable_str; ///< enable expression string - void *enable; ///< parsed expression (AVExpr*) - double *var_values; ///< variable values for the enable expression - int is_disabled; ///< the enabled state from the last expression evaluation -}; - -/** - * A link between two filters. This contains pointers to the source and - * destination filters between which this link exists, and the indexes of - * the pads involved. In addition, this link also contains the parameters - * which have been negotiated and agreed upon between the filter, such as - * image dimensions, format, etc. - */ -struct AVFilterLink { - AVFilterContext *src; ///< source filter - AVFilterPad *srcpad; ///< output pad on the source filter - - AVFilterContext *dst; ///< dest filter - AVFilterPad *dstpad; ///< input pad on the dest filter - - enum AVMediaType type; ///< filter media type - - /* These parameters apply only to video */ - int w; ///< agreed upon image width - int h; ///< agreed upon image height - AVRational sample_aspect_ratio; ///< agreed upon sample aspect ratio - /* These parameters apply only to audio */ - uint64_t channel_layout; ///< channel layout of current buffer (see libavutil/channel_layout.h) - int sample_rate; ///< samples per second - - int format; ///< agreed upon media format - - /** - * Define the time base used by the PTS of the frames/samples - * which will pass through this link. - * During the configuration stage, each filter is supposed to - * change only the output timebase, while the timebase of the - * input link is assumed to be an unchangeable property. - */ - AVRational time_base; - - /***************************************************************** - * All fields below this line are not part of the public API. They - * may not be used outside of libavfilter and can be changed and - * removed at will. - * New public fields should be added right above. - ***************************************************************** - */ - /** - * Lists of formats and channel layouts supported by the input and output - * filters respectively. These lists are used for negotiating the format - * to actually be used, which will be loaded into the format and - * channel_layout members, above, when chosen. - * - */ - AVFilterFormats *in_formats; - AVFilterFormats *out_formats; - - /** - * Lists of channel layouts and sample rates used for automatic - * negotiation. - */ - AVFilterFormats *in_samplerates; - AVFilterFormats *out_samplerates; - struct AVFilterChannelLayouts *in_channel_layouts; - struct AVFilterChannelLayouts *out_channel_layouts; - - /** - * Audio only, the destination filter sets this to a non-zero value to - * request that buffers with the given number of samples should be sent to - * it. AVFilterPad.needs_fifo must also be set on the corresponding input - * pad. - * Last buffer before EOF will be padded with silence. - */ - int request_samples; - - /** stage of the initialization of the link properties (dimensions, etc) */ - enum { - AVLINK_UNINIT = 0, ///< not started - AVLINK_STARTINIT, ///< started, but incomplete - AVLINK_INIT ///< complete - } init_state; - - struct AVFilterPool *pool; - - /** - * Graph the filter belongs to. - */ - struct AVFilterGraph *graph; - - /** - * Current timestamp of the link, as defined by the most recent - * frame(s), in AV_TIME_BASE units. - */ - int64_t current_pts; - - /** - * Index in the age array. - */ - int age_index; - - /** - * Frame rate of the stream on the link, or 1/0 if unknown; - * if left to 0/0, will be automatically be copied from the first input - * of the source filter if it exists. - * - * Sources should set it to the best estimation of the real frame rate. - * Filters should update it if necessary depending on their function. - * Sinks can use it to set a default output frame rate. - * It is similar to the r_frame_rate field in AVStream. - */ - AVRational frame_rate; - - /** - * Buffer partially filled with samples to achieve a fixed/minimum size. - */ - AVFrame *partial_buf; - - /** - * Size of the partial buffer to allocate. - * Must be between min_samples and max_samples. - */ - int partial_buf_size; - - /** - * Minimum number of samples to filter at once. If filter_frame() is - * called with fewer samples, it will accumulate them in partial_buf. - * This field and the related ones must not be changed after filtering - * has started. - * If 0, all related fields are ignored. - */ - int min_samples; - - /** - * Maximum number of samples to filter at once. If filter_frame() is - * called with more samples, it will split them. - */ - int max_samples; - - /** - * The buffer reference currently being received across the link by the - * destination filter. This is used internally by the filter system to - * allow automatic copying of buffers which do not have sufficient - * permissions for the destination. This should not be accessed directly - * by the filters. - */ - AVFilterBufferRef *cur_buf_copy; - - /** - * True if the link is closed. - * If set, all attempts of start_frame, filter_frame or request_frame - * will fail with AVERROR_EOF, and if necessary the reference will be - * destroyed. - * If request_frame returns AVERROR_EOF, this flag is set on the - * corresponding link. - * It can be set also be set by either the source or the destination - * filter. - */ - int closed; - - /** - * Number of channels. - */ - int channels; - - /** - * True if a frame is being requested on the link. - * Used internally by the framework. - */ - unsigned frame_requested; - - /** - * Link processing flags. - */ - unsigned flags; - - /** - * Number of past frames sent through the link. - */ - int64_t frame_count; -}; - -/** - * Link two filters together. - * - * @param src the source filter - * @param srcpad index of the output pad on the source filter - * @param dst the destination filter - * @param dstpad index of the input pad on the destination filter - * @return zero on success - */ -int avfilter_link(AVFilterContext *src, unsigned srcpad, - AVFilterContext *dst, unsigned dstpad); - -/** - * Free the link in *link, and set its pointer to NULL. - */ -void avfilter_link_free(AVFilterLink **link); - -/** - * Get the number of channels of a link. - */ -int avfilter_link_get_channels(AVFilterLink *link); - -/** - * Set the closed field of a link. - */ -void avfilter_link_set_closed(AVFilterLink *link, int closed); - -/** - * Negotiate the media format, dimensions, etc of all inputs to a filter. - * - * @param filter the filter to negotiate the properties for its inputs - * @return zero on successful negotiation - */ -int avfilter_config_links(AVFilterContext *filter); - -#if FF_API_AVFILTERBUFFER -/** - * Create a buffer reference wrapped around an already allocated image - * buffer. - * - * @param data pointers to the planes of the image to reference - * @param linesize linesizes for the planes of the image to reference - * @param perms the required access permissions - * @param w the width of the image specified by the data and linesize arrays - * @param h the height of the image specified by the data and linesize arrays - * @param format the pixel format of the image specified by the data and linesize arrays - */ -attribute_deprecated -AVFilterBufferRef * -avfilter_get_video_buffer_ref_from_arrays(uint8_t * const data[4], const int linesize[4], int perms, - int w, int h, enum AVPixelFormat format); - -/** - * Create an audio buffer reference wrapped around an already - * allocated samples buffer. - * - * See avfilter_get_audio_buffer_ref_from_arrays_channels() for a version - * that can handle unknown channel layouts. - * - * @param data pointers to the samples plane buffers - * @param linesize linesize for the samples plane buffers - * @param perms the required access permissions - * @param nb_samples number of samples per channel - * @param sample_fmt the format of each sample in the buffer to allocate - * @param channel_layout the channel layout of the buffer - */ -attribute_deprecated -AVFilterBufferRef *avfilter_get_audio_buffer_ref_from_arrays(uint8_t **data, - int linesize, - int perms, - int nb_samples, - enum AVSampleFormat sample_fmt, - uint64_t channel_layout); -/** - * Create an audio buffer reference wrapped around an already - * allocated samples buffer. - * - * @param data pointers to the samples plane buffers - * @param linesize linesize for the samples plane buffers - * @param perms the required access permissions - * @param nb_samples number of samples per channel - * @param sample_fmt the format of each sample in the buffer to allocate - * @param channels the number of channels of the buffer - * @param channel_layout the channel layout of the buffer, - * must be either 0 or consistent with channels - */ -attribute_deprecated -AVFilterBufferRef *avfilter_get_audio_buffer_ref_from_arrays_channels(uint8_t **data, - int linesize, - int perms, - int nb_samples, - enum AVSampleFormat sample_fmt, - int channels, - uint64_t channel_layout); - -#endif - - -#define AVFILTER_CMD_FLAG_ONE 1 ///< Stop once a filter understood the command (for target=all for example), fast filters are favored automatically -#define AVFILTER_CMD_FLAG_FAST 2 ///< Only execute command when its fast (like a video out that supports contrast adjustment in hw) - -/** - * Make the filter instance process a command. - * It is recommended to use avfilter_graph_send_command(). - */ -int avfilter_process_command(AVFilterContext *filter, const char *cmd, const char *arg, char *res, int res_len, int flags); - -/** Initialize the filter system. Register all builtin filters. */ -void avfilter_register_all(void); - -#if FF_API_OLD_FILTER_REGISTER -/** Uninitialize the filter system. Unregister all filters. */ -attribute_deprecated -void avfilter_uninit(void); -#endif - -/** - * Register a filter. This is only needed if you plan to use - * avfilter_get_by_name later to lookup the AVFilter structure by name. A - * filter can still by instantiated with avfilter_graph_alloc_filter even if it - * is not registered. - * - * @param filter the filter to register - * @return 0 if the registration was successful, a negative value - * otherwise - */ -int avfilter_register(AVFilter *filter); - -/** - * Get a filter definition matching the given name. - * - * @param name the filter name to find - * @return the filter definition, if any matching one is registered. - * NULL if none found. - */ -#if !FF_API_NOCONST_GET_NAME -const -#endif -AVFilter *avfilter_get_by_name(const char *name); - -/** - * Iterate over all registered filters. - * @return If prev is non-NULL, next registered filter after prev or NULL if - * prev is the last filter. If prev is NULL, return the first registered filter. - */ -const AVFilter *avfilter_next(const AVFilter *prev); - -#if FF_API_OLD_FILTER_REGISTER -/** - * If filter is NULL, returns a pointer to the first registered filter pointer, - * if filter is non-NULL, returns the next pointer after filter. - * If the returned pointer points to NULL, the last registered filter - * was already reached. - * @deprecated use avfilter_next() - */ -attribute_deprecated -AVFilter **av_filter_next(AVFilter **filter); -#endif - -#if FF_API_AVFILTER_OPEN -/** - * Create a filter instance. - * - * @param filter_ctx put here a pointer to the created filter context - * on success, NULL on failure - * @param filter the filter to create an instance of - * @param inst_name Name to give to the new instance. Can be NULL for none. - * @return >= 0 in case of success, a negative error code otherwise - * @deprecated use avfilter_graph_alloc_filter() instead - */ -attribute_deprecated -int avfilter_open(AVFilterContext **filter_ctx, AVFilter *filter, const char *inst_name); -#endif - - -#if FF_API_AVFILTER_INIT_FILTER -/** - * Initialize a filter. - * - * @param filter the filter to initialize - * @param args A string of parameters to use when initializing the filter. - * The format and meaning of this string varies by filter. - * @param opaque Any extra non-string data needed by the filter. The meaning - * of this parameter varies by filter. - * @return zero on success - */ -attribute_deprecated -int avfilter_init_filter(AVFilterContext *filter, const char *args, void *opaque); -#endif - -/** - * Initialize a filter with the supplied parameters. - * - * @param ctx uninitialized filter context to initialize - * @param args Options to initialize the filter with. This must be a - * ':'-separated list of options in the 'key=value' form. - * May be NULL if the options have been set directly using the - * AVOptions API or there are no options that need to be set. - * @return 0 on success, a negative AVERROR on failure - */ -int avfilter_init_str(AVFilterContext *ctx, const char *args); - -/** - * Initialize a filter with the supplied dictionary of options. - * - * @param ctx uninitialized filter context to initialize - * @param options An AVDictionary filled with options for this filter. On - * return this parameter will be destroyed and replaced with - * a dict containing options that were not found. This dictionary - * must be freed by the caller. - * May be NULL, then this function is equivalent to - * avfilter_init_str() with the second parameter set to NULL. - * @return 0 on success, a negative AVERROR on failure - * - * @note This function and avfilter_init_str() do essentially the same thing, - * the difference is in manner in which the options are passed. It is up to the - * calling code to choose whichever is more preferable. The two functions also - * behave differently when some of the provided options are not declared as - * supported by the filter. In such a case, avfilter_init_str() will fail, but - * this function will leave those extra options in the options AVDictionary and - * continue as usual. - */ -int avfilter_init_dict(AVFilterContext *ctx, AVDictionary **options); - -/** - * Free a filter context. This will also remove the filter from its - * filtergraph's list of filters. - * - * @param filter the filter to free - */ -void avfilter_free(AVFilterContext *filter); - -/** - * Insert a filter in the middle of an existing link. - * - * @param link the link into which the filter should be inserted - * @param filt the filter to be inserted - * @param filt_srcpad_idx the input pad on the filter to connect - * @param filt_dstpad_idx the output pad on the filter to connect - * @return zero on success - */ -int avfilter_insert_filter(AVFilterLink *link, AVFilterContext *filt, - unsigned filt_srcpad_idx, unsigned filt_dstpad_idx); - -#if FF_API_AVFILTERBUFFER -/** - * Copy the frame properties of src to dst, without copying the actual - * image data. - * - * @return 0 on success, a negative number on error. - */ -attribute_deprecated -int avfilter_copy_frame_props(AVFilterBufferRef *dst, const AVFrame *src); - -/** - * Copy the frame properties and data pointers of src to dst, without copying - * the actual data. - * - * @return 0 on success, a negative number on error. - */ -attribute_deprecated -int avfilter_copy_buf_props(AVFrame *dst, const AVFilterBufferRef *src); -#endif - -/** - * @return AVClass for AVFilterContext. - * - * @see av_opt_find(). - */ -const AVClass *avfilter_get_class(void); - -typedef struct AVFilterGraphInternal AVFilterGraphInternal; - -/** - * A function pointer passed to the @ref AVFilterGraph.execute callback to be - * executed multiple times, possibly in parallel. - * - * @param ctx the filter context the job belongs to - * @param arg an opaque parameter passed through from @ref - * AVFilterGraph.execute - * @param jobnr the index of the job being executed - * @param nb_jobs the total number of jobs - * - * @return 0 on success, a negative AVERROR on error - */ -typedef int (avfilter_action_func)(AVFilterContext *ctx, void *arg, int jobnr, int nb_jobs); - -/** - * A function executing multiple jobs, possibly in parallel. - * - * @param ctx the filter context to which the jobs belong - * @param func the function to be called multiple times - * @param arg the argument to be passed to func - * @param ret a nb_jobs-sized array to be filled with return values from each - * invocation of func - * @param nb_jobs the number of jobs to execute - * - * @return 0 on success, a negative AVERROR on error - */ -typedef int (avfilter_execute_func)(AVFilterContext *ctx, avfilter_action_func *func, - void *arg, int *ret, int nb_jobs); - -typedef struct AVFilterGraph { - const AVClass *av_class; -#if FF_API_FOO_COUNT - attribute_deprecated - unsigned filter_count_unused; -#endif - AVFilterContext **filters; -#if !FF_API_FOO_COUNT - unsigned nb_filters; -#endif - - char *scale_sws_opts; ///< sws options to use for the auto-inserted scale filters - char *resample_lavr_opts; ///< libavresample options to use for the auto-inserted resample filters -#if FF_API_FOO_COUNT - unsigned nb_filters; -#endif - - /** - * Type of multithreading allowed for filters in this graph. A combination - * of AVFILTER_THREAD_* flags. - * - * May be set by the caller at any point, the setting will apply to all - * filters initialized after that. The default is allowing everything. - * - * When a filter in this graph is initialized, this field is combined using - * bit AND with AVFilterContext.thread_type to get the final mask used for - * determining allowed threading types. I.e. a threading type needs to be - * set in both to be allowed. - */ - int thread_type; - - /** - * Maximum number of threads used by filters in this graph. May be set by - * the caller before adding any filters to the filtergraph. Zero (the - * default) means that the number of threads is determined automatically. - */ - int nb_threads; - - /** - * Opaque object for libavfilter internal use. - */ - AVFilterGraphInternal *internal; - - /** - * Opaque user data. May be set by the caller to an arbitrary value, e.g. to - * be used from callbacks like @ref AVFilterGraph.execute. - * Libavfilter will not touch this field in any way. - */ - void *opaque; - - /** - * This callback may be set by the caller immediately after allocating the - * graph and before adding any filters to it, to provide a custom - * multithreading implementation. - * - * If set, filters with slice threading capability will call this callback - * to execute multiple jobs in parallel. - * - * If this field is left unset, libavfilter will use its internal - * implementation, which may or may not be multithreaded depending on the - * platform and build options. - */ - avfilter_execute_func *execute; - - char *aresample_swr_opts; ///< swr options to use for the auto-inserted aresample filters, Access ONLY through AVOptions - - /** - * Private fields - * - * The following fields are for internal use only. - * Their type, offset, number and semantic can change without notice. - */ - - AVFilterLink **sink_links; - int sink_links_count; - - unsigned disable_auto_convert; -} AVFilterGraph; - -/** - * Allocate a filter graph. - */ -AVFilterGraph *avfilter_graph_alloc(void); - -/** - * Create a new filter instance in a filter graph. - * - * @param graph graph in which the new filter will be used - * @param filter the filter to create an instance of - * @param name Name to give to the new instance (will be copied to - * AVFilterContext.name). This may be used by the caller to identify - * different filters, libavfilter itself assigns no semantics to - * this parameter. May be NULL. - * - * @return the context of the newly created filter instance (note that it is - * also retrievable directly through AVFilterGraph.filters or with - * avfilter_graph_get_filter()) on success or NULL on failure. - */ -AVFilterContext *avfilter_graph_alloc_filter(AVFilterGraph *graph, - const AVFilter *filter, - const char *name); - -/** - * Get a filter instance identified by instance name from graph. - * - * @param graph filter graph to search through. - * @param name filter instance name (should be unique in the graph). - * @return the pointer to the found filter instance or NULL if it - * cannot be found. - */ -AVFilterContext *avfilter_graph_get_filter(AVFilterGraph *graph, const char *name); - -#if FF_API_AVFILTER_OPEN -/** - * Add an existing filter instance to a filter graph. - * - * @param graphctx the filter graph - * @param filter the filter to be added - * - * @deprecated use avfilter_graph_alloc_filter() to allocate a filter in a - * filter graph - */ -attribute_deprecated -int avfilter_graph_add_filter(AVFilterGraph *graphctx, AVFilterContext *filter); -#endif - -/** - * Create and add a filter instance into an existing graph. - * The filter instance is created from the filter filt and inited - * with the parameters args and opaque. - * - * In case of success put in *filt_ctx the pointer to the created - * filter instance, otherwise set *filt_ctx to NULL. - * - * @param name the instance name to give to the created filter instance - * @param graph_ctx the filter graph - * @return a negative AVERROR error code in case of failure, a non - * negative value otherwise - */ -int avfilter_graph_create_filter(AVFilterContext **filt_ctx, const AVFilter *filt, - const char *name, const char *args, void *opaque, - AVFilterGraph *graph_ctx); - -/** - * Enable or disable automatic format conversion inside the graph. - * - * Note that format conversion can still happen inside explicitly inserted - * scale and aresample filters. - * - * @param flags any of the AVFILTER_AUTO_CONVERT_* constants - */ -void avfilter_graph_set_auto_convert(AVFilterGraph *graph, unsigned flags); - -enum { - AVFILTER_AUTO_CONVERT_ALL = 0, /**< all automatic conversions enabled */ - AVFILTER_AUTO_CONVERT_NONE = -1, /**< all automatic conversions disabled */ -}; - -/** - * Check validity and configure all the links and formats in the graph. - * - * @param graphctx the filter graph - * @param log_ctx context used for logging - * @return >= 0 in case of success, a negative AVERROR code otherwise - */ -int avfilter_graph_config(AVFilterGraph *graphctx, void *log_ctx); - -/** - * Free a graph, destroy its links, and set *graph to NULL. - * If *graph is NULL, do nothing. - */ -void avfilter_graph_free(AVFilterGraph **graph); - -/** - * A linked-list of the inputs/outputs of the filter chain. - * - * This is mainly useful for avfilter_graph_parse() / avfilter_graph_parse2(), - * where it is used to communicate open (unlinked) inputs and outputs from and - * to the caller. - * This struct specifies, per each not connected pad contained in the graph, the - * filter context and the pad index required for establishing a link. - */ -typedef struct AVFilterInOut { - /** unique name for this input/output in the list */ - char *name; - - /** filter context associated to this input/output */ - AVFilterContext *filter_ctx; - - /** index of the filt_ctx pad to use for linking */ - int pad_idx; - - /** next input/input in the list, NULL if this is the last */ - struct AVFilterInOut *next; -} AVFilterInOut; - -/** - * Allocate a single AVFilterInOut entry. - * Must be freed with avfilter_inout_free(). - * @return allocated AVFilterInOut on success, NULL on failure. - */ -AVFilterInOut *avfilter_inout_alloc(void); - -/** - * Free the supplied list of AVFilterInOut and set *inout to NULL. - * If *inout is NULL, do nothing. - */ -void avfilter_inout_free(AVFilterInOut **inout); - -#if AV_HAVE_INCOMPATIBLE_LIBAV_ABI || !FF_API_OLD_GRAPH_PARSE -/** - * Add a graph described by a string to a graph. - * - * @note The caller must provide the lists of inputs and outputs, - * which therefore must be known before calling the function. - * - * @note The inputs parameter describes inputs of the already existing - * part of the graph; i.e. from the point of view of the newly created - * part, they are outputs. Similarly the outputs parameter describes - * outputs of the already existing filters, which are provided as - * inputs to the parsed filters. - * - * @param graph the filter graph where to link the parsed graph context - * @param filters string to be parsed - * @param inputs linked list to the inputs of the graph - * @param outputs linked list to the outputs of the graph - * @return zero on success, a negative AVERROR code on error - */ -int avfilter_graph_parse(AVFilterGraph *graph, const char *filters, - AVFilterInOut *inputs, AVFilterInOut *outputs, - void *log_ctx); -#else -/** - * Add a graph described by a string to a graph. - * - * @param graph the filter graph where to link the parsed graph context - * @param filters string to be parsed - * @param inputs pointer to a linked list to the inputs of the graph, may be NULL. - * If non-NULL, *inputs is updated to contain the list of open inputs - * after the parsing, should be freed with avfilter_inout_free(). - * @param outputs pointer to a linked list to the outputs of the graph, may be NULL. - * If non-NULL, *outputs is updated to contain the list of open outputs - * after the parsing, should be freed with avfilter_inout_free(). - * @return non negative on success, a negative AVERROR code on error - * @deprecated Use avfilter_graph_parse_ptr() instead. - */ -attribute_deprecated -int avfilter_graph_parse(AVFilterGraph *graph, const char *filters, - AVFilterInOut **inputs, AVFilterInOut **outputs, - void *log_ctx); -#endif - -/** - * Add a graph described by a string to a graph. - * - * @param graph the filter graph where to link the parsed graph context - * @param filters string to be parsed - * @param inputs pointer to a linked list to the inputs of the graph, may be NULL. - * If non-NULL, *inputs is updated to contain the list of open inputs - * after the parsing, should be freed with avfilter_inout_free(). - * @param outputs pointer to a linked list to the outputs of the graph, may be NULL. - * If non-NULL, *outputs is updated to contain the list of open outputs - * after the parsing, should be freed with avfilter_inout_free(). - * @return non negative on success, a negative AVERROR code on error - */ -int avfilter_graph_parse_ptr(AVFilterGraph *graph, const char *filters, - AVFilterInOut **inputs, AVFilterInOut **outputs, - void *log_ctx); - -/** - * Add a graph described by a string to a graph. - * - * @param[in] graph the filter graph where to link the parsed graph context - * @param[in] filters string to be parsed - * @param[out] inputs a linked list of all free (unlinked) inputs of the - * parsed graph will be returned here. It is to be freed - * by the caller using avfilter_inout_free(). - * @param[out] outputs a linked list of all free (unlinked) outputs of the - * parsed graph will be returned here. It is to be freed by the - * caller using avfilter_inout_free(). - * @return zero on success, a negative AVERROR code on error - * - * @note This function returns the inputs and outputs that are left - * unlinked after parsing the graph and the caller then deals with - * them. - * @note This function makes no reference whatsoever to already - * existing parts of the graph and the inputs parameter will on return - * contain inputs of the newly parsed part of the graph. Analogously - * the outputs parameter will contain outputs of the newly created - * filters. - */ -int avfilter_graph_parse2(AVFilterGraph *graph, const char *filters, - AVFilterInOut **inputs, - AVFilterInOut **outputs); - -/** - * Send a command to one or more filter instances. - * - * @param graph the filter graph - * @param target the filter(s) to which the command should be sent - * "all" sends to all filters - * otherwise it can be a filter or filter instance name - * which will send the command to all matching filters. - * @param cmd the command to send, for handling simplicity all commands must be alphanumeric only - * @param arg the argument for the command - * @param res a buffer with size res_size where the filter(s) can return a response. - * - * @returns >=0 on success otherwise an error code. - * AVERROR(ENOSYS) on unsupported commands - */ -int avfilter_graph_send_command(AVFilterGraph *graph, const char *target, const char *cmd, const char *arg, char *res, int res_len, int flags); - -/** - * Queue a command for one or more filter instances. - * - * @param graph the filter graph - * @param target the filter(s) to which the command should be sent - * "all" sends to all filters - * otherwise it can be a filter or filter instance name - * which will send the command to all matching filters. - * @param cmd the command to sent, for handling simplicity all commands must be alphanumeric only - * @param arg the argument for the command - * @param ts time at which the command should be sent to the filter - * - * @note As this executes commands after this function returns, no return code - * from the filter is provided, also AVFILTER_CMD_FLAG_ONE is not supported. - */ -int avfilter_graph_queue_command(AVFilterGraph *graph, const char *target, const char *cmd, const char *arg, int flags, double ts); - - -/** - * Dump a graph into a human-readable string representation. - * - * @param graph the graph to dump - * @param options formatting options; currently ignored - * @return a string, or NULL in case of memory allocation failure; - * the string must be freed using av_free - */ -char *avfilter_graph_dump(AVFilterGraph *graph, const char *options); - -/** - * Request a frame on the oldest sink link. - * - * If the request returns AVERROR_EOF, try the next. - * - * Note that this function is not meant to be the sole scheduling mechanism - * of a filtergraph, only a convenience function to help drain a filtergraph - * in a balanced way under normal circumstances. - * - * Also note that AVERROR_EOF does not mean that frames did not arrive on - * some of the sinks during the process. - * When there are multiple sink links, in case the requested link - * returns an EOF, this may cause a filter to flush pending frames - * which are sent to another sink link, although unrequested. - * - * @return the return value of ff_request_frame(), - * or AVERROR_EOF if all links returned AVERROR_EOF - */ -int avfilter_graph_request_oldest(AVFilterGraph *graph); - -/** - * @} - */ - -#endif /* AVFILTER_AVFILTER_H */ diff --git a/dji_sdk_manifold_read_cam/include/libavfilter/avfiltergraph.h b/dji_sdk_manifold_read_cam/include/libavfilter/avfiltergraph.h deleted file mode 100644 index b31d581..0000000 --- a/dji_sdk_manifold_read_cam/include/libavfilter/avfiltergraph.h +++ /dev/null @@ -1,28 +0,0 @@ -/* - * Filter graphs - * copyright (c) 2007 Bobby Bingham - * - * This file is part of FFmpeg. - * - * FFmpeg is free software; you can redistribute it and/or - * modify it under the terms of the GNU Lesser General Public - * License as published by the Free Software Foundation; either - * version 2.1 of the License, or (at your option) any later version. - * - * FFmpeg is distributed in the hope that it will be useful, - * but WITHOUT ANY WARRANTY; without even the implied warranty of - * MERCHANTABILITY or FITNESS FOR A PARTICULAR PURPOSE. See the GNU - * Lesser General Public License for more details. - * - * You should have received a copy of the GNU Lesser General Public - * License along with FFmpeg; if not, write to the Free Software - * Foundation, Inc., 51 Franklin Street, Fifth Floor, Boston, MA 02110-1301 USA - */ - -#ifndef AVFILTER_AVFILTERGRAPH_H -#define AVFILTER_AVFILTERGRAPH_H - -#include "avfilter.h" -#include "libavutil/log.h" - -#endif /* AVFILTER_AVFILTERGRAPH_H */ diff --git a/dji_sdk_manifold_read_cam/include/libavfilter/buffersink.h b/dji_sdk_manifold_read_cam/include/libavfilter/buffersink.h deleted file mode 100644 index 24cd2fe..0000000 --- a/dji_sdk_manifold_read_cam/include/libavfilter/buffersink.h +++ /dev/null @@ -1,204 +0,0 @@ -/* - * This file is part of FFmpeg. - * - * FFmpeg is free software; you can redistribute it and/or - * modify it under the terms of the GNU Lesser General Public - * License as published by the Free Software Foundation; either - * version 2.1 of the License, or (at your option) any later version. - * - * FFmpeg is distributed in the hope that it will be useful, - * but WITHOUT ANY WARRANTY; without even the implied warranty of - * MERCHANTABILITY or FITNESS FOR A PARTICULAR PURPOSE. See the GNU - * Lesser General Public License for more details. - * - * You should have received a copy of the GNU Lesser General Public - * License along with FFmpeg; if not, write to the Free Software - * Foundation, Inc., 51 Franklin Street, Fifth Floor, Boston, MA 02110-1301 USA - */ - -#ifndef AVFILTER_BUFFERSINK_H -#define AVFILTER_BUFFERSINK_H - -/** - * @file - * @ingroup lavfi_buffersink - * memory buffer sink API for audio and video - */ - -#include "avfilter.h" - -/** - * @defgroup lavfi_buffersink Buffer sink API - * @ingroup lavfi - * @{ - */ - -#if FF_API_AVFILTERBUFFER -/** - * Get an audio/video buffer data from buffer_sink and put it in bufref. - * - * This function works with both audio and video buffer sinks. - * - * @param buffer_sink pointer to a buffersink or abuffersink context - * @param flags a combination of AV_BUFFERSINK_FLAG_* flags - * @return >= 0 in case of success, a negative AVERROR code in case of - * failure - */ -attribute_deprecated -int av_buffersink_get_buffer_ref(AVFilterContext *buffer_sink, - AVFilterBufferRef **bufref, int flags); - -/** - * Get the number of immediately available frames. - */ -attribute_deprecated -int av_buffersink_poll_frame(AVFilterContext *ctx); - -/** - * Get a buffer with filtered data from sink and put it in buf. - * - * @param ctx pointer to a context of a buffersink or abuffersink AVFilter. - * @param buf pointer to the buffer will be written here if buf is non-NULL. buf - * must be freed by the caller using avfilter_unref_buffer(). - * Buf may also be NULL to query whether a buffer is ready to be - * output. - * - * @return >= 0 in case of success, a negative AVERROR code in case of - * failure. - */ -attribute_deprecated -int av_buffersink_read(AVFilterContext *ctx, AVFilterBufferRef **buf); - -/** - * Same as av_buffersink_read, but with the ability to specify the number of - * samples read. This function is less efficient than av_buffersink_read(), - * because it copies the data around. - * - * @param ctx pointer to a context of the abuffersink AVFilter. - * @param buf pointer to the buffer will be written here if buf is non-NULL. buf - * must be freed by the caller using avfilter_unref_buffer(). buf - * will contain exactly nb_samples audio samples, except at the end - * of stream, when it can contain less than nb_samples. - * Buf may also be NULL to query whether a buffer is ready to be - * output. - * - * @warning do not mix this function with av_buffersink_read(). Use only one or - * the other with a single sink, not both. - */ -attribute_deprecated -int av_buffersink_read_samples(AVFilterContext *ctx, AVFilterBufferRef **buf, - int nb_samples); -#endif - -/** - * Get a frame with filtered data from sink and put it in frame. - * - * @param ctx pointer to a buffersink or abuffersink filter context. - * @param frame pointer to an allocated frame that will be filled with data. - * The data must be freed using av_frame_unref() / av_frame_free() - * @param flags a combination of AV_BUFFERSINK_FLAG_* flags - * - * @return >= 0 in for success, a negative AVERROR code for failure. - */ -int av_buffersink_get_frame_flags(AVFilterContext *ctx, AVFrame *frame, int flags); - -/** - * Tell av_buffersink_get_buffer_ref() to read video/samples buffer - * reference, but not remove it from the buffer. This is useful if you - * need only to read a video/samples buffer, without to fetch it. - */ -#define AV_BUFFERSINK_FLAG_PEEK 1 - -/** - * Tell av_buffersink_get_buffer_ref() not to request a frame from its input. - * If a frame is already buffered, it is read (and removed from the buffer), - * but if no frame is present, return AVERROR(EAGAIN). - */ -#define AV_BUFFERSINK_FLAG_NO_REQUEST 2 - -/** - * Struct to use for initializing a buffersink context. - */ -typedef struct { - const enum AVPixelFormat *pixel_fmts; ///< list of allowed pixel formats, terminated by AV_PIX_FMT_NONE -} AVBufferSinkParams; - -/** - * Create an AVBufferSinkParams structure. - * - * Must be freed with av_free(). - */ -AVBufferSinkParams *av_buffersink_params_alloc(void); - -/** - * Struct to use for initializing an abuffersink context. - */ -typedef struct { - const enum AVSampleFormat *sample_fmts; ///< list of allowed sample formats, terminated by AV_SAMPLE_FMT_NONE - const int64_t *channel_layouts; ///< list of allowed channel layouts, terminated by -1 - const int *channel_counts; ///< list of allowed channel counts, terminated by -1 - int all_channel_counts; ///< if not 0, accept any channel count or layout - int *sample_rates; ///< list of allowed sample rates, terminated by -1 -} AVABufferSinkParams; - -/** - * Create an AVABufferSinkParams structure. - * - * Must be freed with av_free(). - */ -AVABufferSinkParams *av_abuffersink_params_alloc(void); - -/** - * Set the frame size for an audio buffer sink. - * - * All calls to av_buffersink_get_buffer_ref will return a buffer with - * exactly the specified number of samples, or AVERROR(EAGAIN) if there is - * not enough. The last buffer at EOF will be padded with 0. - */ -void av_buffersink_set_frame_size(AVFilterContext *ctx, unsigned frame_size); - -/** - * Get the frame rate of the input. - */ -AVRational av_buffersink_get_frame_rate(AVFilterContext *ctx); - -/** - * Get a frame with filtered data from sink and put it in frame. - * - * @param ctx pointer to a context of a buffersink or abuffersink AVFilter. - * @param frame pointer to an allocated frame that will be filled with data. - * The data must be freed using av_frame_unref() / av_frame_free() - * - * @return - * - >= 0 if a frame was successfully returned. - * - AVERROR(EAGAIN) if no frames are available at this point; more - * input frames must be added to the filtergraph to get more output. - * - AVERROR_EOF if there will be no more output frames on this sink. - * - A different negative AVERROR code in other failure cases. - */ -int av_buffersink_get_frame(AVFilterContext *ctx, AVFrame *frame); - -/** - * Same as av_buffersink_get_frame(), but with the ability to specify the number - * of samples read. This function is less efficient than - * av_buffersink_get_frame(), because it copies the data around. - * - * @param ctx pointer to a context of the abuffersink AVFilter. - * @param frame pointer to an allocated frame that will be filled with data. - * The data must be freed using av_frame_unref() / av_frame_free() - * frame will contain exactly nb_samples audio samples, except at - * the end of stream, when it can contain less than nb_samples. - * - * @return The return codes have the same meaning as for - * av_buffersink_get_samples(). - * - * @warning do not mix this function with av_buffersink_get_frame(). Use only one or - * the other with a single sink, not both. - */ -int av_buffersink_get_samples(AVFilterContext *ctx, AVFrame *frame, int nb_samples); - -/** - * @} - */ - -#endif /* AVFILTER_BUFFERSINK_H */ diff --git a/dji_sdk_manifold_read_cam/include/libavfilter/buffersrc.h b/dji_sdk_manifold_read_cam/include/libavfilter/buffersrc.h deleted file mode 100644 index 5d12433..0000000 --- a/dji_sdk_manifold_read_cam/include/libavfilter/buffersrc.h +++ /dev/null @@ -1,160 +0,0 @@ -/* - * - * This file is part of FFmpeg. - * - * FFmpeg is free software; you can redistribute it and/or - * modify it under the terms of the GNU Lesser General Public - * License as published by the Free Software Foundation; either - * version 2.1 of the License, or (at your option) any later version. - * - * FFmpeg is distributed in the hope that it will be useful, - * but WITHOUT ANY WARRANTY; without even the implied warranty of - * MERCHANTABILITY or FITNESS FOR A PARTICULAR PURPOSE. See the GNU - * Lesser General Public License for more details. - * - * You should have received a copy of the GNU Lesser General Public - * License along with FFmpeg; if not, write to the Free Software - * Foundation, Inc., 51 Franklin Street, Fifth Floor, Boston, MA 02110-1301 USA - */ - -#ifndef AVFILTER_BUFFERSRC_H -#define AVFILTER_BUFFERSRC_H - -/** - * @file - * @ingroup lavfi_buffersrc - * Memory buffer source API. - */ - -#include "libavcodec/avcodec.h" -#include "avfilter.h" - -/** - * @defgroup lavfi_buffersrc Buffer source API - * @ingroup lavfi - * @{ - */ - -enum { - - /** - * Do not check for format changes. - */ - AV_BUFFERSRC_FLAG_NO_CHECK_FORMAT = 1, - -#if FF_API_AVFILTERBUFFER - /** - * Ignored - */ - AV_BUFFERSRC_FLAG_NO_COPY = 2, -#endif - - /** - * Immediately push the frame to the output. - */ - AV_BUFFERSRC_FLAG_PUSH = 4, - - /** - * Keep a reference to the frame. - * If the frame if reference-counted, create a new reference; otherwise - * copy the frame data. - */ - AV_BUFFERSRC_FLAG_KEEP_REF = 8, - -}; - -/** - * Add buffer data in picref to buffer_src. - * - * @param buffer_src pointer to a buffer source context - * @param picref a buffer reference, or NULL to mark EOF - * @param flags a combination of AV_BUFFERSRC_FLAG_* - * @return >= 0 in case of success, a negative AVERROR code - * in case of failure - */ -int av_buffersrc_add_ref(AVFilterContext *buffer_src, - AVFilterBufferRef *picref, int flags); - -/** - * Get the number of failed requests. - * - * A failed request is when the request_frame method is called while no - * frame is present in the buffer. - * The number is reset when a frame is added. - */ -unsigned av_buffersrc_get_nb_failed_requests(AVFilterContext *buffer_src); - -#if FF_API_AVFILTERBUFFER -/** - * Add a buffer to a filtergraph. - * - * @param ctx an instance of the buffersrc filter - * @param buf buffer containing frame data to be passed down the filtergraph. - * This function will take ownership of buf, the user must not free it. - * A NULL buf signals EOF -- i.e. no more frames will be sent to this filter. - * - * @deprecated use av_buffersrc_write_frame() or av_buffersrc_add_frame() - */ -attribute_deprecated -int av_buffersrc_buffer(AVFilterContext *ctx, AVFilterBufferRef *buf); -#endif - -/** - * Add a frame to the buffer source. - * - * @param ctx an instance of the buffersrc filter - * @param frame frame to be added. If the frame is reference counted, this - * function will make a new reference to it. Otherwise the frame data will be - * copied. - * - * @return 0 on success, a negative AVERROR on error - * - * This function is equivalent to av_buffersrc_add_frame_flags() with the - * AV_BUFFERSRC_FLAG_KEEP_REF flag. - */ -int av_buffersrc_write_frame(AVFilterContext *ctx, const AVFrame *frame); - -/** - * Add a frame to the buffer source. - * - * @param ctx an instance of the buffersrc filter - * @param frame frame to be added. If the frame is reference counted, this - * function will take ownership of the reference(s) and reset the frame. - * Otherwise the frame data will be copied. If this function returns an error, - * the input frame is not touched. - * - * @return 0 on success, a negative AVERROR on error. - * - * @note the difference between this function and av_buffersrc_write_frame() is - * that av_buffersrc_write_frame() creates a new reference to the input frame, - * while this function takes ownership of the reference passed to it. - * - * This function is equivalent to av_buffersrc_add_frame_flags() without the - * AV_BUFFERSRC_FLAG_KEEP_REF flag. - */ -int av_buffersrc_add_frame(AVFilterContext *ctx, AVFrame *frame); - -/** - * Add a frame to the buffer source. - * - * By default, if the frame is reference-counted, this function will take - * ownership of the reference(s) and reset the frame. This can be controled - * using the flags. - * - * If this function returns an error, the input frame is not touched. - * - * @param buffer_src pointer to a buffer source context - * @param frame a frame, or NULL to mark EOF - * @param flags a combination of AV_BUFFERSRC_FLAG_* - * @return >= 0 in case of success, a negative AVERROR code - * in case of failure - */ -int av_buffersrc_add_frame_flags(AVFilterContext *buffer_src, - AVFrame *frame, int flags); - - -/** - * @} - */ - -#endif /* AVFILTER_BUFFERSRC_H */ diff --git a/dji_sdk_manifold_read_cam/include/libavfilter/version.h b/dji_sdk_manifold_read_cam/include/libavfilter/version.h deleted file mode 100644 index 7a6321e..0000000 --- a/dji_sdk_manifold_read_cam/include/libavfilter/version.h +++ /dev/null @@ -1,95 +0,0 @@ -/* - * Version macros. - * - * This file is part of FFmpeg. - * - * FFmpeg is free software; you can redistribute it and/or - * modify it under the terms of the GNU Lesser General Public - * License as published by the Free Software Foundation; either - * version 2.1 of the License, or (at your option) any later version. - * - * FFmpeg is distributed in the hope that it will be useful, - * but WITHOUT ANY WARRANTY; without even the implied warranty of - * MERCHANTABILITY or FITNESS FOR A PARTICULAR PURPOSE. See the GNU - * Lesser General Public License for more details. - * - * You should have received a copy of the GNU Lesser General Public - * License along with FFmpeg; if not, write to the Free Software - * Foundation, Inc., 51 Franklin Street, Fifth Floor, Boston, MA 02110-1301 USA - */ - -#ifndef AVFILTER_VERSION_H -#define AVFILTER_VERSION_H - -/** - * @file - * @ingroup lavfi - * Libavfilter version macros - */ - -#include "libavutil/version.h" - -#define LIBAVFILTER_VERSION_MAJOR 4 -#define LIBAVFILTER_VERSION_MINOR 5 -#define LIBAVFILTER_VERSION_MICRO 100 - -#define LIBAVFILTER_VERSION_INT AV_VERSION_INT(LIBAVFILTER_VERSION_MAJOR, \ - LIBAVFILTER_VERSION_MINOR, \ - LIBAVFILTER_VERSION_MICRO) -#define LIBAVFILTER_VERSION AV_VERSION(LIBAVFILTER_VERSION_MAJOR, \ - LIBAVFILTER_VERSION_MINOR, \ - LIBAVFILTER_VERSION_MICRO) -#define LIBAVFILTER_BUILD LIBAVFILTER_VERSION_INT - -#define LIBAVFILTER_IDENT "Lavfi" AV_STRINGIFY(LIBAVFILTER_VERSION) - -/** - * FF_API_* defines may be placed below to indicate public API that will be - * dropped at a future version bump. The defines themselves are not part of - * the public API and may change, break or disappear at any time. - */ - -#ifndef FF_API_AVFILTERPAD_PUBLIC -#define FF_API_AVFILTERPAD_PUBLIC (LIBAVFILTER_VERSION_MAJOR < 5) -#endif -#ifndef FF_API_FOO_COUNT -#define FF_API_FOO_COUNT (LIBAVFILTER_VERSION_MAJOR < 5) -#endif -#ifndef FF_API_FILL_FRAME -#define FF_API_FILL_FRAME (LIBAVFILTER_VERSION_MAJOR < 5) -#endif -#ifndef FF_API_BUFFERSRC_BUFFER -#define FF_API_BUFFERSRC_BUFFER (LIBAVFILTER_VERSION_MAJOR < 5) -#endif -#ifndef FF_API_AVFILTERBUFFER -#define FF_API_AVFILTERBUFFER (LIBAVFILTER_VERSION_MAJOR < 5) -#endif -#ifndef FF_API_OLD_FILTER_OPTS -#define FF_API_OLD_FILTER_OPTS (LIBAVFILTER_VERSION_MAJOR < 5) -#endif -#ifndef FF_API_ACONVERT_FILTER -#define FF_API_ACONVERT_FILTER (LIBAVFILTER_VERSION_MAJOR < 5) -#endif -#ifndef FF_API_AVFILTER_OPEN -#define FF_API_AVFILTER_OPEN (LIBAVFILTER_VERSION_MAJOR < 5) -#endif -#ifndef FF_API_AVFILTER_INIT_FILTER -#define FF_API_AVFILTER_INIT_FILTER (LIBAVFILTER_VERSION_MAJOR < 5) -#endif -#ifndef FF_API_OLD_FILTER_REGISTER -#define FF_API_OLD_FILTER_REGISTER (LIBAVFILTER_VERSION_MAJOR < 5) -#endif -#ifndef FF_API_OLD_GRAPH_PARSE -#define FF_API_OLD_GRAPH_PARSE (LIBAVFILTER_VERSION_MAJOR < 5) -#endif -#ifndef FF_API_DRAWTEXT_OLD_TIMELINE -#define FF_API_DRAWTEXT_OLD_TIMELINE (LIBAVFILTER_VERSION_MAJOR < 5) -#endif -#ifndef FF_API_NOCONST_GET_NAME -#define FF_API_NOCONST_GET_NAME (LIBAVFILTER_VERSION_MAJOR < 5) -#endif -#ifndef FF_API_INTERLACE_LOWPASS_SET -#define FF_API_INTERLACE_LOWPASS_SET (LIBAVFILTER_VERSION_MAJOR < 5) -#endif - -#endif /* AVFILTER_VERSION_H */ diff --git a/dji_sdk_manifold_read_cam/include/libavformat/avformat.h b/dji_sdk_manifold_read_cam/include/libavformat/avformat.h deleted file mode 100644 index 7d2db6a..0000000 --- a/dji_sdk_manifold_read_cam/include/libavformat/avformat.h +++ /dev/null @@ -1,2603 +0,0 @@ -/* - * copyright (c) 2001 Fabrice Bellard - * - * This file is part of FFmpeg. - * - * FFmpeg is free software; you can redistribute it and/or - * modify it under the terms of the GNU Lesser General Public - * License as published by the Free Software Foundation; either - * version 2.1 of the License, or (at your option) any later version. - * - * FFmpeg is distributed in the hope that it will be useful, - * but WITHOUT ANY WARRANTY; without even the implied warranty of - * MERCHANTABILITY or FITNESS FOR A PARTICULAR PURPOSE. See the GNU - * Lesser General Public License for more details. - * - * You should have received a copy of the GNU Lesser General Public - * License along with FFmpeg; if not, write to the Free Software - * Foundation, Inc., 51 Franklin Street, Fifth Floor, Boston, MA 02110-1301 USA - */ - -#ifndef AVFORMAT_AVFORMAT_H -#define AVFORMAT_AVFORMAT_H - -/** - * @file - * @ingroup libavf - * Main libavformat public API header - */ - -/** - * @defgroup libavf I/O and Muxing/Demuxing Library - * @{ - * - * Libavformat (lavf) is a library for dealing with various media container - * formats. Its main two purposes are demuxing - i.e. splitting a media file - * into component streams, and the reverse process of muxing - writing supplied - * data in a specified container format. It also has an @ref lavf_io - * "I/O module" which supports a number of protocols for accessing the data (e.g. - * file, tcp, http and others). Before using lavf, you need to call - * av_register_all() to register all compiled muxers, demuxers and protocols. - * Unless you are absolutely sure you won't use libavformat's network - * capabilities, you should also call avformat_network_init(). - * - * A supported input format is described by an AVInputFormat struct, conversely - * an output format is described by AVOutputFormat. You can iterate over all - * registered input/output formats using the av_iformat_next() / - * av_oformat_next() functions. The protocols layer is not part of the public - * API, so you can only get the names of supported protocols with the - * avio_enum_protocols() function. - * - * Main lavf structure used for both muxing and demuxing is AVFormatContext, - * which exports all information about the file being read or written. As with - * most Libavformat structures, its size is not part of public ABI, so it cannot be - * allocated on stack or directly with av_malloc(). To create an - * AVFormatContext, use avformat_alloc_context() (some functions, like - * avformat_open_input() might do that for you). - * - * Most importantly an AVFormatContext contains: - * @li the @ref AVFormatContext.iformat "input" or @ref AVFormatContext.oformat - * "output" format. It is either autodetected or set by user for input; - * always set by user for output. - * @li an @ref AVFormatContext.streams "array" of AVStreams, which describe all - * elementary streams stored in the file. AVStreams are typically referred to - * using their index in this array. - * @li an @ref AVFormatContext.pb "I/O context". It is either opened by lavf or - * set by user for input, always set by user for output (unless you are dealing - * with an AVFMT_NOFILE format). - * - * @section lavf_options Passing options to (de)muxers - * Lavf allows to configure muxers and demuxers using the @ref avoptions - * mechanism. Generic (format-independent) libavformat options are provided by - * AVFormatContext, they can be examined from a user program by calling - * av_opt_next() / av_opt_find() on an allocated AVFormatContext (or its AVClass - * from avformat_get_class()). Private (format-specific) options are provided by - * AVFormatContext.priv_data if and only if AVInputFormat.priv_class / - * AVOutputFormat.priv_class of the corresponding format struct is non-NULL. - * Further options may be provided by the @ref AVFormatContext.pb "I/O context", - * if its AVClass is non-NULL, and the protocols layer. See the discussion on - * nesting in @ref avoptions documentation to learn how to access those. - * - * @defgroup lavf_decoding Demuxing - * @{ - * Demuxers read a media file and split it into chunks of data (@em packets). A - * @ref AVPacket "packet" contains one or more encoded frames which belongs to a - * single elementary stream. In the lavf API this process is represented by the - * avformat_open_input() function for opening a file, av_read_frame() for - * reading a single packet and finally avformat_close_input(), which does the - * cleanup. - * - * @section lavf_decoding_open Opening a media file - * The minimum information required to open a file is its URL or filename, which - * is passed to avformat_open_input(), as in the following code: - * @code - * const char *url = "in.mp3"; - * AVFormatContext *s = NULL; - * int ret = avformat_open_input(&s, url, NULL, NULL); - * if (ret < 0) - * abort(); - * @endcode - * The above code attempts to allocate an AVFormatContext, open the - * specified file (autodetecting the format) and read the header, exporting the - * information stored there into s. Some formats do not have a header or do not - * store enough information there, so it is recommended that you call the - * avformat_find_stream_info() function which tries to read and decode a few - * frames to find missing information. - * - * In some cases you might want to preallocate an AVFormatContext yourself with - * avformat_alloc_context() and do some tweaking on it before passing it to - * avformat_open_input(). One such case is when you want to use custom functions - * for reading input data instead of lavf internal I/O layer. - * To do that, create your own AVIOContext with avio_alloc_context(), passing - * your reading callbacks to it. Then set the @em pb field of your - * AVFormatContext to newly created AVIOContext. - * - * Since the format of the opened file is in general not known until after - * avformat_open_input() has returned, it is not possible to set demuxer private - * options on a preallocated context. Instead, the options should be passed to - * avformat_open_input() wrapped in an AVDictionary: - * @code - * AVDictionary *options = NULL; - * av_dict_set(&options, "video_size", "640x480", 0); - * av_dict_set(&options, "pixel_format", "rgb24", 0); - * - * if (avformat_open_input(&s, url, NULL, &options) < 0) - * abort(); - * av_dict_free(&options); - * @endcode - * This code passes the private options 'video_size' and 'pixel_format' to the - * demuxer. They would be necessary for e.g. the rawvideo demuxer, since it - * cannot know how to interpret raw video data otherwise. If the format turns - * out to be something different than raw video, those options will not be - * recognized by the demuxer and therefore will not be applied. Such unrecognized - * options are then returned in the options dictionary (recognized options are - * consumed). The calling program can handle such unrecognized options as it - * wishes, e.g. - * @code - * AVDictionaryEntry *e; - * if (e = av_dict_get(options, "", NULL, AV_DICT_IGNORE_SUFFIX)) { - * fprintf(stderr, "Option %s not recognized by the demuxer.\n", e->key); - * abort(); - * } - * @endcode - * - * After you have finished reading the file, you must close it with - * avformat_close_input(). It will free everything associated with the file. - * - * @section lavf_decoding_read Reading from an opened file - * Reading data from an opened AVFormatContext is done by repeatedly calling - * av_read_frame() on it. Each call, if successful, will return an AVPacket - * containing encoded data for one AVStream, identified by - * AVPacket.stream_index. This packet may be passed straight into the libavcodec - * decoding functions avcodec_decode_video2(), avcodec_decode_audio4() or - * avcodec_decode_subtitle2() if the caller wishes to decode the data. - * - * AVPacket.pts, AVPacket.dts and AVPacket.duration timing information will be - * set if known. They may also be unset (i.e. AV_NOPTS_VALUE for - * pts/dts, 0 for duration) if the stream does not provide them. The timing - * information will be in AVStream.time_base units, i.e. it has to be - * multiplied by the timebase to convert them to seconds. - * - * If AVPacket.buf is set on the returned packet, then the packet is - * allocated dynamically and the user may keep it indefinitely. - * Otherwise, if AVPacket.buf is NULL, the packet data is backed by a - * static storage somewhere inside the demuxer and the packet is only valid - * until the next av_read_frame() call or closing the file. If the caller - * requires a longer lifetime, av_dup_packet() will make an av_malloc()ed copy - * of it. - * In both cases, the packet must be freed with av_free_packet() when it is no - * longer needed. - * - * @section lavf_decoding_seek Seeking - * @} - * - * @defgroup lavf_encoding Muxing - * @{ - * Muxers take encoded data in the form of @ref AVPacket "AVPackets" and write - * it into files or other output bytestreams in the specified container format. - * - * The main API functions for muxing are avformat_write_header() for writing the - * file header, av_write_frame() / av_interleaved_write_frame() for writing the - * packets and av_write_trailer() for finalizing the file. - * - * At the beginning of the muxing process, the caller must first call - * avformat_alloc_context() to create a muxing context. The caller then sets up - * the muxer by filling the various fields in this context: - * - * - The @ref AVFormatContext.oformat "oformat" field must be set to select the - * muxer that will be used. - * - Unless the format is of the AVFMT_NOFILE type, the @ref AVFormatContext.pb - * "pb" field must be set to an opened IO context, either returned from - * avio_open2() or a custom one. - * - Unless the format is of the AVFMT_NOSTREAMS type, at least one stream must - * be created with the avformat_new_stream() function. The caller should fill - * the @ref AVStream.codec "stream codec context" information, such as the - * codec @ref AVCodecContext.codec_type "type", @ref AVCodecContext.codec_id - * "id" and other parameters (e.g. width / height, the pixel or sample format, - * etc.) as known. The @ref AVCodecContext.time_base "codec timebase" should - * be set to the timebase that the caller desires to use for this stream (note - * that the timebase actually used by the muxer can be different, as will be - * described later). - * - The caller may fill in additional information, such as @ref - * AVFormatContext.metadata "global" or @ref AVStream.metadata "per-stream" - * metadata, @ref AVFormatContext.chapters "chapters", @ref - * AVFormatContext.programs "programs", etc. as described in the - * AVFormatContext documentation. Whether such information will actually be - * stored in the output depends on what the container format and the muxer - * support. - * - * When the muxing context is fully set up, the caller must call - * avformat_write_header() to initialize the muxer internals and write the file - * header. Whether anything actually is written to the IO context at this step - * depends on the muxer, but this function must always be called. Any muxer - * private options must be passed in the options parameter to this function. - * - * The data is then sent to the muxer by repeatedly calling av_write_frame() or - * av_interleaved_write_frame() (consult those functions' documentation for - * discussion on the difference between them; only one of them may be used with - * a single muxing context, they should not be mixed). Do note that the timing - * information on the packets sent to the muxer must be in the corresponding - * AVStream's timebase. That timebase is set by the muxer (in the - * avformat_write_header() step) and may be different from the timebase the - * caller set on the codec context. - * - * Once all the data has been written, the caller must call av_write_trailer() - * to flush any buffered packets and finalize the output file, then close the IO - * context (if any) and finally free the muxing context with - * avformat_free_context(). - * @} - * - * @defgroup lavf_io I/O Read/Write - * @{ - * @} - * - * @defgroup lavf_codec Demuxers - * @{ - * @defgroup lavf_codec_native Native Demuxers - * @{ - * @} - * @defgroup lavf_codec_wrappers External library wrappers - * @{ - * @} - * @} - * @defgroup lavf_protos I/O Protocols - * @{ - * @} - * @defgroup lavf_internal Internal - * @{ - * @} - * @} - * - */ - -#include -#include /* FILE */ -#include "libavcodec/avcodec.h" -#include "libavutil/dict.h" -#include "libavutil/log.h" - -#include "avio.h" -#include "libavformat/version.h" - -struct AVFormatContext; - -struct AVDeviceInfoList; -struct AVDeviceCapabilitiesQuery; - -/** - * @defgroup metadata_api Public Metadata API - * @{ - * @ingroup libavf - * The metadata API allows libavformat to export metadata tags to a client - * application when demuxing. Conversely it allows a client application to - * set metadata when muxing. - * - * Metadata is exported or set as pairs of key/value strings in the 'metadata' - * fields of the AVFormatContext, AVStream, AVChapter and AVProgram structs - * using the @ref lavu_dict "AVDictionary" API. Like all strings in FFmpeg, - * metadata is assumed to be UTF-8 encoded Unicode. Note that metadata - * exported by demuxers isn't checked to be valid UTF-8 in most cases. - * - * Important concepts to keep in mind: - * - Keys are unique; there can never be 2 tags with the same key. This is - * also meant semantically, i.e., a demuxer should not knowingly produce - * several keys that are literally different but semantically identical. - * E.g., key=Author5, key=Author6. In this example, all authors must be - * placed in the same tag. - * - Metadata is flat, not hierarchical; there are no subtags. If you - * want to store, e.g., the email address of the child of producer Alice - * and actor Bob, that could have key=alice_and_bobs_childs_email_address. - * - Several modifiers can be applied to the tag name. This is done by - * appending a dash character ('-') and the modifier name in the order - * they appear in the list below -- e.g. foo-eng-sort, not foo-sort-eng. - * - language -- a tag whose value is localized for a particular language - * is appended with the ISO 639-2/B 3-letter language code. - * For example: Author-ger=Michael, Author-eng=Mike - * The original/default language is in the unqualified "Author" tag. - * A demuxer should set a default if it sets any translated tag. - * - sorting -- a modified version of a tag that should be used for - * sorting will have '-sort' appended. E.g. artist="The Beatles", - * artist-sort="Beatles, The". - * - * - Demuxers attempt to export metadata in a generic format, however tags - * with no generic equivalents are left as they are stored in the container. - * Follows a list of generic tag names: - * - @verbatim - album -- name of the set this work belongs to - album_artist -- main creator of the set/album, if different from artist. - e.g. "Various Artists" for compilation albums. - artist -- main creator of the work - comment -- any additional description of the file. - composer -- who composed the work, if different from artist. - copyright -- name of copyright holder. - creation_time-- date when the file was created, preferably in ISO 8601. - date -- date when the work was created, preferably in ISO 8601. - disc -- number of a subset, e.g. disc in a multi-disc collection. - encoder -- name/settings of the software/hardware that produced the file. - encoded_by -- person/group who created the file. - filename -- original name of the file. - genre -- . - language -- main language in which the work is performed, preferably - in ISO 639-2 format. Multiple languages can be specified by - separating them with commas. - performer -- artist who performed the work, if different from artist. - E.g for "Also sprach Zarathustra", artist would be "Richard - Strauss" and performer "London Philharmonic Orchestra". - publisher -- name of the label/publisher. - service_name -- name of the service in broadcasting (channel name). - service_provider -- name of the service provider in broadcasting. - title -- name of the work. - track -- number of this work in the set, can be in form current/total. - variant_bitrate -- the total bitrate of the bitrate variant that the current stream is part of - @endverbatim - * - * Look in the examples section for an application example how to use the Metadata API. - * - * @} - */ - -/* packet functions */ - - -/** - * Allocate and read the payload of a packet and initialize its - * fields with default values. - * - * @param s associated IO context - * @param pkt packet - * @param size desired payload size - * @return >0 (read size) if OK, AVERROR_xxx otherwise - */ -int av_get_packet(AVIOContext *s, AVPacket *pkt, int size); - - -/** - * Read data and append it to the current content of the AVPacket. - * If pkt->size is 0 this is identical to av_get_packet. - * Note that this uses av_grow_packet and thus involves a realloc - * which is inefficient. Thus this function should only be used - * when there is no reasonable way to know (an upper bound of) - * the final size. - * - * @param s associated IO context - * @param pkt packet - * @param size amount of data to read - * @return >0 (read size) if OK, AVERROR_xxx otherwise, previous data - * will not be lost even if an error occurs. - */ -int av_append_packet(AVIOContext *s, AVPacket *pkt, int size); - -/*************************************************/ -/* fractional numbers for exact pts handling */ - -/** - * The exact value of the fractional number is: 'val + num / den'. - * num is assumed to be 0 <= num < den. - */ -typedef struct AVFrac { - int64_t val, num, den; -} AVFrac; - -/*************************************************/ -/* input/output formats */ - -struct AVCodecTag; - -/** - * This structure contains the data a format has to probe a file. - */ -typedef struct AVProbeData { - const char *filename; - unsigned char *buf; /**< Buffer must have AVPROBE_PADDING_SIZE of extra allocated bytes filled with zero. */ - int buf_size; /**< Size of buf except extra allocated bytes */ -} AVProbeData; - -#define AVPROBE_SCORE_RETRY (AVPROBE_SCORE_MAX/4) -#define AVPROBE_SCORE_STREAM_RETRY (AVPROBE_SCORE_MAX/4-1) - -#define AVPROBE_SCORE_EXTENSION 50 ///< score for file extension -#define AVPROBE_SCORE_MAX 100 ///< maximum score - -#define AVPROBE_PADDING_SIZE 32 ///< extra allocated bytes at the end of the probe buffer - -/// Demuxer will use avio_open, no opened file should be provided by the caller. -#define AVFMT_NOFILE 0x0001 -#define AVFMT_NEEDNUMBER 0x0002 /**< Needs '%d' in filename. */ -#define AVFMT_SHOW_IDS 0x0008 /**< Show format stream IDs numbers. */ -#define AVFMT_RAWPICTURE 0x0020 /**< Format wants AVPicture structure for - raw picture data. */ -#define AVFMT_GLOBALHEADER 0x0040 /**< Format wants global header. */ -#define AVFMT_NOTIMESTAMPS 0x0080 /**< Format does not need / have any timestamps. */ -#define AVFMT_GENERIC_INDEX 0x0100 /**< Use generic index building code. */ -#define AVFMT_TS_DISCONT 0x0200 /**< Format allows timestamp discontinuities. Note, muxers always require valid (monotone) timestamps */ -#define AVFMT_VARIABLE_FPS 0x0400 /**< Format allows variable fps. */ -#define AVFMT_NODIMENSIONS 0x0800 /**< Format does not need width/height */ -#define AVFMT_NOSTREAMS 0x1000 /**< Format does not require any streams */ -#define AVFMT_NOBINSEARCH 0x2000 /**< Format does not allow to fall back on binary search via read_timestamp */ -#define AVFMT_NOGENSEARCH 0x4000 /**< Format does not allow to fall back on generic search */ -#define AVFMT_NO_BYTE_SEEK 0x8000 /**< Format does not allow seeking by bytes */ -#define AVFMT_ALLOW_FLUSH 0x10000 /**< Format allows flushing. If not set, the muxer will not receive a NULL packet in the write_packet function. */ -#if LIBAVFORMAT_VERSION_MAJOR <= 54 -#define AVFMT_TS_NONSTRICT 0x8020000 //we try to be compatible to the ABIs of ffmpeg and major forks -#else -#define AVFMT_TS_NONSTRICT 0x20000 -#endif - /**< Format does not require strictly - increasing timestamps, but they must - still be monotonic */ -#define AVFMT_TS_NEGATIVE 0x40000 /**< Format allows muxing negative - timestamps. If not set the timestamp - will be shifted in av_write_frame and - av_interleaved_write_frame so they - start from 0. - The user or muxer can override this through - AVFormatContext.avoid_negative_ts - */ - -#define AVFMT_SEEK_TO_PTS 0x4000000 /**< Seeking is based on PTS */ - -/** - * @addtogroup lavf_encoding - * @{ - */ -typedef struct AVOutputFormat { - const char *name; - /** - * Descriptive name for the format, meant to be more human-readable - * than name. You should use the NULL_IF_CONFIG_SMALL() macro - * to define it. - */ - const char *long_name; - const char *mime_type; - const char *extensions; /**< comma-separated filename extensions */ - /* output support */ - enum AVCodecID audio_codec; /**< default audio codec */ - enum AVCodecID video_codec; /**< default video codec */ - enum AVCodecID subtitle_codec; /**< default subtitle codec */ - /** - * can use flags: AVFMT_NOFILE, AVFMT_NEEDNUMBER, AVFMT_RAWPICTURE, - * AVFMT_GLOBALHEADER, AVFMT_NOTIMESTAMPS, AVFMT_VARIABLE_FPS, - * AVFMT_NODIMENSIONS, AVFMT_NOSTREAMS, AVFMT_ALLOW_FLUSH, - * AVFMT_TS_NONSTRICT - */ - int flags; - - /** - * List of supported codec_id-codec_tag pairs, ordered by "better - * choice first". The arrays are all terminated by AV_CODEC_ID_NONE. - */ - const struct AVCodecTag * const *codec_tag; - - - const AVClass *priv_class; ///< AVClass for the private context - - /***************************************************************** - * No fields below this line are part of the public API. They - * may not be used outside of libavformat and can be changed and - * removed at will. - * New public fields should be added right above. - ***************************************************************** - */ - struct AVOutputFormat *next; - /** - * size of private data so that it can be allocated in the wrapper - */ - int priv_data_size; - - int (*write_header)(struct AVFormatContext *); - /** - * Write a packet. If AVFMT_ALLOW_FLUSH is set in flags, - * pkt can be NULL in order to flush data buffered in the muxer. - * When flushing, return 0 if there still is more data to flush, - * or 1 if everything was flushed and there is no more buffered - * data. - */ - int (*write_packet)(struct AVFormatContext *, AVPacket *pkt); - int (*write_trailer)(struct AVFormatContext *); - /** - * Currently only used to set pixel format if not YUV420P. - */ - int (*interleave_packet)(struct AVFormatContext *, AVPacket *out, - AVPacket *in, int flush); - /** - * Test if the given codec can be stored in this container. - * - * @return 1 if the codec is supported, 0 if it is not. - * A negative number if unknown. - * MKTAG('A', 'P', 'I', 'C') if the codec is only supported as AV_DISPOSITION_ATTACHED_PIC - */ - int (*query_codec)(enum AVCodecID id, int std_compliance); - - void (*get_output_timestamp)(struct AVFormatContext *s, int stream, - int64_t *dts, int64_t *wall); - /** - * Allows sending messages from application to device. - */ - int (*control_message)(struct AVFormatContext *s, int type, - void *data, size_t data_size); - - /** - * Write an uncoded AVFrame. - * - * See av_write_uncoded_frame() for details. - * - * The library will free *frame afterwards, but the muxer can prevent it - * by setting the pointer to NULL. - */ - int (*write_uncoded_frame)(struct AVFormatContext *, int stream_index, - AVFrame **frame, unsigned flags); - /** - * Returns device list with it properties. - * @see avdevice_list_devices() for more details. - */ - int (*get_device_list)(struct AVFormatContext *s, struct AVDeviceInfoList *device_list); - /** - * Initialize device capabilities submodule. - * @see avdevice_capabilities_create() for more details. - */ - int (*create_device_capabilities)(struct AVFormatContext *s, struct AVDeviceCapabilitiesQuery *caps); - /** - * Free device capabilities submodule. - * @see avdevice_capabilities_free() for more details. - */ - int (*free_device_capabilities)(struct AVFormatContext *s, struct AVDeviceCapabilitiesQuery *caps); -} AVOutputFormat; -/** - * @} - */ - -/** - * @addtogroup lavf_decoding - * @{ - */ -typedef struct AVInputFormat { - /** - * A comma separated list of short names for the format. New names - * may be appended with a minor bump. - */ - const char *name; - - /** - * Descriptive name for the format, meant to be more human-readable - * than name. You should use the NULL_IF_CONFIG_SMALL() macro - * to define it. - */ - const char *long_name; - - /** - * Can use flags: AVFMT_NOFILE, AVFMT_NEEDNUMBER, AVFMT_SHOW_IDS, - * AVFMT_GENERIC_INDEX, AVFMT_TS_DISCONT, AVFMT_NOBINSEARCH, - * AVFMT_NOGENSEARCH, AVFMT_NO_BYTE_SEEK, AVFMT_SEEK_TO_PTS. - */ - int flags; - - /** - * If extensions are defined, then no probe is done. You should - * usually not use extension format guessing because it is not - * reliable enough - */ - const char *extensions; - - const struct AVCodecTag * const *codec_tag; - - const AVClass *priv_class; ///< AVClass for the private context - - /***************************************************************** - * No fields below this line are part of the public API. They - * may not be used outside of libavformat and can be changed and - * removed at will. - * New public fields should be added right above. - ***************************************************************** - */ - struct AVInputFormat *next; - - /** - * Raw demuxers store their codec ID here. - */ - int raw_codec_id; - - /** - * Size of private data so that it can be allocated in the wrapper. - */ - int priv_data_size; - - /** - * Tell if a given file has a chance of being parsed as this format. - * The buffer provided is guaranteed to be AVPROBE_PADDING_SIZE bytes - * big so you do not have to check for that unless you need more. - */ - int (*read_probe)(AVProbeData *); - - /** - * Read the format header and initialize the AVFormatContext - * structure. Return 0 if OK. Only used in raw format right - * now. 'avformat_new_stream' should be called to create new streams. - */ - int (*read_header)(struct AVFormatContext *); - - /** - * Read one packet and put it in 'pkt'. pts and flags are also - * set. 'avformat_new_stream' can be called only if the flag - * AVFMTCTX_NOHEADER is used and only in the calling thread (not in a - * background thread). - * @return 0 on success, < 0 on error. - * When returning an error, pkt must not have been allocated - * or must be freed before returning - */ - int (*read_packet)(struct AVFormatContext *, AVPacket *pkt); - - /** - * Close the stream. The AVFormatContext and AVStreams are not - * freed by this function - */ - int (*read_close)(struct AVFormatContext *); - - /** - * Seek to a given timestamp relative to the frames in - * stream component stream_index. - * @param stream_index Must not be -1. - * @param flags Selects which direction should be preferred if no exact - * match is available. - * @return >= 0 on success (but not necessarily the new offset) - */ - int (*read_seek)(struct AVFormatContext *, - int stream_index, int64_t timestamp, int flags); - - /** - * Get the next timestamp in stream[stream_index].time_base units. - * @return the timestamp or AV_NOPTS_VALUE if an error occurred - */ - int64_t (*read_timestamp)(struct AVFormatContext *s, int stream_index, - int64_t *pos, int64_t pos_limit); - - /** - * Start/resume playing - only meaningful if using a network-based format - * (RTSP). - */ - int (*read_play)(struct AVFormatContext *); - - /** - * Pause playing - only meaningful if using a network-based format - * (RTSP). - */ - int (*read_pause)(struct AVFormatContext *); - - /** - * Seek to timestamp ts. - * Seeking will be done so that the point from which all active streams - * can be presented successfully will be closest to ts and within min/max_ts. - * Active streams are all streams that have AVStream.discard < AVDISCARD_ALL. - */ - int (*read_seek2)(struct AVFormatContext *s, int stream_index, int64_t min_ts, int64_t ts, int64_t max_ts, int flags); - - /** - * Returns device list with it properties. - * @see avdevice_list_devices() for more details. - */ - int (*get_device_list)(struct AVFormatContext *s, struct AVDeviceInfoList *device_list); - - /** - * Initialize device capabilities submodule. - * @see avdevice_capabilities_create() for more details. - */ - int (*create_device_capabilities)(struct AVFormatContext *s, struct AVDeviceCapabilitiesQuery *caps); - - /** - * Free device capabilities submodule. - * @see avdevice_capabilities_free() for more details. - */ - int (*free_device_capabilities)(struct AVFormatContext *s, struct AVDeviceCapabilitiesQuery *caps); -} AVInputFormat; -/** - * @} - */ - -enum AVStreamParseType { - AVSTREAM_PARSE_NONE, - AVSTREAM_PARSE_FULL, /**< full parsing and repack */ - AVSTREAM_PARSE_HEADERS, /**< Only parse headers, do not repack. */ - AVSTREAM_PARSE_TIMESTAMPS, /**< full parsing and interpolation of timestamps for frames not starting on a packet boundary */ - AVSTREAM_PARSE_FULL_ONCE, /**< full parsing and repack of the first frame only, only implemented for H.264 currently */ - AVSTREAM_PARSE_FULL_RAW=MKTAG(0,'R','A','W'), /**< full parsing and repack with timestamp and position generation by parser for raw - this assumes that each packet in the file contains no demuxer level headers and - just codec level data, otherwise position generation would fail */ -}; - -typedef struct AVIndexEntry { - int64_t pos; - int64_t timestamp; /**< - * Timestamp in AVStream.time_base units, preferably the time from which on correctly decoded frames are available - * when seeking to this entry. That means preferable PTS on keyframe based formats. - * But demuxers can choose to store a different timestamp, if it is more convenient for the implementation or nothing better - * is known - */ -#define AVINDEX_KEYFRAME 0x0001 - int flags:2; - int size:30; //Yeah, trying to keep the size of this small to reduce memory requirements (it is 24 vs. 32 bytes due to possible 8-byte alignment). - int min_distance; /**< Minimum distance between this and the previous keyframe, used to avoid unneeded searching. */ -} AVIndexEntry; - -#define AV_DISPOSITION_DEFAULT 0x0001 -#define AV_DISPOSITION_DUB 0x0002 -#define AV_DISPOSITION_ORIGINAL 0x0004 -#define AV_DISPOSITION_COMMENT 0x0008 -#define AV_DISPOSITION_LYRICS 0x0010 -#define AV_DISPOSITION_KARAOKE 0x0020 - -/** - * Track should be used during playback by default. - * Useful for subtitle track that should be displayed - * even when user did not explicitly ask for subtitles. - */ -#define AV_DISPOSITION_FORCED 0x0040 -#define AV_DISPOSITION_HEARING_IMPAIRED 0x0080 /**< stream for hearing impaired audiences */ -#define AV_DISPOSITION_VISUAL_IMPAIRED 0x0100 /**< stream for visual impaired audiences */ -#define AV_DISPOSITION_CLEAN_EFFECTS 0x0200 /**< stream without voice */ -/** - * The stream is stored in the file as an attached picture/"cover art" (e.g. - * APIC frame in ID3v2). The single packet associated with it will be returned - * among the first few packets read from the file unless seeking takes place. - * It can also be accessed at any time in AVStream.attached_pic. - */ -#define AV_DISPOSITION_ATTACHED_PIC 0x0400 - -/** - * To specify text track kind (different from subtitles default). - */ -#define AV_DISPOSITION_CAPTIONS 0x10000 -#define AV_DISPOSITION_DESCRIPTIONS 0x20000 -#define AV_DISPOSITION_METADATA 0x40000 - -/** - * Options for behavior on timestamp wrap detection. - */ -#define AV_PTS_WRAP_IGNORE 0 ///< ignore the wrap -#define AV_PTS_WRAP_ADD_OFFSET 1 ///< add the format specific offset on wrap detection -#define AV_PTS_WRAP_SUB_OFFSET -1 ///< subtract the format specific offset on wrap detection - -/** - * Stream structure. - * New fields can be added to the end with minor version bumps. - * Removal, reordering and changes to existing fields require a major - * version bump. - * sizeof(AVStream) must not be used outside libav*. - */ -typedef struct AVStream { - int index; /**< stream index in AVFormatContext */ - /** - * Format-specific stream ID. - * decoding: set by libavformat - * encoding: set by the user, replaced by libavformat if left unset - */ - int id; - /** - * Codec context associated with this stream. Allocated and freed by - * libavformat. - * - * - decoding: The demuxer exports codec information stored in the headers - * here. - * - encoding: The user sets codec information, the muxer writes it to the - * output. Mandatory fields as specified in AVCodecContext - * documentation must be set even if this AVCodecContext is - * not actually used for encoding. - */ - AVCodecContext *codec; - void *priv_data; - - /** - * encoding: pts generation when outputting stream - */ - struct AVFrac pts; - - /** - * This is the fundamental unit of time (in seconds) in terms - * of which frame timestamps are represented. - * - * decoding: set by libavformat - * encoding: set by libavformat in avformat_write_header. The muxer may use the - * user-provided value of @ref AVCodecContext.time_base "codec->time_base" - * as a hint. - */ - AVRational time_base; - - /** - * Decoding: pts of the first frame of the stream in presentation order, in stream time base. - * Only set this if you are absolutely 100% sure that the value you set - * it to really is the pts of the first frame. - * This may be undefined (AV_NOPTS_VALUE). - * @note The ASF header does NOT contain a correct start_time the ASF - * demuxer must NOT set this. - */ - int64_t start_time; - - /** - * Decoding: duration of the stream, in stream time base. - * If a source file does not specify a duration, but does specify - * a bitrate, this value will be estimated from bitrate and file size. - */ - int64_t duration; - - int64_t nb_frames; ///< number of frames in this stream if known or 0 - - int disposition; /**< AV_DISPOSITION_* bit field */ - - enum AVDiscard discard; ///< Selects which packets can be discarded at will and do not need to be demuxed. - - /** - * sample aspect ratio (0 if unknown) - * - encoding: Set by user. - * - decoding: Set by libavformat. - */ - AVRational sample_aspect_ratio; - - AVDictionary *metadata; - - /** - * Average framerate - */ - AVRational avg_frame_rate; - - /** - * For streams with AV_DISPOSITION_ATTACHED_PIC disposition, this packet - * will contain the attached picture. - * - * decoding: set by libavformat, must not be modified by the caller. - * encoding: unused - */ - AVPacket attached_pic; - - /** - * An array of side data that applies to the whole stream (i.e. the - * container does not allow it to change between packets). - * - * There may be no overlap between the side data in this array and side data - * in the packets. I.e. a given side data is either exported by the muxer - * (demuxing) / set by the caller (muxing) in this array, then it never - * appears in the packets, or the side data is exported / sent through - * the packets (always in the first packet where the value becomes known or - * changes), then it does not appear in this array. - * - * - demuxing: Set by libavformat when the stream is created. - * - muxing: May be set by the caller before avformat_write_header(). - * - * Freed by libavformat in avformat_free_context(). - * - * @see av_format_inject_global_side_data() - */ - AVPacketSideData *side_data; - /** - * The number of elements in the AVStream.side_data array. - */ - int nb_side_data; - - /***************************************************************** - * All fields below this line are not part of the public API. They - * may not be used outside of libavformat and can be changed and - * removed at will. - * New public fields should be added right above. - ***************************************************************** - */ - - /** - * Stream information used internally by av_find_stream_info() - */ -#define MAX_STD_TIMEBASES (60*12+6) - struct { - int64_t last_dts; - int64_t duration_gcd; - int duration_count; - int64_t rfps_duration_sum; - double (*duration_error)[2][MAX_STD_TIMEBASES]; - int64_t codec_info_duration; - int64_t codec_info_duration_fields; - - /** - * 0 -> decoder has not been searched for yet. - * >0 -> decoder found - * <0 -> decoder with codec_id == -found_decoder has not been found - */ - int found_decoder; - - int64_t last_duration; - - /** - * Those are used for average framerate estimation. - */ - int64_t fps_first_dts; - int fps_first_dts_idx; - int64_t fps_last_dts; - int fps_last_dts_idx; - - } *info; - - int pts_wrap_bits; /**< number of bits in pts (used for wrapping control) */ - -#if FF_API_REFERENCE_DTS - /* a hack to keep ABI compatibility for ffmpeg and other applications, which accesses parser even - * though it should not */ - int64_t do_not_use; -#endif - // Timestamp generation support: - /** - * Timestamp corresponding to the last dts sync point. - * - * Initialized when AVCodecParserContext.dts_sync_point >= 0 and - * a DTS is received from the underlying container. Otherwise set to - * AV_NOPTS_VALUE by default. - */ - int64_t first_dts; - int64_t cur_dts; - int64_t last_IP_pts; - int last_IP_duration; - - /** - * Number of packets to buffer for codec probing - */ -#define MAX_PROBE_PACKETS 2500 - int probe_packets; - - /** - * Number of frames that have been demuxed during av_find_stream_info() - */ - int codec_info_nb_frames; - - /* av_read_frame() support */ - enum AVStreamParseType need_parsing; - struct AVCodecParserContext *parser; - - /** - * last packet in packet_buffer for this stream when muxing. - */ - struct AVPacketList *last_in_packet_buffer; - AVProbeData probe_data; -#define MAX_REORDER_DELAY 16 - int64_t pts_buffer[MAX_REORDER_DELAY+1]; - - AVIndexEntry *index_entries; /**< Only used if the format does not - support seeking natively. */ - int nb_index_entries; - unsigned int index_entries_allocated_size; - - /** - * Real base framerate of the stream. - * This is the lowest framerate with which all timestamps can be - * represented accurately (it is the least common multiple of all - * framerates in the stream). Note, this value is just a guess! - * For example, if the time base is 1/90000 and all frames have either - * approximately 3600 or 1800 timer ticks, then r_frame_rate will be 50/1. - * - * Code outside avformat should access this field using: - * av_stream_get/set_r_frame_rate(stream) - */ - AVRational r_frame_rate; - - /** - * Stream Identifier - * This is the MPEG-TS stream identifier +1 - * 0 means unknown - */ - int stream_identifier; - - int64_t interleaver_chunk_size; - int64_t interleaver_chunk_duration; - - /** - * stream probing state - * -1 -> probing finished - * 0 -> no probing requested - * rest -> perform probing with request_probe being the minimum score to accept. - * NOT PART OF PUBLIC API - */ - int request_probe; - /** - * Indicates that everything up to the next keyframe - * should be discarded. - */ - int skip_to_keyframe; - - /** - * Number of samples to skip at the start of the frame decoded from the next packet. - */ - int skip_samples; - - /** - * Number of internally decoded frames, used internally in libavformat, do not access - * its lifetime differs from info which is why it is not in that structure. - */ - int nb_decoded_frames; - - /** - * Timestamp offset added to timestamps before muxing - * NOT PART OF PUBLIC API - */ - int64_t mux_ts_offset; - - /** - * Internal data to check for wrapping of the time stamp - */ - int64_t pts_wrap_reference; - - /** - * Options for behavior, when a wrap is detected. - * - * Defined by AV_PTS_WRAP_ values. - * - * If correction is enabled, there are two possibilities: - * If the first time stamp is near the wrap point, the wrap offset - * will be subtracted, which will create negative time stamps. - * Otherwise the offset will be added. - */ - int pts_wrap_behavior; - - /** - * Internal data to prevent doing update_initial_durations() twice - */ - int update_initial_durations_done; - - /** - * Internal data to generate dts from pts - */ - int64_t pts_reorder_error[MAX_REORDER_DELAY+1]; - uint8_t pts_reorder_error_count[MAX_REORDER_DELAY+1]; - - /** - * Internal data to analyze DTS and detect faulty mpeg streams - */ - int64_t last_dts_for_order_check; - uint8_t dts_ordered; - uint8_t dts_misordered; - - /** - * Internal data to inject global side data - */ - int inject_global_side_data; - -} AVStream; - -AVRational av_stream_get_r_frame_rate(const AVStream *s); -void av_stream_set_r_frame_rate(AVStream *s, AVRational r); - -#define AV_PROGRAM_RUNNING 1 - -/** - * New fields can be added to the end with minor version bumps. - * Removal, reordering and changes to existing fields require a major - * version bump. - * sizeof(AVProgram) must not be used outside libav*. - */ -typedef struct AVProgram { - int id; - int flags; - enum AVDiscard discard; ///< selects which program to discard and which to feed to the caller - unsigned int *stream_index; - unsigned int nb_stream_indexes; - AVDictionary *metadata; - - int program_num; - int pmt_pid; - int pcr_pid; - - /***************************************************************** - * All fields below this line are not part of the public API. They - * may not be used outside of libavformat and can be changed and - * removed at will. - * New public fields should be added right above. - ***************************************************************** - */ - int64_t start_time; - int64_t end_time; - - int64_t pts_wrap_reference; ///< reference dts for wrap detection - int pts_wrap_behavior; ///< behavior on wrap detection -} AVProgram; - -#define AVFMTCTX_NOHEADER 0x0001 /**< signal that no header is present - (streams are added dynamically) */ - -typedef struct AVChapter { - int id; ///< unique ID to identify the chapter - AVRational time_base; ///< time base in which the start/end timestamps are specified - int64_t start, end; ///< chapter start/end time in time_base units - AVDictionary *metadata; -} AVChapter; - - -/** - * Callback used by devices to communicate with application. - */ -typedef int (*av_format_control_message)(struct AVFormatContext *s, int type, - void *data, size_t data_size); - - -/** - * The duration of a video can be estimated through various ways, and this enum can be used - * to know how the duration was estimated. - */ -enum AVDurationEstimationMethod { - AVFMT_DURATION_FROM_PTS, ///< Duration accurately estimated from PTSes - AVFMT_DURATION_FROM_STREAM, ///< Duration estimated from a stream with a known duration - AVFMT_DURATION_FROM_BITRATE ///< Duration estimated from bitrate (less accurate) -}; - -typedef struct AVFormatInternal AVFormatInternal; - -/** - * Format I/O context. - * New fields can be added to the end with minor version bumps. - * Removal, reordering and changes to existing fields require a major - * version bump. - * sizeof(AVFormatContext) must not be used outside libav*, use - * avformat_alloc_context() to create an AVFormatContext. - */ -typedef struct AVFormatContext { - /** - * A class for logging and @ref avoptions. Set by avformat_alloc_context(). - * Exports (de)muxer private options if they exist. - */ - const AVClass *av_class; - - /** - * The input container format. - * - * Demuxing only, set by avformat_open_input(). - */ - struct AVInputFormat *iformat; - - /** - * The output container format. - * - * Muxing only, must be set by the caller before avformat_write_header(). - */ - struct AVOutputFormat *oformat; - - /** - * Format private data. This is an AVOptions-enabled struct - * if and only if iformat/oformat.priv_class is not NULL. - * - * - muxing: set by avformat_write_header() - * - demuxing: set by avformat_open_input() - */ - void *priv_data; - - /** - * I/O context. - * - * - demuxing: either set by the user before avformat_open_input() (then - * the user must close it manually) or set by avformat_open_input(). - * - muxing: set by the user before avformat_write_header(). The caller must - * take care of closing / freeing the IO context. - * - * Do NOT set this field if AVFMT_NOFILE flag is set in - * iformat/oformat.flags. In such a case, the (de)muxer will handle - * I/O in some other way and this field will be NULL. - */ - AVIOContext *pb; - - /* stream info */ - int ctx_flags; /**< Format-specific flags, see AVFMTCTX_xx */ - - /** - * Number of elements in AVFormatContext.streams. - * - * Set by avformat_new_stream(), must not be modified by any other code. - */ - unsigned int nb_streams; - /** - * A list of all streams in the file. New streams are created with - * avformat_new_stream(). - * - * - demuxing: streams are created by libavformat in avformat_open_input(). - * If AVFMTCTX_NOHEADER is set in ctx_flags, then new streams may also - * appear in av_read_frame(). - * - muxing: streams are created by the user before avformat_write_header(). - * - * Freed by libavformat in avformat_free_context(). - */ - AVStream **streams; - - /** - * input or output filename - * - * - demuxing: set by avformat_open_input() - * - muxing: may be set by the caller before avformat_write_header() - */ - char filename[1024]; - - /** - * Position of the first frame of the component, in - * AV_TIME_BASE fractional seconds. NEVER set this value directly: - * It is deduced from the AVStream values. - * - * Demuxing only, set by libavformat. - */ - int64_t start_time; - - /** - * Duration of the stream, in AV_TIME_BASE fractional - * seconds. Only set this value if you know none of the individual stream - * durations and also do not set any of them. This is deduced from the - * AVStream values if not set. - * - * Demuxing only, set by libavformat. - */ - int64_t duration; - - /** - * Total stream bitrate in bit/s, 0 if not - * available. Never set it directly if the file_size and the - * duration are known as FFmpeg can compute it automatically. - */ - int bit_rate; - - unsigned int packet_size; - int max_delay; - - int flags; -#define AVFMT_FLAG_GENPTS 0x0001 ///< Generate missing pts even if it requires parsing future frames. -#define AVFMT_FLAG_IGNIDX 0x0002 ///< Ignore index. -#define AVFMT_FLAG_NONBLOCK 0x0004 ///< Do not block when reading packets from input. -#define AVFMT_FLAG_IGNDTS 0x0008 ///< Ignore DTS on frames that contain both DTS & PTS -#define AVFMT_FLAG_NOFILLIN 0x0010 ///< Do not infer any values from other values, just return what is stored in the container -#define AVFMT_FLAG_NOPARSE 0x0020 ///< Do not use AVParsers, you also must set AVFMT_FLAG_NOFILLIN as the fillin code works on frames and no parsing -> no frames. Also seeking to frames can not work if parsing to find frame boundaries has been disabled -#define AVFMT_FLAG_NOBUFFER 0x0040 ///< Do not buffer frames when possible -#define AVFMT_FLAG_CUSTOM_IO 0x0080 ///< The caller has supplied a custom AVIOContext, don't avio_close() it. -#define AVFMT_FLAG_DISCARD_CORRUPT 0x0100 ///< Discard frames marked corrupted -#define AVFMT_FLAG_FLUSH_PACKETS 0x0200 ///< Flush the AVIOContext every packet. -#define AVFMT_FLAG_MP4A_LATM 0x8000 ///< Enable RTP MP4A-LATM payload -#define AVFMT_FLAG_SORT_DTS 0x10000 ///< try to interleave outputted packets by dts (using this flag can slow demuxing down) -#define AVFMT_FLAG_PRIV_OPT 0x20000 ///< Enable use of private options by delaying codec open (this could be made default once all code is converted) -#define AVFMT_FLAG_KEEP_SIDE_DATA 0x40000 ///< Don't merge side data but keep it separate. - - /** - * Maximum size of the data read from input for determining - * the input container format. - * Demuxing only, set by the caller before avformat_open_input(). - */ - unsigned int probesize; - - /** - * Maximum duration (in AV_TIME_BASE units) of the data read - * from input in avformat_find_stream_info(). - * Demuxing only, set by the caller before avformat_find_stream_info(). - */ - int max_analyze_duration; - - const uint8_t *key; - int keylen; - - unsigned int nb_programs; - AVProgram **programs; - - /** - * Forced video codec_id. - * Demuxing: Set by user. - */ - enum AVCodecID video_codec_id; - - /** - * Forced audio codec_id. - * Demuxing: Set by user. - */ - enum AVCodecID audio_codec_id; - - /** - * Forced subtitle codec_id. - * Demuxing: Set by user. - */ - enum AVCodecID subtitle_codec_id; - - /** - * Maximum amount of memory in bytes to use for the index of each stream. - * If the index exceeds this size, entries will be discarded as - * needed to maintain a smaller size. This can lead to slower or less - * accurate seeking (depends on demuxer). - * Demuxers for which a full in-memory index is mandatory will ignore - * this. - * - muxing: unused - * - demuxing: set by user - */ - unsigned int max_index_size; - - /** - * Maximum amount of memory in bytes to use for buffering frames - * obtained from realtime capture devices. - */ - unsigned int max_picture_buffer; - - /** - * Number of chapters in AVChapter array. - * When muxing, chapters are normally written in the file header, - * so nb_chapters should normally be initialized before write_header - * is called. Some muxers (e.g. mov and mkv) can also write chapters - * in the trailer. To write chapters in the trailer, nb_chapters - * must be zero when write_header is called and non-zero when - * write_trailer is called. - * - muxing: set by user - * - demuxing: set by libavformat - */ - unsigned int nb_chapters; - AVChapter **chapters; - - /** - * Metadata that applies to the whole file. - * - * - demuxing: set by libavformat in avformat_open_input() - * - muxing: may be set by the caller before avformat_write_header() - * - * Freed by libavformat in avformat_free_context(). - */ - AVDictionary *metadata; - - /** - * Start time of the stream in real world time, in microseconds - * since the Unix epoch (00:00 1st January 1970). That is, pts=0 in the - * stream was captured at this real world time. - * - muxing: Set by the caller before avformat_write_header(). If set to - * either 0 or AV_NOPTS_VALUE, then the current wall-time will - * be used. - * - demuxing: Set by libavformat. AV_NOPTS_VALUE if unknown. Note that - * the value may become known after some number of frames - * have been received. - */ - int64_t start_time_realtime; - - /** - * The number of frames used for determining the framerate in - * avformat_find_stream_info(). - * Demuxing only, set by the caller before avformat_find_stream_info(). - */ - int fps_probe_size; - - /** - * Error recognition; higher values will detect more errors but may - * misdetect some more or less valid parts as errors. - * Demuxing only, set by the caller before avformat_open_input(). - */ - int error_recognition; - - /** - * Custom interrupt callbacks for the I/O layer. - * - * demuxing: set by the user before avformat_open_input(). - * muxing: set by the user before avformat_write_header() - * (mainly useful for AVFMT_NOFILE formats). The callback - * should also be passed to avio_open2() if it's used to - * open the file. - */ - AVIOInterruptCB interrupt_callback; - - /** - * Flags to enable debugging. - */ - int debug; -#define FF_FDEBUG_TS 0x0001 - - /** - * Maximum buffering duration for interleaving. - * - * To ensure all the streams are interleaved correctly, - * av_interleaved_write_frame() will wait until it has at least one packet - * for each stream before actually writing any packets to the output file. - * When some streams are "sparse" (i.e. there are large gaps between - * successive packets), this can result in excessive buffering. - * - * This field specifies the maximum difference between the timestamps of the - * first and the last packet in the muxing queue, above which libavformat - * will output a packet regardless of whether it has queued a packet for all - * the streams. - * - * Muxing only, set by the caller before avformat_write_header(). - */ - int64_t max_interleave_delta; - - /** - * Transport stream id. - * This will be moved into demuxer private options. Thus no API/ABI compatibility - */ - int ts_id; - - /** - * Audio preload in microseconds. - * Note, not all formats support this and unpredictable things may happen if it is used when not supported. - * - encoding: Set by user via AVOptions (NO direct access) - * - decoding: unused - */ - int audio_preload; - - /** - * Max chunk time in microseconds. - * Note, not all formats support this and unpredictable things may happen if it is used when not supported. - * - encoding: Set by user via AVOptions (NO direct access) - * - decoding: unused - */ - int max_chunk_duration; - - /** - * Max chunk size in bytes - * Note, not all formats support this and unpredictable things may happen if it is used when not supported. - * - encoding: Set by user via AVOptions (NO direct access) - * - decoding: unused - */ - int max_chunk_size; - - /** - * forces the use of wallclock timestamps as pts/dts of packets - * This has undefined results in the presence of B frames. - * - encoding: unused - * - decoding: Set by user via AVOptions (NO direct access) - */ - int use_wallclock_as_timestamps; - - /** - * Avoid negative timestamps during muxing. - * 0 -> allow negative timestamps - * 1 -> avoid negative timestamps - * -1 -> choose automatically (default) - * Note, this only works when interleave_packet_per_dts is in use. - * - encoding: Set by user via AVOptions (NO direct access) - * - decoding: unused - */ - int avoid_negative_ts; - - /** - * avio flags, used to force AVIO_FLAG_DIRECT. - * - encoding: unused - * - decoding: Set by user via AVOptions (NO direct access) - */ - int avio_flags; - - /** - * The duration field can be estimated through various ways, and this field can be used - * to know how the duration was estimated. - * - encoding: unused - * - decoding: Read by user via AVOptions (NO direct access) - */ - enum AVDurationEstimationMethod duration_estimation_method; - - /** - * Skip initial bytes when opening stream - * - encoding: unused - * - decoding: Set by user via AVOptions (NO direct access) - */ - unsigned int skip_initial_bytes; - - /** - * Correct single timestamp overflows - * - encoding: unused - * - decoding: Set by user via AVOptions (NO direct access) - */ - unsigned int correct_ts_overflow; - - /** - * Force seeking to any (also non key) frames. - * - encoding: unused - * - decoding: Set by user via AVOptions (NO direct access) - */ - int seek2any; - - /** - * Flush the I/O context after each packet. - * - encoding: Set by user via AVOptions (NO direct access) - * - decoding: unused - */ - int flush_packets; - - /** - * format probing score. - * The maximal score is AVPROBE_SCORE_MAX, its set when the demuxer probes - * the format. - * - encoding: unused - * - decoding: set by avformat, read by user via av_format_get_probe_score() (NO direct access) - */ - int probe_score; - - /***************************************************************** - * All fields below this line are not part of the public API. They - * may not be used outside of libavformat and can be changed and - * removed at will. - * New public fields should be added right above. - ***************************************************************** - */ - - /** - * This buffer is only needed when packets were already buffered but - * not decoded, for example to get the codec parameters in MPEG - * streams. - */ - struct AVPacketList *packet_buffer; - struct AVPacketList *packet_buffer_end; - - /* av_seek_frame() support */ - int64_t data_offset; /**< offset of the first packet */ - - /** - * Raw packets from the demuxer, prior to parsing and decoding. - * This buffer is used for buffering packets until the codec can - * be identified, as parsing cannot be done without knowing the - * codec. - */ - struct AVPacketList *raw_packet_buffer; - struct AVPacketList *raw_packet_buffer_end; - /** - * Packets split by the parser get queued here. - */ - struct AVPacketList *parse_queue; - struct AVPacketList *parse_queue_end; - /** - * Remaining size available for raw_packet_buffer, in bytes. - */ -#define RAW_PACKET_BUFFER_SIZE 2500000 - int raw_packet_buffer_remaining_size; - - /** - * Offset to remap timestamps to be non-negative. - * Expressed in timebase units. - * @see AVStream.mux_ts_offset - */ - int64_t offset; - - /** - * Timebase for the timestamp offset. - */ - AVRational offset_timebase; - - /** - * An opaque field for libavformat internal usage. - * Must not be accessed in any way by callers. - */ - AVFormatInternal *internal; - - /** - * IO repositioned flag. - * This is set by avformat when the underlaying IO context read pointer - * is repositioned, for example when doing byte based seeking. - * Demuxers can use the flag to detect such changes. - */ - int io_repositioned; - - /** - * Forced video codec. - * This allows forcing a specific decoder, even when there are multiple with - * the same codec_id. - * Demuxing: Set by user via av_format_set_video_codec (NO direct access). - */ - AVCodec *video_codec; - - /** - * Forced audio codec. - * This allows forcing a specific decoder, even when there are multiple with - * the same codec_id. - * Demuxing: Set by user via av_format_set_audio_codec (NO direct access). - */ - AVCodec *audio_codec; - - /** - * Forced subtitle codec. - * This allows forcing a specific decoder, even when there are multiple with - * the same codec_id. - * Demuxing: Set by user via av_format_set_subtitle_codec (NO direct access). - */ - AVCodec *subtitle_codec; - - /** - * Number of bytes to be written as padding in a metadata header. - * Demuxing: Unused. - * Muxing: Set by user via av_format_set_metadata_header_padding. - */ - int metadata_header_padding; - - /** - * User data. - * This is a place for some private data of the user. - * Mostly usable with control_message_cb or any future callbacks in device's context. - */ - void *opaque; - - /** - * Callback used by devices to communicate with application. - */ - av_format_control_message control_message_cb; - - /** - * Output timestamp offset, in microseconds. - * Muxing: set by user via AVOptions (NO direct access) - */ - int64_t output_ts_offset; -} AVFormatContext; - -int av_format_get_probe_score(const AVFormatContext *s); -AVCodec * av_format_get_video_codec(const AVFormatContext *s); -void av_format_set_video_codec(AVFormatContext *s, AVCodec *c); -AVCodec * av_format_get_audio_codec(const AVFormatContext *s); -void av_format_set_audio_codec(AVFormatContext *s, AVCodec *c); -AVCodec * av_format_get_subtitle_codec(const AVFormatContext *s); -void av_format_set_subtitle_codec(AVFormatContext *s, AVCodec *c); -int av_format_get_metadata_header_padding(const AVFormatContext *s); -void av_format_set_metadata_header_padding(AVFormatContext *s, int c); -void * av_format_get_opaque(const AVFormatContext *s); -void av_format_set_opaque(AVFormatContext *s, void *opaque); -av_format_control_message av_format_get_control_message_cb(const AVFormatContext *s); -void av_format_set_control_message_cb(AVFormatContext *s, av_format_control_message callback); - -/** - * This function will cause global side data to be injected in the next packet - * of each stream as well as after any subsequent seek. - */ -void av_format_inject_global_side_data(AVFormatContext *s); - -/** - * Returns the method used to set ctx->duration. - * - * @return AVFMT_DURATION_FROM_PTS, AVFMT_DURATION_FROM_STREAM, or AVFMT_DURATION_FROM_BITRATE. - */ -enum AVDurationEstimationMethod av_fmt_ctx_get_duration_estimation_method(const AVFormatContext* ctx); - -typedef struct AVPacketList { - AVPacket pkt; - struct AVPacketList *next; -} AVPacketList; - - -/** - * @defgroup lavf_core Core functions - * @ingroup libavf - * - * Functions for querying libavformat capabilities, allocating core structures, - * etc. - * @{ - */ - -/** - * Return the LIBAVFORMAT_VERSION_INT constant. - */ -unsigned avformat_version(void); - -/** - * Return the libavformat build-time configuration. - */ -const char *avformat_configuration(void); - -/** - * Return the libavformat license. - */ -const char *avformat_license(void); - -/** - * Initialize libavformat and register all the muxers, demuxers and - * protocols. If you do not call this function, then you can select - * exactly which formats you want to support. - * - * @see av_register_input_format() - * @see av_register_output_format() - */ -void av_register_all(void); - -void av_register_input_format(AVInputFormat *format); -void av_register_output_format(AVOutputFormat *format); - -/** - * Do global initialization of network components. This is optional, - * but recommended, since it avoids the overhead of implicitly - * doing the setup for each session. - * - * Calling this function will become mandatory if using network - * protocols at some major version bump. - */ -int avformat_network_init(void); - -/** - * Undo the initialization done by avformat_network_init. - */ -int avformat_network_deinit(void); - -/** - * If f is NULL, returns the first registered input format, - * if f is non-NULL, returns the next registered input format after f - * or NULL if f is the last one. - */ -AVInputFormat *av_iformat_next(AVInputFormat *f); - -/** - * If f is NULL, returns the first registered output format, - * if f is non-NULL, returns the next registered output format after f - * or NULL if f is the last one. - */ -AVOutputFormat *av_oformat_next(AVOutputFormat *f); - -/** - * Allocate an AVFormatContext. - * avformat_free_context() can be used to free the context and everything - * allocated by the framework within it. - */ -AVFormatContext *avformat_alloc_context(void); - -/** - * Free an AVFormatContext and all its streams. - * @param s context to free - */ -void avformat_free_context(AVFormatContext *s); - -/** - * Get the AVClass for AVFormatContext. It can be used in combination with - * AV_OPT_SEARCH_FAKE_OBJ for examining options. - * - * @see av_opt_find(). - */ -const AVClass *avformat_get_class(void); - -/** - * Add a new stream to a media file. - * - * When demuxing, it is called by the demuxer in read_header(). If the - * flag AVFMTCTX_NOHEADER is set in s.ctx_flags, then it may also - * be called in read_packet(). - * - * When muxing, should be called by the user before avformat_write_header(). - * - * User is required to call avcodec_close() and avformat_free_context() to - * clean up the allocation by avformat_new_stream(). - * - * @param s media file handle - * @param c If non-NULL, the AVCodecContext corresponding to the new stream - * will be initialized to use this codec. This is needed for e.g. codec-specific - * defaults to be set, so codec should be provided if it is known. - * - * @return newly created stream or NULL on error. - */ -AVStream *avformat_new_stream(AVFormatContext *s, const AVCodec *c); - -AVProgram *av_new_program(AVFormatContext *s, int id); - -/** - * @} - */ - - -#if FF_API_ALLOC_OUTPUT_CONTEXT -/** - * @deprecated deprecated in favor of avformat_alloc_output_context2() - */ -attribute_deprecated -AVFormatContext *avformat_alloc_output_context(const char *format, - AVOutputFormat *oformat, - const char *filename); -#endif - -/** - * Allocate an AVFormatContext for an output format. - * avformat_free_context() can be used to free the context and - * everything allocated by the framework within it. - * - * @param *ctx is set to the created format context, or to NULL in - * case of failure - * @param oformat format to use for allocating the context, if NULL - * format_name and filename are used instead - * @param format_name the name of output format to use for allocating the - * context, if NULL filename is used instead - * @param filename the name of the filename to use for allocating the - * context, may be NULL - * @return >= 0 in case of success, a negative AVERROR code in case of - * failure - */ -int avformat_alloc_output_context2(AVFormatContext **ctx, AVOutputFormat *oformat, - const char *format_name, const char *filename); - -/** - * @addtogroup lavf_decoding - * @{ - */ - -/** - * Find AVInputFormat based on the short name of the input format. - */ -AVInputFormat *av_find_input_format(const char *short_name); - -/** - * Guess the file format. - * - * @param pd data to be probed - * @param is_opened Whether the file is already opened; determines whether - * demuxers with or without AVFMT_NOFILE are probed. - */ -AVInputFormat *av_probe_input_format(AVProbeData *pd, int is_opened); - -/** - * Guess the file format. - * - * @param pd data to be probed - * @param is_opened Whether the file is already opened; determines whether - * demuxers with or without AVFMT_NOFILE are probed. - * @param score_max A probe score larger that this is required to accept a - * detection, the variable is set to the actual detection - * score afterwards. - * If the score is <= AVPROBE_SCORE_MAX / 4 it is recommended - * to retry with a larger probe buffer. - */ -AVInputFormat *av_probe_input_format2(AVProbeData *pd, int is_opened, int *score_max); - -/** - * Guess the file format. - * - * @param is_opened Whether the file is already opened; determines whether - * demuxers with or without AVFMT_NOFILE are probed. - * @param score_ret The score of the best detection. - */ -AVInputFormat *av_probe_input_format3(AVProbeData *pd, int is_opened, int *score_ret); - -/** - * Probe a bytestream to determine the input format. Each time a probe returns - * with a score that is too low, the probe buffer size is increased and another - * attempt is made. When the maximum probe size is reached, the input format - * with the highest score is returned. - * - * @param pb the bytestream to probe - * @param fmt the input format is put here - * @param filename the filename of the stream - * @param logctx the log context - * @param offset the offset within the bytestream to probe from - * @param max_probe_size the maximum probe buffer size (zero for default) - * @return the score in case of success, a negative value corresponding to an - * the maximal score is AVPROBE_SCORE_MAX - * AVERROR code otherwise - */ -int av_probe_input_buffer2(AVIOContext *pb, AVInputFormat **fmt, - const char *filename, void *logctx, - unsigned int offset, unsigned int max_probe_size); - -/** - * Like av_probe_input_buffer2() but returns 0 on success - */ -int av_probe_input_buffer(AVIOContext *pb, AVInputFormat **fmt, - const char *filename, void *logctx, - unsigned int offset, unsigned int max_probe_size); - -/** - * Open an input stream and read the header. The codecs are not opened. - * The stream must be closed with avformat_close_input(). - * - * @param ps Pointer to user-supplied AVFormatContext (allocated by avformat_alloc_context). - * May be a pointer to NULL, in which case an AVFormatContext is allocated by this - * function and written into ps. - * Note that a user-supplied AVFormatContext will be freed on failure. - * @param filename Name of the stream to open. - * @param fmt If non-NULL, this parameter forces a specific input format. - * Otherwise the format is autodetected. - * @param options A dictionary filled with AVFormatContext and demuxer-private options. - * On return this parameter will be destroyed and replaced with a dict containing - * options that were not found. May be NULL. - * - * @return 0 on success, a negative AVERROR on failure. - * - * @note If you want to use custom IO, preallocate the format context and set its pb field. - */ -int avformat_open_input(AVFormatContext **ps, const char *filename, AVInputFormat *fmt, AVDictionary **options); - -attribute_deprecated -int av_demuxer_open(AVFormatContext *ic); - -#if FF_API_FORMAT_PARAMETERS -/** - * Read packets of a media file to get stream information. This - * is useful for file formats with no headers such as MPEG. This - * function also computes the real framerate in case of MPEG-2 repeat - * frame mode. - * The logical file position is not changed by this function; - * examined packets may be buffered for later processing. - * - * @param ic media file handle - * @return >=0 if OK, AVERROR_xxx on error - * @todo Let the user decide somehow what information is needed so that - * we do not waste time getting stuff the user does not need. - * - * @deprecated use avformat_find_stream_info. - */ -attribute_deprecated -int av_find_stream_info(AVFormatContext *ic); -#endif - -/** - * Read packets of a media file to get stream information. This - * is useful for file formats with no headers such as MPEG. This - * function also computes the real framerate in case of MPEG-2 repeat - * frame mode. - * The logical file position is not changed by this function; - * examined packets may be buffered for later processing. - * - * @param ic media file handle - * @param options If non-NULL, an ic.nb_streams long array of pointers to - * dictionaries, where i-th member contains options for - * codec corresponding to i-th stream. - * On return each dictionary will be filled with options that were not found. - * @return >=0 if OK, AVERROR_xxx on error - * - * @note this function isn't guaranteed to open all the codecs, so - * options being non-empty at return is a perfectly normal behavior. - * - * @todo Let the user decide somehow what information is needed so that - * we do not waste time getting stuff the user does not need. - */ -int avformat_find_stream_info(AVFormatContext *ic, AVDictionary **options); - -/** - * Find the programs which belong to a given stream. - * - * @param ic media file handle - * @param last the last found program, the search will start after this - * program, or from the beginning if it is NULL - * @param s stream index - * @return the next program which belongs to s, NULL if no program is found or - * the last program is not among the programs of ic. - */ -AVProgram *av_find_program_from_stream(AVFormatContext *ic, AVProgram *last, int s); - -/** - * Find the "best" stream in the file. - * The best stream is determined according to various heuristics as the most - * likely to be what the user expects. - * If the decoder parameter is non-NULL, av_find_best_stream will find the - * default decoder for the stream's codec; streams for which no decoder can - * be found are ignored. - * - * @param ic media file handle - * @param type stream type: video, audio, subtitles, etc. - * @param wanted_stream_nb user-requested stream number, - * or -1 for automatic selection - * @param related_stream try to find a stream related (eg. in the same - * program) to this one, or -1 if none - * @param decoder_ret if non-NULL, returns the decoder for the - * selected stream - * @param flags flags; none are currently defined - * @return the non-negative stream number in case of success, - * AVERROR_STREAM_NOT_FOUND if no stream with the requested type - * could be found, - * AVERROR_DECODER_NOT_FOUND if streams were found but no decoder - * @note If av_find_best_stream returns successfully and decoder_ret is not - * NULL, then *decoder_ret is guaranteed to be set to a valid AVCodec. - */ -int av_find_best_stream(AVFormatContext *ic, - enum AVMediaType type, - int wanted_stream_nb, - int related_stream, - AVCodec **decoder_ret, - int flags); - -#if FF_API_READ_PACKET -/** - * @deprecated use AVFMT_FLAG_NOFILLIN | AVFMT_FLAG_NOPARSE to read raw - * unprocessed packets - * - * Read a transport packet from a media file. - * - * This function is obsolete and should never be used. - * Use av_read_frame() instead. - * - * @param s media file handle - * @param pkt is filled - * @return 0 if OK, AVERROR_xxx on error - */ -attribute_deprecated -int av_read_packet(AVFormatContext *s, AVPacket *pkt); -#endif - -/** - * Return the next frame of a stream. - * This function returns what is stored in the file, and does not validate - * that what is there are valid frames for the decoder. It will split what is - * stored in the file into frames and return one for each call. It will not - * omit invalid data between valid frames so as to give the decoder the maximum - * information possible for decoding. - * - * If pkt->buf is NULL, then the packet is valid until the next - * av_read_frame() or until avformat_close_input(). Otherwise the packet - * is valid indefinitely. In both cases the packet must be freed with - * av_free_packet when it is no longer needed. For video, the packet contains - * exactly one frame. For audio, it contains an integer number of frames if each - * frame has a known fixed size (e.g. PCM or ADPCM data). If the audio frames - * have a variable size (e.g. MPEG audio), then it contains one frame. - * - * pkt->pts, pkt->dts and pkt->duration are always set to correct - * values in AVStream.time_base units (and guessed if the format cannot - * provide them). pkt->pts can be AV_NOPTS_VALUE if the video format - * has B-frames, so it is better to rely on pkt->dts if you do not - * decompress the payload. - * - * @return 0 if OK, < 0 on error or end of file - */ -int av_read_frame(AVFormatContext *s, AVPacket *pkt); - -/** - * Seek to the keyframe at timestamp. - * 'timestamp' in 'stream_index'. - * - * @param s media file handle - * @param stream_index If stream_index is (-1), a default - * stream is selected, and timestamp is automatically converted - * from AV_TIME_BASE units to the stream specific time_base. - * @param timestamp Timestamp in AVStream.time_base units - * or, if no stream is specified, in AV_TIME_BASE units. - * @param flags flags which select direction and seeking mode - * @return >= 0 on success - */ -int av_seek_frame(AVFormatContext *s, int stream_index, int64_t timestamp, - int flags); - -/** - * Seek to timestamp ts. - * Seeking will be done so that the point from which all active streams - * can be presented successfully will be closest to ts and within min/max_ts. - * Active streams are all streams that have AVStream.discard < AVDISCARD_ALL. - * - * If flags contain AVSEEK_FLAG_BYTE, then all timestamps are in bytes and - * are the file position (this may not be supported by all demuxers). - * If flags contain AVSEEK_FLAG_FRAME, then all timestamps are in frames - * in the stream with stream_index (this may not be supported by all demuxers). - * Otherwise all timestamps are in units of the stream selected by stream_index - * or if stream_index is -1, in AV_TIME_BASE units. - * If flags contain AVSEEK_FLAG_ANY, then non-keyframes are treated as - * keyframes (this may not be supported by all demuxers). - * If flags contain AVSEEK_FLAG_BACKWARD, it is ignored. - * - * @param s media file handle - * @param stream_index index of the stream which is used as time base reference - * @param min_ts smallest acceptable timestamp - * @param ts target timestamp - * @param max_ts largest acceptable timestamp - * @param flags flags - * @return >=0 on success, error code otherwise - * - * @note This is part of the new seek API which is still under construction. - * Thus do not use this yet. It may change at any time, do not expect - * ABI compatibility yet! - */ -int avformat_seek_file(AVFormatContext *s, int stream_index, int64_t min_ts, int64_t ts, int64_t max_ts, int flags); - -/** - * Start playing a network-based stream (e.g. RTSP stream) at the - * current position. - */ -int av_read_play(AVFormatContext *s); - -/** - * Pause a network-based stream (e.g. RTSP stream). - * - * Use av_read_play() to resume it. - */ -int av_read_pause(AVFormatContext *s); - -#if FF_API_CLOSE_INPUT_FILE -/** - * @deprecated use avformat_close_input() - * Close a media file (but not its codecs). - * - * @param s media file handle - */ -attribute_deprecated -void av_close_input_file(AVFormatContext *s); -#endif - -/** - * Close an opened input AVFormatContext. Free it and all its contents - * and set *s to NULL. - */ -void avformat_close_input(AVFormatContext **s); -/** - * @} - */ - -#if FF_API_NEW_STREAM -/** - * Add a new stream to a media file. - * - * Can only be called in the read_header() function. If the flag - * AVFMTCTX_NOHEADER is in the format context, then new streams - * can be added in read_packet too. - * - * @param s media file handle - * @param id file-format-dependent stream ID - */ -attribute_deprecated -AVStream *av_new_stream(AVFormatContext *s, int id); -#endif - -#if FF_API_SET_PTS_INFO -/** - * @deprecated this function is not supposed to be called outside of lavf - */ -attribute_deprecated -void av_set_pts_info(AVStream *s, int pts_wrap_bits, - unsigned int pts_num, unsigned int pts_den); -#endif - -#define AVSEEK_FLAG_BACKWARD 1 ///< seek backward -#define AVSEEK_FLAG_BYTE 2 ///< seeking based on position in bytes -#define AVSEEK_FLAG_ANY 4 ///< seek to any frame, even non-keyframes -#define AVSEEK_FLAG_FRAME 8 ///< seeking based on frame number - -/** - * @addtogroup lavf_encoding - * @{ - */ -/** - * Allocate the stream private data and write the stream header to - * an output media file. - * - * @param s Media file handle, must be allocated with avformat_alloc_context(). - * Its oformat field must be set to the desired output format; - * Its pb field must be set to an already opened AVIOContext. - * @param options An AVDictionary filled with AVFormatContext and muxer-private options. - * On return this parameter will be destroyed and replaced with a dict containing - * options that were not found. May be NULL. - * - * @return 0 on success, negative AVERROR on failure. - * - * @see av_opt_find, av_dict_set, avio_open, av_oformat_next. - */ -int avformat_write_header(AVFormatContext *s, AVDictionary **options); - -/** - * Write a packet to an output media file. - * - * This function passes the packet directly to the muxer, without any buffering - * or reordering. The caller is responsible for correctly interleaving the - * packets if the format requires it. Callers that want libavformat to handle - * the interleaving should call av_interleaved_write_frame() instead of this - * function. - * - * @param s media file handle - * @param pkt The packet containing the data to be written. Note that unlike - * av_interleaved_write_frame(), this function does not take - * ownership of the packet passed to it (though some muxers may make - * an internal reference to the input packet). - *
- * This parameter can be NULL (at any time, not just at the end), in - * order to immediately flush data buffered within the muxer, for - * muxers that buffer up data internally before writing it to the - * output. - *
- * Packet's @ref AVPacket.stream_index "stream_index" field must be - * set to the index of the corresponding stream in @ref - * AVFormatContext.streams "s->streams". It is very strongly - * recommended that timing information (@ref AVPacket.pts "pts", @ref - * AVPacket.dts "dts", @ref AVPacket.duration "duration") is set to - * correct values. - * @return < 0 on error, = 0 if OK, 1 if flushed and there is no more data to flush - * - * @see av_interleaved_write_frame() - */ -int av_write_frame(AVFormatContext *s, AVPacket *pkt); - -/** - * Write a packet to an output media file ensuring correct interleaving. - * - * This function will buffer the packets internally as needed to make sure the - * packets in the output file are properly interleaved in the order of - * increasing dts. Callers doing their own interleaving should call - * av_write_frame() instead of this function. - * - * @param s media file handle - * @param pkt The packet containing the data to be written. - *
- * If the packet is reference-counted, this function will take - * ownership of this reference and unreference it later when it sees - * fit. - * The caller must not access the data through this reference after - * this function returns. If the packet is not reference-counted, - * libavformat will make a copy. - *
- * This parameter can be NULL (at any time, not just at the end), to - * flush the interleaving queues. - *
- * Packet's @ref AVPacket.stream_index "stream_index" field must be - * set to the index of the corresponding stream in @ref - * AVFormatContext.streams "s->streams". It is very strongly - * recommended that timing information (@ref AVPacket.pts "pts", @ref - * AVPacket.dts "dts", @ref AVPacket.duration "duration") is set to - * correct values. - * - * @return 0 on success, a negative AVERROR on error. Libavformat will always - * take care of freeing the packet, even if this function fails. - * - * @see av_write_frame(), AVFormatContext.max_interleave_delta - */ -int av_interleaved_write_frame(AVFormatContext *s, AVPacket *pkt); - -/** - * Write a uncoded frame to an output media file. - * - * The frame must be correctly interleaved according to the container - * specification; if not, then av_interleaved_write_frame() must be used. - * - * See av_interleaved_write_frame() for details. - */ -int av_write_uncoded_frame(AVFormatContext *s, int stream_index, - AVFrame *frame); - -/** - * Write a uncoded frame to an output media file. - * - * If the muxer supports it, this function allows to write an AVFrame - * structure directly, without encoding it into a packet. - * It is mostly useful for devices and similar special muxers that use raw - * video or PCM data and will not serialize it into a byte stream. - * - * To test whether it is possible to use it with a given muxer and stream, - * use av_write_uncoded_frame_query(). - * - * The caller gives up ownership of the frame and must not access it - * afterwards. - * - * @return >=0 for success, a negative code on error - */ -int av_interleaved_write_uncoded_frame(AVFormatContext *s, int stream_index, - AVFrame *frame); - -/** - * Test whether a muxer supports uncoded frame. - * - * @return >=0 if an uncoded frame can be written to that muxer and stream, - * <0 if not - */ -int av_write_uncoded_frame_query(AVFormatContext *s, int stream_index); - -/** - * Write the stream trailer to an output media file and free the - * file private data. - * - * May only be called after a successful call to avformat_write_header. - * - * @param s media file handle - * @return 0 if OK, AVERROR_xxx on error - */ -int av_write_trailer(AVFormatContext *s); - -/** - * Return the output format in the list of registered output formats - * which best matches the provided parameters, or return NULL if - * there is no match. - * - * @param short_name if non-NULL checks if short_name matches with the - * names of the registered formats - * @param filename if non-NULL checks if filename terminates with the - * extensions of the registered formats - * @param mime_type if non-NULL checks if mime_type matches with the - * MIME type of the registered formats - */ -AVOutputFormat *av_guess_format(const char *short_name, - const char *filename, - const char *mime_type); - -/** - * Guess the codec ID based upon muxer and filename. - */ -enum AVCodecID av_guess_codec(AVOutputFormat *fmt, const char *short_name, - const char *filename, const char *mime_type, - enum AVMediaType type); - -/** - * Get timing information for the data currently output. - * The exact meaning of "currently output" depends on the format. - * It is mostly relevant for devices that have an internal buffer and/or - * work in real time. - * @param s media file handle - * @param stream stream in the media file - * @param[out] dts DTS of the last packet output for the stream, in stream - * time_base units - * @param[out] wall absolute time when that packet whas output, - * in microsecond - * @return 0 if OK, AVERROR(ENOSYS) if the format does not support it - * Note: some formats or devices may not allow to measure dts and wall - * atomically. - */ -int av_get_output_timestamp(struct AVFormatContext *s, int stream, - int64_t *dts, int64_t *wall); - - -/** - * @} - */ - - -/** - * @defgroup lavf_misc Utility functions - * @ingroup libavf - * @{ - * - * Miscellaneous utility functions related to both muxing and demuxing - * (or neither). - */ - -/** - * Send a nice hexadecimal dump of a buffer to the specified file stream. - * - * @param f The file stream pointer where the dump should be sent to. - * @param buf buffer - * @param size buffer size - * - * @see av_hex_dump_log, av_pkt_dump2, av_pkt_dump_log2 - */ -void av_hex_dump(FILE *f, const uint8_t *buf, int size); - -/** - * Send a nice hexadecimal dump of a buffer to the log. - * - * @param avcl A pointer to an arbitrary struct of which the first field is a - * pointer to an AVClass struct. - * @param level The importance level of the message, lower values signifying - * higher importance. - * @param buf buffer - * @param size buffer size - * - * @see av_hex_dump, av_pkt_dump2, av_pkt_dump_log2 - */ -void av_hex_dump_log(void *avcl, int level, const uint8_t *buf, int size); - -/** - * Send a nice dump of a packet to the specified file stream. - * - * @param f The file stream pointer where the dump should be sent to. - * @param pkt packet to dump - * @param dump_payload True if the payload must be displayed, too. - * @param st AVStream that the packet belongs to - */ -void av_pkt_dump2(FILE *f, const AVPacket *pkt, int dump_payload, const AVStream *st); - - -/** - * Send a nice dump of a packet to the log. - * - * @param avcl A pointer to an arbitrary struct of which the first field is a - * pointer to an AVClass struct. - * @param level The importance level of the message, lower values signifying - * higher importance. - * @param pkt packet to dump - * @param dump_payload True if the payload must be displayed, too. - * @param st AVStream that the packet belongs to - */ -void av_pkt_dump_log2(void *avcl, int level, const AVPacket *pkt, int dump_payload, - const AVStream *st); - -/** - * Get the AVCodecID for the given codec tag tag. - * If no codec id is found returns AV_CODEC_ID_NONE. - * - * @param tags list of supported codec_id-codec_tag pairs, as stored - * in AVInputFormat.codec_tag and AVOutputFormat.codec_tag - * @param tag codec tag to match to a codec ID - */ -enum AVCodecID av_codec_get_id(const struct AVCodecTag * const *tags, unsigned int tag); - -/** - * Get the codec tag for the given codec id id. - * If no codec tag is found returns 0. - * - * @param tags list of supported codec_id-codec_tag pairs, as stored - * in AVInputFormat.codec_tag and AVOutputFormat.codec_tag - * @param id codec ID to match to a codec tag - */ -unsigned int av_codec_get_tag(const struct AVCodecTag * const *tags, enum AVCodecID id); - -/** - * Get the codec tag for the given codec id. - * - * @param tags list of supported codec_id - codec_tag pairs, as stored - * in AVInputFormat.codec_tag and AVOutputFormat.codec_tag - * @param id codec id that should be searched for in the list - * @param tag A pointer to the found tag - * @return 0 if id was not found in tags, > 0 if it was found - */ -int av_codec_get_tag2(const struct AVCodecTag * const *tags, enum AVCodecID id, - unsigned int *tag); - -int av_find_default_stream_index(AVFormatContext *s); - -/** - * Get the index for a specific timestamp. - * - * @param st stream that the timestamp belongs to - * @param timestamp timestamp to retrieve the index for - * @param flags if AVSEEK_FLAG_BACKWARD then the returned index will correspond - * to the timestamp which is <= the requested one, if backward - * is 0, then it will be >= - * if AVSEEK_FLAG_ANY seek to any frame, only keyframes otherwise - * @return < 0 if no such timestamp could be found - */ -int av_index_search_timestamp(AVStream *st, int64_t timestamp, int flags); - -/** - * Add an index entry into a sorted list. Update the entry if the list - * already contains it. - * - * @param timestamp timestamp in the time base of the given stream - */ -int av_add_index_entry(AVStream *st, int64_t pos, int64_t timestamp, - int size, int distance, int flags); - - -/** - * Split a URL string into components. - * - * The pointers to buffers for storing individual components may be null, - * in order to ignore that component. Buffers for components not found are - * set to empty strings. If the port is not found, it is set to a negative - * value. - * - * @param proto the buffer for the protocol - * @param proto_size the size of the proto buffer - * @param authorization the buffer for the authorization - * @param authorization_size the size of the authorization buffer - * @param hostname the buffer for the host name - * @param hostname_size the size of the hostname buffer - * @param port_ptr a pointer to store the port number in - * @param path the buffer for the path - * @param path_size the size of the path buffer - * @param url the URL to split - */ -void av_url_split(char *proto, int proto_size, - char *authorization, int authorization_size, - char *hostname, int hostname_size, - int *port_ptr, - char *path, int path_size, - const char *url); - -/** - * log a nice Dump of input format context or output format context - * @param ic already initialized Format Context, must not be NULL. - * @param index index of the stream to dump information about - * @param url name of file or URL of stream to print information about - * @param is_output Select whether specified context is of input(0) or output(1) - */ -void av_dump_format(AVFormatContext *ic, - int index, - const char *url, - int is_output); - -/** - * Return in 'buf' the path with '%d' replaced by a number. - * - * Also handles the '%0nd' format where 'n' is the total number - * of digits and '%%'. - * - * @param buf destination buffer - * @param buf_size destination buffer size - * @param path numbered sequence string - * @param number frame number - * @return 0 if OK, -1 on format error - */ -int av_get_frame_filename(char *buf, int buf_size, - const char *path, int number); - -/** - * Check whether filename actually is a numbered sequence generator. - * - * @param filename possible numbered sequence string - * @return 1 if a valid numbered sequence string, 0 otherwise - */ -int av_filename_number_test(const char *filename); - -/** - * Generate an SDP for an RTP session. - * - * Note, this overwrites the id values of AVStreams in the muxer contexts - * for getting unique dynamic payload types. - * - * @param ac array of AVFormatContexts describing the RTP streams. If the - * array is composed by only one context, such context can contain - * multiple AVStreams (one AVStream per RTP stream). Otherwise, - * all the contexts in the array (an AVCodecContext per RTP stream) - * must contain only one AVStream. - * @param n_files number of AVCodecContexts contained in ac - * @param buf buffer where the SDP will be stored (must be allocated by - * the caller) - * @param size the size of the buffer - * @return 0 if OK, AVERROR_xxx on error - */ -int av_sdp_create(AVFormatContext *ac[], int n_files, char *buf, int size); - -/** - * Return a positive value if the given filename has one of the given - * extensions, 0 otherwise. - * - * @param filename file name to check against the given extensions - * @param extensions a comma-separated list of filename extensions - */ -int av_match_ext(const char *filename, const char *extensions); - -/** - * Test if the given container can store a codec. - * - * @param ofmt container to check for compatibility - * @param codec_id codec to potentially store in container - * @param std_compliance standards compliance level, one of FF_COMPLIANCE_* - * - * @return 1 if codec with ID codec_id can be stored in ofmt, 0 if it cannot. - * A negative number if this information is not available. - */ -int avformat_query_codec(AVOutputFormat *ofmt, enum AVCodecID codec_id, int std_compliance); - -/** - * @defgroup riff_fourcc RIFF FourCCs - * @{ - * Get the tables mapping RIFF FourCCs to libavcodec AVCodecIDs. The tables are - * meant to be passed to av_codec_get_id()/av_codec_get_tag() as in the - * following code: - * @code - * uint32_t tag = MKTAG('H', '2', '6', '4'); - * const struct AVCodecTag *table[] = { avformat_get_riff_video_tags(), 0 }; - * enum AVCodecID id = av_codec_get_id(table, tag); - * @endcode - */ -/** - * @return the table mapping RIFF FourCCs for video to libavcodec AVCodecID. - */ -const struct AVCodecTag *avformat_get_riff_video_tags(void); -/** - * @return the table mapping RIFF FourCCs for audio to AVCodecID. - */ -const struct AVCodecTag *avformat_get_riff_audio_tags(void); -/** - * @return the table mapping MOV FourCCs for video to libavcodec AVCodecID. - */ -const struct AVCodecTag *avformat_get_mov_video_tags(void); -/** - * @return the table mapping MOV FourCCs for audio to AVCodecID. - */ -const struct AVCodecTag *avformat_get_mov_audio_tags(void); - -/** - * @} - */ - -/** - * Guess the sample aspect ratio of a frame, based on both the stream and the - * frame aspect ratio. - * - * Since the frame aspect ratio is set by the codec but the stream aspect ratio - * is set by the demuxer, these two may not be equal. This function tries to - * return the value that you should use if you would like to display the frame. - * - * Basic logic is to use the stream aspect ratio if it is set to something sane - * otherwise use the frame aspect ratio. This way a container setting, which is - * usually easy to modify can override the coded value in the frames. - * - * @param format the format context which the stream is part of - * @param stream the stream which the frame is part of - * @param frame the frame with the aspect ratio to be determined - * @return the guessed (valid) sample_aspect_ratio, 0/1 if no idea - */ -AVRational av_guess_sample_aspect_ratio(AVFormatContext *format, AVStream *stream, AVFrame *frame); - -/** - * Guess the frame rate, based on both the container and codec information. - * - * @param ctx the format context which the stream is part of - * @param stream the stream which the frame is part of - * @param frame the frame for which the frame rate should be determined, may be NULL - * @return the guessed (valid) frame rate, 0/1 if no idea - */ -AVRational av_guess_frame_rate(AVFormatContext *ctx, AVStream *stream, AVFrame *frame); - -/** - * Check if the stream st contained in s is matched by the stream specifier - * spec. - * - * See the "stream specifiers" chapter in the documentation for the syntax - * of spec. - * - * @return >0 if st is matched by spec; - * 0 if st is not matched by spec; - * AVERROR code if spec is invalid - * - * @note A stream specifier can match several streams in the format. - */ -int avformat_match_stream_specifier(AVFormatContext *s, AVStream *st, - const char *spec); - -int avformat_queue_attached_pictures(AVFormatContext *s); - - -/** - * @} - */ - -#endif /* AVFORMAT_AVFORMAT_H */ diff --git a/dji_sdk_manifold_read_cam/include/libavformat/avio.h b/dji_sdk_manifold_read_cam/include/libavformat/avio.h deleted file mode 100644 index 4004b6f..0000000 --- a/dji_sdk_manifold_read_cam/include/libavformat/avio.h +++ /dev/null @@ -1,503 +0,0 @@ -/* - * copyright (c) 2001 Fabrice Bellard - * - * This file is part of FFmpeg. - * - * FFmpeg is free software; you can redistribute it and/or - * modify it under the terms of the GNU Lesser General Public - * License as published by the Free Software Foundation; either - * version 2.1 of the License, or (at your option) any later version. - * - * FFmpeg is distributed in the hope that it will be useful, - * but WITHOUT ANY WARRANTY; without even the implied warranty of - * MERCHANTABILITY or FITNESS FOR A PARTICULAR PURPOSE. See the GNU - * Lesser General Public License for more details. - * - * You should have received a copy of the GNU Lesser General Public - * License along with FFmpeg; if not, write to the Free Software - * Foundation, Inc., 51 Franklin Street, Fifth Floor, Boston, MA 02110-1301 USA - */ -#ifndef AVFORMAT_AVIO_H -#define AVFORMAT_AVIO_H - -/** - * @file - * @ingroup lavf_io - * Buffered I/O operations - */ - -#include - -#include "libavutil/common.h" -#include "libavutil/dict.h" -#include "libavutil/log.h" - -#include "libavformat/version.h" - - -#define AVIO_SEEKABLE_NORMAL 0x0001 /**< Seeking works like for a local file */ - -/** - * Callback for checking whether to abort blocking functions. - * AVERROR_EXIT is returned in this case by the interrupted - * function. During blocking operations, callback is called with - * opaque as parameter. If the callback returns 1, the - * blocking operation will be aborted. - * - * No members can be added to this struct without a major bump, if - * new elements have been added after this struct in AVFormatContext - * or AVIOContext. - */ -typedef struct AVIOInterruptCB { - int (*callback)(void*); - void *opaque; -} AVIOInterruptCB; - -/** - * Bytestream IO Context. - * New fields can be added to the end with minor version bumps. - * Removal, reordering and changes to existing fields require a major - * version bump. - * sizeof(AVIOContext) must not be used outside libav*. - * - * @note None of the function pointers in AVIOContext should be called - * directly, they should only be set by the client application - * when implementing custom I/O. Normally these are set to the - * function pointers specified in avio_alloc_context() - */ -typedef struct AVIOContext { - /** - * A class for private options. - * - * If this AVIOContext is created by avio_open2(), av_class is set and - * passes the options down to protocols. - * - * If this AVIOContext is manually allocated, then av_class may be set by - * the caller. - * - * warning -- this field can be NULL, be sure to not pass this AVIOContext - * to any av_opt_* functions in that case. - */ - const AVClass *av_class; - unsigned char *buffer; /**< Start of the buffer. */ - int buffer_size; /**< Maximum buffer size */ - unsigned char *buf_ptr; /**< Current position in the buffer */ - unsigned char *buf_end; /**< End of the data, may be less than - buffer+buffer_size if the read function returned - less data than requested, e.g. for streams where - no more data has been received yet. */ - void *opaque; /**< A private pointer, passed to the read/write/seek/... - functions. */ - int (*read_packet)(void *opaque, uint8_t *buf, int buf_size); - int (*write_packet)(void *opaque, uint8_t *buf, int buf_size); - int64_t (*seek)(void *opaque, int64_t offset, int whence); - int64_t pos; /**< position in the file of the current buffer */ - int must_flush; /**< true if the next seek should flush */ - int eof_reached; /**< true if eof reached */ - int write_flag; /**< true if open for writing */ - int max_packet_size; - unsigned long checksum; - unsigned char *checksum_ptr; - unsigned long (*update_checksum)(unsigned long checksum, const uint8_t *buf, unsigned int size); - int error; /**< contains the error code or 0 if no error happened */ - /** - * Pause or resume playback for network streaming protocols - e.g. MMS. - */ - int (*read_pause)(void *opaque, int pause); - /** - * Seek to a given timestamp in stream with the specified stream_index. - * Needed for some network streaming protocols which don't support seeking - * to byte position. - */ - int64_t (*read_seek)(void *opaque, int stream_index, - int64_t timestamp, int flags); - /** - * A combination of AVIO_SEEKABLE_ flags or 0 when the stream is not seekable. - */ - int seekable; - - /** - * max filesize, used to limit allocations - * This field is internal to libavformat and access from outside is not allowed. - */ - int64_t maxsize; - - /** - * avio_read and avio_write should if possible be satisfied directly - * instead of going through a buffer, and avio_seek will always - * call the underlying seek function directly. - */ - int direct; - - /** - * Bytes read statistic - * This field is internal to libavformat and access from outside is not allowed. - */ - int64_t bytes_read; - - /** - * seek statistic - * This field is internal to libavformat and access from outside is not allowed. - */ - int seek_count; - - /** - * writeout statistic - * This field is internal to libavformat and access from outside is not allowed. - */ - int writeout_count; - - /** - * Original buffer size - * used internally after probing and ensure seekback to reset the buffer size - * This field is internal to libavformat and access from outside is not allowed. - */ - int orig_buffer_size; -} AVIOContext; - -/* unbuffered I/O */ - -/** - * Return the name of the protocol that will handle the passed URL. - * - * NULL is returned if no protocol could be found for the given URL. - * - * @return Name of the protocol or NULL. - */ -const char *avio_find_protocol_name(const char *url); - -/** - * Return AVIO_FLAG_* access flags corresponding to the access permissions - * of the resource in url, or a negative value corresponding to an - * AVERROR code in case of failure. The returned access flags are - * masked by the value in flags. - * - * @note This function is intrinsically unsafe, in the sense that the - * checked resource may change its existence or permission status from - * one call to another. Thus you should not trust the returned value, - * unless you are sure that no other processes are accessing the - * checked resource. - */ -int avio_check(const char *url, int flags); - -/** - * Allocate and initialize an AVIOContext for buffered I/O. It must be later - * freed with av_free(). - * - * @param buffer Memory block for input/output operations via AVIOContext. - * The buffer must be allocated with av_malloc() and friends. - * @param buffer_size The buffer size is very important for performance. - * For protocols with fixed blocksize it should be set to this blocksize. - * For others a typical size is a cache page, e.g. 4kb. - * @param write_flag Set to 1 if the buffer should be writable, 0 otherwise. - * @param opaque An opaque pointer to user-specific data. - * @param read_packet A function for refilling the buffer, may be NULL. - * @param write_packet A function for writing the buffer contents, may be NULL. - * The function may not change the input buffers content. - * @param seek A function for seeking to specified byte position, may be NULL. - * - * @return Allocated AVIOContext or NULL on failure. - */ -AVIOContext *avio_alloc_context( - unsigned char *buffer, - int buffer_size, - int write_flag, - void *opaque, - int (*read_packet)(void *opaque, uint8_t *buf, int buf_size), - int (*write_packet)(void *opaque, uint8_t *buf, int buf_size), - int64_t (*seek)(void *opaque, int64_t offset, int whence)); - -void avio_w8(AVIOContext *s, int b); -void avio_write(AVIOContext *s, const unsigned char *buf, int size); -void avio_wl64(AVIOContext *s, uint64_t val); -void avio_wb64(AVIOContext *s, uint64_t val); -void avio_wl32(AVIOContext *s, unsigned int val); -void avio_wb32(AVIOContext *s, unsigned int val); -void avio_wl24(AVIOContext *s, unsigned int val); -void avio_wb24(AVIOContext *s, unsigned int val); -void avio_wl16(AVIOContext *s, unsigned int val); -void avio_wb16(AVIOContext *s, unsigned int val); - -/** - * Write a NULL-terminated string. - * @return number of bytes written. - */ -int avio_put_str(AVIOContext *s, const char *str); - -/** - * Convert an UTF-8 string to UTF-16LE and write it. - * @return number of bytes written. - */ -int avio_put_str16le(AVIOContext *s, const char *str); - -/** - * Passing this as the "whence" parameter to a seek function causes it to - * return the filesize without seeking anywhere. Supporting this is optional. - * If it is not supported then the seek function will return <0. - */ -#define AVSEEK_SIZE 0x10000 - -/** - * Oring this flag as into the "whence" parameter to a seek function causes it to - * seek by any means (like reopening and linear reading) or other normally unreasonable - * means that can be extremely slow. - * This may be ignored by the seek code. - */ -#define AVSEEK_FORCE 0x20000 - -/** - * fseek() equivalent for AVIOContext. - * @return new position or AVERROR. - */ -int64_t avio_seek(AVIOContext *s, int64_t offset, int whence); - -/** - * Skip given number of bytes forward - * @return new position or AVERROR. - */ -int64_t avio_skip(AVIOContext *s, int64_t offset); - -/** - * ftell() equivalent for AVIOContext. - * @return position or AVERROR. - */ -static av_always_inline int64_t avio_tell(AVIOContext *s) -{ - return avio_seek(s, 0, SEEK_CUR); -} - -/** - * Get the filesize. - * @return filesize or AVERROR - */ -int64_t avio_size(AVIOContext *s); - -/** - * feof() equivalent for AVIOContext. - * @return non zero if and only if end of file - */ -int url_feof(AVIOContext *s); - -/** @warning currently size is limited */ -int avio_printf(AVIOContext *s, const char *fmt, ...) av_printf_format(2, 3); - -/** - * Force flushing of buffered data to the output s. - * - * Force the buffered data to be immediately written to the output, - * without to wait to fill the internal buffer. - */ -void avio_flush(AVIOContext *s); - -/** - * Read size bytes from AVIOContext into buf. - * @return number of bytes read or AVERROR - */ -int avio_read(AVIOContext *s, unsigned char *buf, int size); - -/** - * @name Functions for reading from AVIOContext - * @{ - * - * @note return 0 if EOF, so you cannot use it if EOF handling is - * necessary - */ -int avio_r8 (AVIOContext *s); -unsigned int avio_rl16(AVIOContext *s); -unsigned int avio_rl24(AVIOContext *s); -unsigned int avio_rl32(AVIOContext *s); -uint64_t avio_rl64(AVIOContext *s); -unsigned int avio_rb16(AVIOContext *s); -unsigned int avio_rb24(AVIOContext *s); -unsigned int avio_rb32(AVIOContext *s); -uint64_t avio_rb64(AVIOContext *s); -/** - * @} - */ - -/** - * Read a string from pb into buf. The reading will terminate when either - * a NULL character was encountered, maxlen bytes have been read, or nothing - * more can be read from pb. The result is guaranteed to be NULL-terminated, it - * will be truncated if buf is too small. - * Note that the string is not interpreted or validated in any way, it - * might get truncated in the middle of a sequence for multi-byte encodings. - * - * @return number of bytes read (is always <= maxlen). - * If reading ends on EOF or error, the return value will be one more than - * bytes actually read. - */ -int avio_get_str(AVIOContext *pb, int maxlen, char *buf, int buflen); - -/** - * Read a UTF-16 string from pb and convert it to UTF-8. - * The reading will terminate when either a null or invalid character was - * encountered or maxlen bytes have been read. - * @return number of bytes read (is always <= maxlen) - */ -int avio_get_str16le(AVIOContext *pb, int maxlen, char *buf, int buflen); -int avio_get_str16be(AVIOContext *pb, int maxlen, char *buf, int buflen); - - -/** - * @name URL open modes - * The flags argument to avio_open must be one of the following - * constants, optionally ORed with other flags. - * @{ - */ -#define AVIO_FLAG_READ 1 /**< read-only */ -#define AVIO_FLAG_WRITE 2 /**< write-only */ -#define AVIO_FLAG_READ_WRITE (AVIO_FLAG_READ|AVIO_FLAG_WRITE) /**< read-write pseudo flag */ -/** - * @} - */ - -/** - * Use non-blocking mode. - * If this flag is set, operations on the context will return - * AVERROR(EAGAIN) if they can not be performed immediately. - * If this flag is not set, operations on the context will never return - * AVERROR(EAGAIN). - * Note that this flag does not affect the opening/connecting of the - * context. Connecting a protocol will always block if necessary (e.g. on - * network protocols) but never hang (e.g. on busy devices). - * Warning: non-blocking protocols is work-in-progress; this flag may be - * silently ignored. - */ -#define AVIO_FLAG_NONBLOCK 8 - -/** - * Use direct mode. - * avio_read and avio_write should if possible be satisfied directly - * instead of going through a buffer, and avio_seek will always - * call the underlying seek function directly. - */ -#define AVIO_FLAG_DIRECT 0x8000 - -/** - * Create and initialize a AVIOContext for accessing the - * resource indicated by url. - * @note When the resource indicated by url has been opened in - * read+write mode, the AVIOContext can be used only for writing. - * - * @param s Used to return the pointer to the created AVIOContext. - * In case of failure the pointed to value is set to NULL. - * @param url resource to access - * @param flags flags which control how the resource indicated by url - * is to be opened - * @return >= 0 in case of success, a negative value corresponding to an - * AVERROR code in case of failure - */ -int avio_open(AVIOContext **s, const char *url, int flags); - -/** - * Create and initialize a AVIOContext for accessing the - * resource indicated by url. - * @note When the resource indicated by url has been opened in - * read+write mode, the AVIOContext can be used only for writing. - * - * @param s Used to return the pointer to the created AVIOContext. - * In case of failure the pointed to value is set to NULL. - * @param url resource to access - * @param flags flags which control how the resource indicated by url - * is to be opened - * @param int_cb an interrupt callback to be used at the protocols level - * @param options A dictionary filled with protocol-private options. On return - * this parameter will be destroyed and replaced with a dict containing options - * that were not found. May be NULL. - * @return >= 0 in case of success, a negative value corresponding to an - * AVERROR code in case of failure - */ -int avio_open2(AVIOContext **s, const char *url, int flags, - const AVIOInterruptCB *int_cb, AVDictionary **options); - -/** - * Close the resource accessed by the AVIOContext s and free it. - * This function can only be used if s was opened by avio_open(). - * - * The internal buffer is automatically flushed before closing the - * resource. - * - * @return 0 on success, an AVERROR < 0 on error. - * @see avio_closep - */ -int avio_close(AVIOContext *s); - -/** - * Close the resource accessed by the AVIOContext *s, free it - * and set the pointer pointing to it to NULL. - * This function can only be used if s was opened by avio_open(). - * - * The internal buffer is automatically flushed before closing the - * resource. - * - * @return 0 on success, an AVERROR < 0 on error. - * @see avio_close - */ -int avio_closep(AVIOContext **s); - - -/** - * Open a write only memory stream. - * - * @param s new IO context - * @return zero if no error. - */ -int avio_open_dyn_buf(AVIOContext **s); - -/** - * Return the written size and a pointer to the buffer. The buffer - * must be freed with av_free(). - * Padding of FF_INPUT_BUFFER_PADDING_SIZE is added to the buffer. - * - * @param s IO context - * @param pbuffer pointer to a byte buffer - * @return the length of the byte buffer - */ -int avio_close_dyn_buf(AVIOContext *s, uint8_t **pbuffer); - -/** - * Iterate through names of available protocols. - * - * @param opaque A private pointer representing current protocol. - * It must be a pointer to NULL on first iteration and will - * be updated by successive calls to avio_enum_protocols. - * @param output If set to 1, iterate over output protocols, - * otherwise over input protocols. - * - * @return A static string containing the name of current protocol or NULL - */ -const char *avio_enum_protocols(void **opaque, int output); - -/** - * Pause and resume playing - only meaningful if using a network streaming - * protocol (e.g. MMS). - * - * @param h IO context from which to call the read_pause function pointer - * @param pause 1 for pause, 0 for resume - */ -int avio_pause(AVIOContext *h, int pause); - -/** - * Seek to a given timestamp relative to some component stream. - * Only meaningful if using a network streaming protocol (e.g. MMS.). - * - * @param h IO context from which to call the seek function pointers - * @param stream_index The stream index that the timestamp is relative to. - * If stream_index is (-1) the timestamp should be in AV_TIME_BASE - * units from the beginning of the presentation. - * If a stream_index >= 0 is used and the protocol does not support - * seeking based on component streams, the call will fail. - * @param timestamp timestamp in AVStream.time_base units - * or if there is no stream specified then in AV_TIME_BASE units. - * @param flags Optional combination of AVSEEK_FLAG_BACKWARD, AVSEEK_FLAG_BYTE - * and AVSEEK_FLAG_ANY. The protocol may silently ignore - * AVSEEK_FLAG_BACKWARD and AVSEEK_FLAG_ANY, but AVSEEK_FLAG_BYTE will - * fail if used and not supported. - * @return >= 0 on success - * @see AVInputFormat::read_seek - */ -int64_t avio_seek_time(AVIOContext *h, int stream_index, - int64_t timestamp, int flags); - -#endif /* AVFORMAT_AVIO_H */ diff --git a/dji_sdk_manifold_read_cam/include/libavformat/version.h b/dji_sdk_manifold_read_cam/include/libavformat/version.h deleted file mode 100644 index 8905fb5..0000000 --- a/dji_sdk_manifold_read_cam/include/libavformat/version.h +++ /dev/null @@ -1,79 +0,0 @@ -/* - * Version macros. - * - * This file is part of FFmpeg. - * - * FFmpeg is free software; you can redistribute it and/or - * modify it under the terms of the GNU Lesser General Public - * License as published by the Free Software Foundation; either - * version 2.1 of the License, or (at your option) any later version. - * - * FFmpeg is distributed in the hope that it will be useful, - * but WITHOUT ANY WARRANTY; without even the implied warranty of - * MERCHANTABILITY or FITNESS FOR A PARTICULAR PURPOSE. See the GNU - * Lesser General Public License for more details. - * - * You should have received a copy of the GNU Lesser General Public - * License along with FFmpeg; if not, write to the Free Software - * Foundation, Inc., 51 Franklin Street, Fifth Floor, Boston, MA 02110-1301 USA - */ - -#ifndef AVFORMAT_VERSION_H -#define AVFORMAT_VERSION_H - -/** - * @file - * @ingroup libavf - * Libavformat version macros - */ - -#include "libavutil/version.h" - -#define LIBAVFORMAT_VERSION_MAJOR 55 -#define LIBAVFORMAT_VERSION_MINOR 37 -#define LIBAVFORMAT_VERSION_MICRO 102 - -#define LIBAVFORMAT_VERSION_INT AV_VERSION_INT(LIBAVFORMAT_VERSION_MAJOR, \ - LIBAVFORMAT_VERSION_MINOR, \ - LIBAVFORMAT_VERSION_MICRO) -#define LIBAVFORMAT_VERSION AV_VERSION(LIBAVFORMAT_VERSION_MAJOR, \ - LIBAVFORMAT_VERSION_MINOR, \ - LIBAVFORMAT_VERSION_MICRO) -#define LIBAVFORMAT_BUILD LIBAVFORMAT_VERSION_INT - -#define LIBAVFORMAT_IDENT "Lavf" AV_STRINGIFY(LIBAVFORMAT_VERSION) - -/** - * FF_API_* defines may be placed below to indicate public API that will be - * dropped at a future version bump. The defines themselves are not part of - * the public API and may change, break or disappear at any time. - */ -#ifndef FF_API_REFERENCE_DTS -#define FF_API_REFERENCE_DTS (LIBAVFORMAT_VERSION_MAJOR < 56) -#endif - -#ifndef FF_API_ALLOC_OUTPUT_CONTEXT -#define FF_API_ALLOC_OUTPUT_CONTEXT (LIBAVFORMAT_VERSION_MAJOR < 56) -#endif -#ifndef FF_API_FORMAT_PARAMETERS -#define FF_API_FORMAT_PARAMETERS (LIBAVFORMAT_VERSION_MAJOR < 56) -#endif -#ifndef FF_API_NEW_STREAM -#define FF_API_NEW_STREAM (LIBAVFORMAT_VERSION_MAJOR < 56) -#endif -#ifndef FF_API_SET_PTS_INFO -#define FF_API_SET_PTS_INFO (LIBAVFORMAT_VERSION_MAJOR < 56) -#endif -#ifndef FF_API_CLOSE_INPUT_FILE -#define FF_API_CLOSE_INPUT_FILE (LIBAVFORMAT_VERSION_MAJOR < 56) -#endif -#ifndef FF_API_READ_PACKET -#define FF_API_READ_PACKET (LIBAVFORMAT_VERSION_MAJOR < 56) -#endif -#ifndef FF_API_ASS_SSA -#define FF_API_ASS_SSA (LIBAVFORMAT_VERSION_MAJOR < 56) -#endif -#ifndef FF_API_R_FRAME_RATE -#define FF_API_R_FRAME_RATE 1 -#endif -#endif /* AVFORMAT_VERSION_H */ diff --git a/dji_sdk_manifold_read_cam/include/libavutil/adler32.h b/dji_sdk_manifold_read_cam/include/libavutil/adler32.h deleted file mode 100644 index 0dc69ec..0000000 --- a/dji_sdk_manifold_read_cam/include/libavutil/adler32.h +++ /dev/null @@ -1,55 +0,0 @@ -/* - * copyright (c) 2006 Mans Rullgard - * - * This file is part of FFmpeg. - * - * FFmpeg is free software; you can redistribute it and/or - * modify it under the terms of the GNU Lesser General Public - * License as published by the Free Software Foundation; either - * version 2.1 of the License, or (at your option) any later version. - * - * FFmpeg is distributed in the hope that it will be useful, - * but WITHOUT ANY WARRANTY; without even the implied warranty of - * MERCHANTABILITY or FITNESS FOR A PARTICULAR PURPOSE. See the GNU - * Lesser General Public License for more details. - * - * You should have received a copy of the GNU Lesser General Public - * License along with FFmpeg; if not, write to the Free Software - * Foundation, Inc., 51 Franklin Street, Fifth Floor, Boston, MA 02110-1301 USA - */ - -#ifndef AVUTIL_ADLER32_H -#define AVUTIL_ADLER32_H - -#include -#include "attributes.h" - -/** - * @file - * Public header for libavutil Adler32 hasher - * - * @defgroup lavu_adler32 Adler32 - * @ingroup lavu_crypto - * @{ - */ - -/** - * Calculate the Adler32 checksum of a buffer. - * - * Passing the return value to a subsequent av_adler32_update() call - * allows the checksum of multiple buffers to be calculated as though - * they were concatenated. - * - * @param adler initial checksum value - * @param buf pointer to input buffer - * @param len size of input buffer - * @return updated checksum - */ -unsigned long av_adler32_update(unsigned long adler, const uint8_t *buf, - unsigned int len) av_pure; - -/** - * @} - */ - -#endif /* AVUTIL_ADLER32_H */ diff --git a/dji_sdk_manifold_read_cam/include/libavutil/aes.h b/dji_sdk_manifold_read_cam/include/libavutil/aes.h deleted file mode 100644 index 09efbda..0000000 --- a/dji_sdk_manifold_read_cam/include/libavutil/aes.h +++ /dev/null @@ -1,65 +0,0 @@ -/* - * copyright (c) 2007 Michael Niedermayer - * - * This file is part of FFmpeg. - * - * FFmpeg is free software; you can redistribute it and/or - * modify it under the terms of the GNU Lesser General Public - * License as published by the Free Software Foundation; either - * version 2.1 of the License, or (at your option) any later version. - * - * FFmpeg is distributed in the hope that it will be useful, - * but WITHOUT ANY WARRANTY; without even the implied warranty of - * MERCHANTABILITY or FITNESS FOR A PARTICULAR PURPOSE. See the GNU - * Lesser General Public License for more details. - * - * You should have received a copy of the GNU Lesser General Public - * License along with FFmpeg; if not, write to the Free Software - * Foundation, Inc., 51 Franklin Street, Fifth Floor, Boston, MA 02110-1301 USA - */ - -#ifndef AVUTIL_AES_H -#define AVUTIL_AES_H - -#include - -#include "attributes.h" -#include "version.h" - -/** - * @defgroup lavu_aes AES - * @ingroup lavu_crypto - * @{ - */ - -extern const int av_aes_size; - -struct AVAES; - -/** - * Allocate an AVAES context. - */ -struct AVAES *av_aes_alloc(void); - -/** - * Initialize an AVAES context. - * @param key_bits 128, 192 or 256 - * @param decrypt 0 for encryption, 1 for decryption - */ -int av_aes_init(struct AVAES *a, const uint8_t *key, int key_bits, int decrypt); - -/** - * Encrypt or decrypt a buffer using a previously initialized context. - * @param count number of 16 byte blocks - * @param dst destination array, can be equal to src - * @param src source array, can be equal to dst - * @param iv initialization vector for CBC mode, if NULL then ECB will be used - * @param decrypt 0 for encryption, 1 for decryption - */ -void av_aes_crypt(struct AVAES *a, uint8_t *dst, const uint8_t *src, int count, uint8_t *iv, int decrypt); - -/** - * @} - */ - -#endif /* AVUTIL_AES_H */ diff --git a/dji_sdk_manifold_read_cam/include/libavutil/attributes.h b/dji_sdk_manifold_read_cam/include/libavutil/attributes.h deleted file mode 100644 index 7d3f4a9..0000000 --- a/dji_sdk_manifold_read_cam/include/libavutil/attributes.h +++ /dev/null @@ -1,160 +0,0 @@ -/* - * copyright (c) 2006 Michael Niedermayer - * - * This file is part of FFmpeg. - * - * FFmpeg is free software; you can redistribute it and/or - * modify it under the terms of the GNU Lesser General Public - * License as published by the Free Software Foundation; either - * version 2.1 of the License, or (at your option) any later version. - * - * FFmpeg is distributed in the hope that it will be useful, - * but WITHOUT ANY WARRANTY; without even the implied warranty of - * MERCHANTABILITY or FITNESS FOR A PARTICULAR PURPOSE. See the GNU - * Lesser General Public License for more details. - * - * You should have received a copy of the GNU Lesser General Public - * License along with FFmpeg; if not, write to the Free Software - * Foundation, Inc., 51 Franklin Street, Fifth Floor, Boston, MA 02110-1301 USA - */ - -/** - * @file - * Macro definitions for various function/variable attributes - */ - -#ifndef AVUTIL_ATTRIBUTES_H -#define AVUTIL_ATTRIBUTES_H - -#ifdef __GNUC__ -# define AV_GCC_VERSION_AT_LEAST(x,y) (__GNUC__ > x || __GNUC__ == x && __GNUC_MINOR__ >= y) -#else -# define AV_GCC_VERSION_AT_LEAST(x,y) 0 -#endif - -#ifndef av_always_inline -#if AV_GCC_VERSION_AT_LEAST(3,1) -# define av_always_inline __attribute__((always_inline)) inline -#elif defined(_MSC_VER) -# define av_always_inline __forceinline -#else -# define av_always_inline inline -#endif -#endif - -#ifndef av_extern_inline -#if defined(__ICL) && __ICL >= 1210 || defined(__GNUC_STDC_INLINE__) -# define av_extern_inline extern inline -#else -# define av_extern_inline inline -#endif -#endif - -#if AV_GCC_VERSION_AT_LEAST(3,1) -# define av_noinline __attribute__((noinline)) -#elif defined(_MSC_VER) -# define av_noinline __declspec(noinline) -#else -# define av_noinline -#endif - -#if AV_GCC_VERSION_AT_LEAST(3,1) -# define av_pure __attribute__((pure)) -#else -# define av_pure -#endif - -#if AV_GCC_VERSION_AT_LEAST(2,6) -# define av_const __attribute__((const)) -#else -# define av_const -#endif - -#if AV_GCC_VERSION_AT_LEAST(4,3) -# define av_cold __attribute__((cold)) -#else -# define av_cold -#endif - -#if AV_GCC_VERSION_AT_LEAST(4,1) && !defined(__llvm__) -# define av_flatten __attribute__((flatten)) -#else -# define av_flatten -#endif - -#if AV_GCC_VERSION_AT_LEAST(3,1) -# define attribute_deprecated __attribute__((deprecated)) -#elif defined(_MSC_VER) -# define attribute_deprecated __declspec(deprecated) -#else -# define attribute_deprecated -#endif - -/** - * Disable warnings about deprecated features - * This is useful for sections of code kept for backward compatibility and - * scheduled for removal. - */ -#ifndef AV_NOWARN_DEPRECATED -#if AV_GCC_VERSION_AT_LEAST(4,6) -# define AV_NOWARN_DEPRECATED(code) \ - _Pragma("GCC diagnostic push") \ - _Pragma("GCC diagnostic ignored \"-Wdeprecated-declarations\"") \ - code \ - _Pragma("GCC diagnostic pop") -#elif defined(_MSC_VER) -# define AV_NOWARN_DEPRECATED(code) \ - __pragma(warning(push)) \ - __pragma(warning(disable : 4996)) \ - code; \ - __pragma(warning(pop)) -#else -# define AV_NOWARN_DEPRECATED(code) code -#endif -#endif - - -#if defined(__GNUC__) -# define av_unused __attribute__((unused)) -#else -# define av_unused -#endif - -/** - * Mark a variable as used and prevent the compiler from optimizing it - * away. This is useful for variables accessed only from inline - * assembler without the compiler being aware. - */ -#if AV_GCC_VERSION_AT_LEAST(3,1) -# define av_used __attribute__((used)) -#else -# define av_used -#endif - -#if AV_GCC_VERSION_AT_LEAST(3,3) -# define av_alias __attribute__((may_alias)) -#else -# define av_alias -#endif - -#if defined(__GNUC__) && !defined(__INTEL_COMPILER) && !defined(__clang__) -# define av_uninit(x) x=x -#else -# define av_uninit(x) x -#endif - -#ifdef __GNUC__ -# define av_builtin_constant_p __builtin_constant_p -# define av_printf_format(fmtpos, attrpos) __attribute__((__format__(__printf__, fmtpos, attrpos))) -#else -# define av_builtin_constant_p(x) 0 -# define av_printf_format(fmtpos, attrpos) -#endif - -#if AV_GCC_VERSION_AT_LEAST(2,5) -# define av_noreturn __attribute__((noreturn)) -#else -# define av_noreturn -#endif - -#endif /* AVUTIL_ATTRIBUTES_H */ diff --git a/dji_sdk_manifold_read_cam/include/libavutil/audio_fifo.h b/dji_sdk_manifold_read_cam/include/libavutil/audio_fifo.h deleted file mode 100644 index 903b8f1..0000000 --- a/dji_sdk_manifold_read_cam/include/libavutil/audio_fifo.h +++ /dev/null @@ -1,149 +0,0 @@ -/* - * Audio FIFO - * Copyright (c) 2012 Justin Ruggles - * - * This file is part of FFmpeg. - * - * FFmpeg is free software; you can redistribute it and/or - * modify it under the terms of the GNU Lesser General Public - * License as published by the Free Software Foundation; either - * version 2.1 of the License, or (at your option) any later version. - * - * FFmpeg is distributed in the hope that it will be useful, - * but WITHOUT ANY WARRANTY; without even the implied warranty of - * MERCHANTABILITY or FITNESS FOR A PARTICULAR PURPOSE. See the GNU - * Lesser General Public License for more details. - * - * You should have received a copy of the GNU Lesser General Public - * License along with FFmpeg; if not, write to the Free Software - * Foundation, Inc., 51 Franklin Street, Fifth Floor, Boston, MA 02110-1301 USA - */ - -/** - * @file - * Audio FIFO Buffer - */ - -#ifndef AVUTIL_AUDIO_FIFO_H -#define AVUTIL_AUDIO_FIFO_H - -#include "avutil.h" -#include "fifo.h" -#include "samplefmt.h" - -/** - * @addtogroup lavu_audio - * @{ - */ - -/** - * Context for an Audio FIFO Buffer. - * - * - Operates at the sample level rather than the byte level. - * - Supports multiple channels with either planar or packed sample format. - * - Automatic reallocation when writing to a full buffer. - */ -typedef struct AVAudioFifo AVAudioFifo; - -/** - * Free an AVAudioFifo. - * - * @param af AVAudioFifo to free - */ -void av_audio_fifo_free(AVAudioFifo *af); - -/** - * Allocate an AVAudioFifo. - * - * @param sample_fmt sample format - * @param channels number of channels - * @param nb_samples initial allocation size, in samples - * @return newly allocated AVAudioFifo, or NULL on error - */ -AVAudioFifo *av_audio_fifo_alloc(enum AVSampleFormat sample_fmt, int channels, - int nb_samples); - -/** - * Reallocate an AVAudioFifo. - * - * @param af AVAudioFifo to reallocate - * @param nb_samples new allocation size, in samples - * @return 0 if OK, or negative AVERROR code on failure - */ -int av_audio_fifo_realloc(AVAudioFifo *af, int nb_samples); - -/** - * Write data to an AVAudioFifo. - * - * The AVAudioFifo will be reallocated automatically if the available space - * is less than nb_samples. - * - * @see enum AVSampleFormat - * The documentation for AVSampleFormat describes the data layout. - * - * @param af AVAudioFifo to write to - * @param data audio data plane pointers - * @param nb_samples number of samples to write - * @return number of samples actually written, or negative AVERROR - * code on failure. If successful, the number of samples - * actually written will always be nb_samples. - */ -int av_audio_fifo_write(AVAudioFifo *af, void **data, int nb_samples); - -/** - * Read data from an AVAudioFifo. - * - * @see enum AVSampleFormat - * The documentation for AVSampleFormat describes the data layout. - * - * @param af AVAudioFifo to read from - * @param data audio data plane pointers - * @param nb_samples number of samples to read - * @return number of samples actually read, or negative AVERROR code - * on failure. The number of samples actually read will not - * be greater than nb_samples, and will only be less than - * nb_samples if av_audio_fifo_size is less than nb_samples. - */ -int av_audio_fifo_read(AVAudioFifo *af, void **data, int nb_samples); - -/** - * Drain data from an AVAudioFifo. - * - * Removes the data without reading it. - * - * @param af AVAudioFifo to drain - * @param nb_samples number of samples to drain - * @return 0 if OK, or negative AVERROR code on failure - */ -int av_audio_fifo_drain(AVAudioFifo *af, int nb_samples); - -/** - * Reset the AVAudioFifo buffer. - * - * This empties all data in the buffer. - * - * @param af AVAudioFifo to reset - */ -void av_audio_fifo_reset(AVAudioFifo *af); - -/** - * Get the current number of samples in the AVAudioFifo available for reading. - * - * @param af the AVAudioFifo to query - * @return number of samples available for reading - */ -int av_audio_fifo_size(AVAudioFifo *af); - -/** - * Get the current number of samples in the AVAudioFifo available for writing. - * - * @param af the AVAudioFifo to query - * @return number of samples available for writing - */ -int av_audio_fifo_space(AVAudioFifo *af); - -/** - * @} - */ - -#endif /* AVUTIL_AUDIO_FIFO_H */ diff --git a/dji_sdk_manifold_read_cam/include/libavutil/audioconvert.h b/dji_sdk_manifold_read_cam/include/libavutil/audioconvert.h deleted file mode 100644 index 300a67c..0000000 --- a/dji_sdk_manifold_read_cam/include/libavutil/audioconvert.h +++ /dev/null @@ -1,6 +0,0 @@ - -#include "version.h" - -#if FF_API_AUDIOCONVERT -#include "channel_layout.h" -#endif diff --git a/dji_sdk_manifold_read_cam/include/libavutil/avassert.h b/dji_sdk_manifold_read_cam/include/libavutil/avassert.h deleted file mode 100644 index 41f5e0e..0000000 --- a/dji_sdk_manifold_read_cam/include/libavutil/avassert.h +++ /dev/null @@ -1,66 +0,0 @@ -/* - * copyright (c) 2010 Michael Niedermayer - * - * This file is part of FFmpeg. - * - * FFmpeg is free software; you can redistribute it and/or - * modify it under the terms of the GNU Lesser General Public - * License as published by the Free Software Foundation; either - * version 2.1 of the License, or (at your option) any later version. - * - * FFmpeg is distributed in the hope that it will be useful, - * but WITHOUT ANY WARRANTY; without even the implied warranty of - * MERCHANTABILITY or FITNESS FOR A PARTICULAR PURPOSE. See the GNU - * Lesser General Public License for more details. - * - * You should have received a copy of the GNU Lesser General Public - * License along with FFmpeg; if not, write to the Free Software - * Foundation, Inc., 51 Franklin Street, Fifth Floor, Boston, MA 02110-1301 USA - */ - -/** - * @file - * simple assert() macros that are a bit more flexible than ISO C assert(). - * @author Michael Niedermayer - */ - -#ifndef AVUTIL_AVASSERT_H -#define AVUTIL_AVASSERT_H - -#include -#include "avutil.h" -#include "log.h" - -/** - * assert() equivalent, that is always enabled. - */ -#define av_assert0(cond) do { \ - if (!(cond)) { \ - av_log(NULL, AV_LOG_PANIC, "Assertion %s failed at %s:%d\n", \ - AV_STRINGIFY(cond), __FILE__, __LINE__); \ - abort(); \ - } \ -} while (0) - - -/** - * assert() equivalent, that does not lie in speed critical code. - * These asserts() thus can be enabled without fearing speedloss. - */ -#if defined(ASSERT_LEVEL) && ASSERT_LEVEL > 0 -#define av_assert1(cond) av_assert0(cond) -#else -#define av_assert1(cond) ((void)0) -#endif - - -/** - * assert() equivalent, that does lie in speed critical code. - */ -#if defined(ASSERT_LEVEL) && ASSERT_LEVEL > 1 -#define av_assert2(cond) av_assert0(cond) -#else -#define av_assert2(cond) ((void)0) -#endif - -#endif /* AVUTIL_AVASSERT_H */ diff --git a/dji_sdk_manifold_read_cam/include/libavutil/avconfig.h b/dji_sdk_manifold_read_cam/include/libavutil/avconfig.h deleted file mode 100644 index 36a8cd1..0000000 --- a/dji_sdk_manifold_read_cam/include/libavutil/avconfig.h +++ /dev/null @@ -1,7 +0,0 @@ -/* Generated by ffconf */ -#ifndef AVUTIL_AVCONFIG_H -#define AVUTIL_AVCONFIG_H -#define AV_HAVE_BIGENDIAN 0 -#define AV_HAVE_FAST_UNALIGNED 1 -#define AV_HAVE_INCOMPATIBLE_LIBAV_ABI 0 -#endif /* AVUTIL_AVCONFIG_H */ diff --git a/dji_sdk_manifold_read_cam/include/libavutil/avstring.h b/dji_sdk_manifold_read_cam/include/libavutil/avstring.h deleted file mode 100644 index de2f71d..0000000 --- a/dji_sdk_manifold_read_cam/include/libavutil/avstring.h +++ /dev/null @@ -1,356 +0,0 @@ -/* - * Copyright (c) 2007 Mans Rullgard - * - * This file is part of FFmpeg. - * - * FFmpeg is free software; you can redistribute it and/or - * modify it under the terms of the GNU Lesser General Public - * License as published by the Free Software Foundation; either - * version 2.1 of the License, or (at your option) any later version. - * - * FFmpeg is distributed in the hope that it will be useful, - * but WITHOUT ANY WARRANTY; without even the implied warranty of - * MERCHANTABILITY or FITNESS FOR A PARTICULAR PURPOSE. See the GNU - * Lesser General Public License for more details. - * - * You should have received a copy of the GNU Lesser General Public - * License along with FFmpeg; if not, write to the Free Software - * Foundation, Inc., 51 Franklin Street, Fifth Floor, Boston, MA 02110-1301 USA - */ - -#ifndef AVUTIL_AVSTRING_H -#define AVUTIL_AVSTRING_H - -#include -#include -#include "attributes.h" - -/** - * @addtogroup lavu_string - * @{ - */ - -/** - * Return non-zero if pfx is a prefix of str. If it is, *ptr is set to - * the address of the first character in str after the prefix. - * - * @param str input string - * @param pfx prefix to test - * @param ptr updated if the prefix is matched inside str - * @return non-zero if the prefix matches, zero otherwise - */ -int av_strstart(const char *str, const char *pfx, const char **ptr); - -/** - * Return non-zero if pfx is a prefix of str independent of case. If - * it is, *ptr is set to the address of the first character in str - * after the prefix. - * - * @param str input string - * @param pfx prefix to test - * @param ptr updated if the prefix is matched inside str - * @return non-zero if the prefix matches, zero otherwise - */ -int av_stristart(const char *str, const char *pfx, const char **ptr); - -/** - * Locate the first case-independent occurrence in the string haystack - * of the string needle. A zero-length string needle is considered to - * match at the start of haystack. - * - * This function is a case-insensitive version of the standard strstr(). - * - * @param haystack string to search in - * @param needle string to search for - * @return pointer to the located match within haystack - * or a null pointer if no match - */ -char *av_stristr(const char *haystack, const char *needle); - -/** - * Locate the first occurrence of the string needle in the string haystack - * where not more than hay_length characters are searched. A zero-length - * string needle is considered to match at the start of haystack. - * - * This function is a length-limited version of the standard strstr(). - * - * @param haystack string to search in - * @param needle string to search for - * @param hay_length length of string to search in - * @return pointer to the located match within haystack - * or a null pointer if no match - */ -char *av_strnstr(const char *haystack, const char *needle, size_t hay_length); - -/** - * Copy the string src to dst, but no more than size - 1 bytes, and - * null-terminate dst. - * - * This function is the same as BSD strlcpy(). - * - * @param dst destination buffer - * @param src source string - * @param size size of destination buffer - * @return the length of src - * - * @warning since the return value is the length of src, src absolutely - * _must_ be a properly 0-terminated string, otherwise this will read beyond - * the end of the buffer and possibly crash. - */ -size_t av_strlcpy(char *dst, const char *src, size_t size); - -/** - * Append the string src to the string dst, but to a total length of - * no more than size - 1 bytes, and null-terminate dst. - * - * This function is similar to BSD strlcat(), but differs when - * size <= strlen(dst). - * - * @param dst destination buffer - * @param src source string - * @param size size of destination buffer - * @return the total length of src and dst - * - * @warning since the return value use the length of src and dst, these - * absolutely _must_ be a properly 0-terminated strings, otherwise this - * will read beyond the end of the buffer and possibly crash. - */ -size_t av_strlcat(char *dst, const char *src, size_t size); - -/** - * Append output to a string, according to a format. Never write out of - * the destination buffer, and always put a terminating 0 within - * the buffer. - * @param dst destination buffer (string to which the output is - * appended) - * @param size total size of the destination buffer - * @param fmt printf-compatible format string, specifying how the - * following parameters are used - * @return the length of the string that would have been generated - * if enough space had been available - */ -size_t av_strlcatf(char *dst, size_t size, const char *fmt, ...) av_printf_format(3, 4); - -/** - * Get the count of continuous non zero chars starting from the beginning. - * - * @param len maximum number of characters to check in the string, that - * is the maximum value which is returned by the function - */ -static inline size_t av_strnlen(const char *s, size_t len) -{ - size_t i; - for (i = 0; i < len && s[i]; i++) - ; - return i; -} - -/** - * Print arguments following specified format into a large enough auto - * allocated buffer. It is similar to GNU asprintf(). - * @param fmt printf-compatible format string, specifying how the - * following parameters are used. - * @return the allocated string - * @note You have to free the string yourself with av_free(). - */ -char *av_asprintf(const char *fmt, ...) av_printf_format(1, 2); - -/** - * Convert a number to a av_malloced string. - */ -char *av_d2str(double d); - -/** - * Unescape the given string until a non escaped terminating char, - * and return the token corresponding to the unescaped string. - * - * The normal \ and ' escaping is supported. Leading and trailing - * whitespaces are removed, unless they are escaped with '\' or are - * enclosed between ''. - * - * @param buf the buffer to parse, buf will be updated to point to the - * terminating char - * @param term a 0-terminated list of terminating chars - * @return the malloced unescaped string, which must be av_freed by - * the user, NULL in case of allocation failure - */ -char *av_get_token(const char **buf, const char *term); - -/** - * Split the string into several tokens which can be accessed by - * successive calls to av_strtok(). - * - * A token is defined as a sequence of characters not belonging to the - * set specified in delim. - * - * On the first call to av_strtok(), s should point to the string to - * parse, and the value of saveptr is ignored. In subsequent calls, s - * should be NULL, and saveptr should be unchanged since the previous - * call. - * - * This function is similar to strtok_r() defined in POSIX.1. - * - * @param s the string to parse, may be NULL - * @param delim 0-terminated list of token delimiters, must be non-NULL - * @param saveptr user-provided pointer which points to stored - * information necessary for av_strtok() to continue scanning the same - * string. saveptr is updated to point to the next character after the - * first delimiter found, or to NULL if the string was terminated - * @return the found token, or NULL when no token is found - */ -char *av_strtok(char *s, const char *delim, char **saveptr); - -/** - * Locale-independent conversion of ASCII isdigit. - */ -int av_isdigit(int c); - -/** - * Locale-independent conversion of ASCII isgraph. - */ -int av_isgraph(int c); - -/** - * Locale-independent conversion of ASCII isspace. - */ -int av_isspace(int c); - -/** - * Locale-independent conversion of ASCII characters to uppercase. - */ -static inline int av_toupper(int c) -{ - if (c >= 'a' && c <= 'z') - c ^= 0x20; - return c; -} - -/** - * Locale-independent conversion of ASCII characters to lowercase. - */ -static inline int av_tolower(int c) -{ - if (c >= 'A' && c <= 'Z') - c ^= 0x20; - return c; -} - -/** - * Locale-independent conversion of ASCII isxdigit. - */ -int av_isxdigit(int c); - -/** - * Locale-independent case-insensitive compare. - * @note This means only ASCII-range characters are case-insensitive - */ -int av_strcasecmp(const char *a, const char *b); - -/** - * Locale-independent case-insensitive compare. - * @note This means only ASCII-range characters are case-insensitive - */ -int av_strncasecmp(const char *a, const char *b, size_t n); - - -/** - * Thread safe basename. - * @param path the path, on DOS both \ and / are considered separators. - * @return pointer to the basename substring. - */ -const char *av_basename(const char *path); - -/** - * Thread safe dirname. - * @param path the path, on DOS both \ and / are considered separators. - * @return the path with the separator replaced by the string terminator or ".". - * @note the function may change the input string. - */ -const char *av_dirname(char *path); - -enum AVEscapeMode { - AV_ESCAPE_MODE_AUTO, ///< Use auto-selected escaping mode. - AV_ESCAPE_MODE_BACKSLASH, ///< Use backslash escaping. - AV_ESCAPE_MODE_QUOTE, ///< Use single-quote escaping. -}; - -/** - * Consider spaces special and escape them even in the middle of the - * string. - * - * This is equivalent to adding the whitespace characters to the special - * characters lists, except it is guaranteed to use the exact same list - * of whitespace characters as the rest of libavutil. - */ -#define AV_ESCAPE_FLAG_WHITESPACE 0x01 - -/** - * Escape only specified special characters. - * Without this flag, escape also any characters that may be considered - * special by av_get_token(), such as the single quote. - */ -#define AV_ESCAPE_FLAG_STRICT 0x02 - -/** - * Escape string in src, and put the escaped string in an allocated - * string in *dst, which must be freed with av_free(). - * - * @param dst pointer where an allocated string is put - * @param src string to escape, must be non-NULL - * @param special_chars string containing the special characters which - * need to be escaped, can be NULL - * @param mode escape mode to employ, see AV_ESCAPE_MODE_* macros. - * Any unknown value for mode will be considered equivalent to - * AV_ESCAPE_MODE_BACKSLASH, but this behaviour can change without - * notice. - * @param flags flags which control how to escape, see AV_ESCAPE_FLAG_ macros - * @return the length of the allocated string, or a negative error code in case of error - * @see av_bprint_escape() - */ -int av_escape(char **dst, const char *src, const char *special_chars, - enum AVEscapeMode mode, int flags); - -#define AV_UTF8_FLAG_ACCEPT_INVALID_BIG_CODES 1 ///< accept codepoints over 0x10FFFF -#define AV_UTF8_FLAG_ACCEPT_NON_CHARACTERS 2 ///< accept non-characters - 0xFFFE and 0xFFFF -#define AV_UTF8_FLAG_ACCEPT_SURROGATES 4 ///< accept UTF-16 surrogates codes -#define AV_UTF8_FLAG_EXCLUDE_XML_INVALID_CONTROL_CODES 8 ///< exclude control codes not accepted by XML - -#define AV_UTF8_FLAG_ACCEPT_ALL \ - AV_UTF8_FLAG_ACCEPT_INVALID_BIG_CODES|AV_UTF8_FLAG_ACCEPT_NON_CHARACTERS|AV_UTF8_FLAG_ACCEPT_SURROGATES - -/** - * Read and decode a single UTF-8 code point (character) from the - * buffer in *buf, and update *buf to point to the next byte to - * decode. - * - * In case of an invalid byte sequence, the pointer will be updated to - * the next byte after the invalid sequence and the function will - * return an error code. - * - * Depending on the specified flags, the function will also fail in - * case the decoded code point does not belong to a valid range. - * - * @note For speed-relevant code a carefully implemented use of - * GET_UTF8() may be preferred. - * - * @param codep pointer used to return the parsed code in case of success. - * The value in *codep is set even in case the range check fails. - * @param bufp pointer to the address the first byte of the sequence - * to decode, updated by the function to point to the - * byte next after the decoded sequence - * @param buf_end pointer to the end of the buffer, points to the next - * byte past the last in the buffer. This is used to - * avoid buffer overreads (in case of an unfinished - * UTF-8 sequence towards the end of the buffer). - * @param flags a collection of AV_UTF8_FLAG_* flags - * @return >= 0 in case a sequence was successfully read, a negative - * value in case of invalid sequence - */ -int av_utf8_decode(int32_t *codep, const uint8_t **bufp, const uint8_t *buf_end, - unsigned int flags); - -/** - * @} - */ - -#endif /* AVUTIL_AVSTRING_H */ diff --git a/dji_sdk_manifold_read_cam/include/libavutil/avutil.h b/dji_sdk_manifold_read_cam/include/libavutil/avutil.h deleted file mode 100644 index ba6bb02..0000000 --- a/dji_sdk_manifold_read_cam/include/libavutil/avutil.h +++ /dev/null @@ -1,338 +0,0 @@ -/* - * copyright (c) 2006 Michael Niedermayer - * - * This file is part of FFmpeg. - * - * FFmpeg is free software; you can redistribute it and/or - * modify it under the terms of the GNU Lesser General Public - * License as published by the Free Software Foundation; either - * version 2.1 of the License, or (at your option) any later version. - * - * FFmpeg is distributed in the hope that it will be useful, - * but WITHOUT ANY WARRANTY; without even the implied warranty of - * MERCHANTABILITY or FITNESS FOR A PARTICULAR PURPOSE. See the GNU - * Lesser General Public License for more details. - * - * You should have received a copy of the GNU Lesser General Public - * License along with FFmpeg; if not, write to the Free Software - * Foundation, Inc., 51 Franklin Street, Fifth Floor, Boston, MA 02110-1301 USA - */ - -#ifndef AVUTIL_AVUTIL_H -#define AVUTIL_AVUTIL_H - -/** - * @file - * external API header - */ - -/** - * @mainpage - * - * @section ffmpeg_intro Introduction - * - * This document describes the usage of the different libraries - * provided by FFmpeg. - * - * @li @ref libavc "libavcodec" encoding/decoding library - * @li @ref lavfi "libavfilter" graph-based frame editing library - * @li @ref libavf "libavformat" I/O and muxing/demuxing library - * @li @ref lavd "libavdevice" special devices muxing/demuxing library - * @li @ref lavu "libavutil" common utility library - * @li @ref lswr "libswresample" audio resampling, format conversion and mixing - * @li @ref lpp "libpostproc" post processing library - * @li @ref libsws "libswscale" color conversion and scaling library - * - * @section ffmpeg_versioning Versioning and compatibility - * - * Each of the FFmpeg libraries contains a version.h header, which defines a - * major, minor and micro version number with the - * LIBRARYNAME_VERSION_{MAJOR,MINOR,MICRO} macros. The major version - * number is incremented with backward incompatible changes - e.g. removing - * parts of the public API, reordering public struct members, etc. The minor - * version number is incremented for backward compatible API changes or major - * new features - e.g. adding a new public function or a new decoder. The micro - * version number is incremented for smaller changes that a calling program - * might still want to check for - e.g. changing behavior in a previously - * unspecified situation. - * - * FFmpeg guarantees backward API and ABI compatibility for each library as long - * as its major version number is unchanged. This means that no public symbols - * will be removed or renamed. Types and names of the public struct members and - * values of public macros and enums will remain the same (unless they were - * explicitly declared as not part of the public API). Documented behavior will - * not change. - * - * In other words, any correct program that works with a given FFmpeg snapshot - * should work just as well without any changes with any later snapshot with the - * same major versions. This applies to both rebuilding the program against new - * FFmpeg versions or to replacing the dynamic FFmpeg libraries that a program - * links against. - * - * However, new public symbols may be added and new members may be appended to - * public structs whose size is not part of public ABI (most public structs in - * FFmpeg). New macros and enum values may be added. Behavior in undocumented - * situations may change slightly (and be documented). All those are accompanied - * by an entry in doc/APIchanges and incrementing either the minor or micro - * version number. - */ - -/** - * @defgroup lavu Common utility functions - * - * @brief - * libavutil contains the code shared across all the other FFmpeg - * libraries - * - * @note In order to use the functions provided by avutil you must include - * the specific header. - * - * @{ - * - * @defgroup lavu_crypto Crypto and Hashing - * - * @{ - * @} - * - * @defgroup lavu_math Maths - * @{ - * - * @} - * - * @defgroup lavu_string String Manipulation - * - * @{ - * - * @} - * - * @defgroup lavu_mem Memory Management - * - * @{ - * - * @} - * - * @defgroup lavu_data Data Structures - * @{ - * - * @} - * - * @defgroup lavu_audio Audio related - * - * @{ - * - * @} - * - * @defgroup lavu_error Error Codes - * - * @{ - * - * @} - * - * @defgroup lavu_log Logging Facility - * - * @{ - * - * @} - * - * @defgroup lavu_misc Other - * - * @{ - * - * @defgroup lavu_internal Internal - * - * Not exported functions, for internal usage only - * - * @{ - * - * @} - * - * @defgroup preproc_misc Preprocessor String Macros - * - * @{ - * - * @} - */ - - -/** - * @addtogroup lavu_ver - * @{ - */ - -/** - * Return the LIBAVUTIL_VERSION_INT constant. - */ -unsigned avutil_version(void); - -/** - * Return the libavutil build-time configuration. - */ -const char *avutil_configuration(void); - -/** - * Return the libavutil license. - */ -const char *avutil_license(void); - -/** - * @} - */ - -/** - * @addtogroup lavu_media Media Type - * @brief Media Type - */ - -enum AVMediaType { - AVMEDIA_TYPE_UNKNOWN = -1, ///< Usually treated as AVMEDIA_TYPE_DATA - AVMEDIA_TYPE_VIDEO, - AVMEDIA_TYPE_AUDIO, - AVMEDIA_TYPE_DATA, ///< Opaque data information usually continuous - AVMEDIA_TYPE_SUBTITLE, - AVMEDIA_TYPE_ATTACHMENT, ///< Opaque data information usually sparse - AVMEDIA_TYPE_NB -}; - -/** - * Return a string describing the media_type enum, NULL if media_type - * is unknown. - */ -const char *av_get_media_type_string(enum AVMediaType media_type); - -/** - * @defgroup lavu_const Constants - * @{ - * - * @defgroup lavu_enc Encoding specific - * - * @note those definition should move to avcodec - * @{ - */ - -#define FF_LAMBDA_SHIFT 7 -#define FF_LAMBDA_SCALE (1< - -/** - * @defgroup lavu_base64 Base64 - * @ingroup lavu_crypto - * @{ - */ - - -/** - * Decode a base64-encoded string. - * - * @param out buffer for decoded data - * @param in null-terminated input string - * @param out_size size in bytes of the out buffer, must be at - * least 3/4 of the length of in - * @return number of bytes written, or a negative value in case of - * invalid input - */ -int av_base64_decode(uint8_t *out, const char *in, int out_size); - -/** - * Encode data to base64 and null-terminate. - * - * @param out buffer for encoded data - * @param out_size size in bytes of the out buffer (including the - * null terminator), must be at least AV_BASE64_SIZE(in_size) - * @param in input buffer containing the data to encode - * @param in_size size in bytes of the in buffer - * @return out or NULL in case of error - */ -char *av_base64_encode(char *out, int out_size, const uint8_t *in, int in_size); - -/** - * Calculate the output size needed to base64-encode x bytes to a - * null-terminated string. - */ -#define AV_BASE64_SIZE(x) (((x)+2) / 3 * 4 + 1) - - /** - * @} - */ - -#endif /* AVUTIL_BASE64_H */ diff --git a/dji_sdk_manifold_read_cam/include/libavutil/blowfish.h b/dji_sdk_manifold_read_cam/include/libavutil/blowfish.h deleted file mode 100644 index 0b00453..0000000 --- a/dji_sdk_manifold_read_cam/include/libavutil/blowfish.h +++ /dev/null @@ -1,77 +0,0 @@ -/* - * Blowfish algorithm - * Copyright (c) 2012 Samuel Pitoiset - * - * This file is part of FFmpeg. - * - * FFmpeg is free software; you can redistribute it and/or - * modify it under the terms of the GNU Lesser General Public - * License as published by the Free Software Foundation; either - * version 2.1 of the License, or (at your option) any later version. - * - * FFmpeg is distributed in the hope that it will be useful, - * but WITHOUT ANY WARRANTY; without even the implied warranty of - * MERCHANTABILITY or FITNESS FOR A PARTICULAR PURPOSE. See the GNU - * Lesser General Public License for more details. - * - * You should have received a copy of the GNU Lesser General Public - * License along with FFmpeg; if not, write to the Free Software - * Foundation, Inc., 51 Franklin Street, Fifth Floor, Boston, MA 02110-1301 USA - */ - -#ifndef AVUTIL_BLOWFISH_H -#define AVUTIL_BLOWFISH_H - -#include - -/** - * @defgroup lavu_blowfish Blowfish - * @ingroup lavu_crypto - * @{ - */ - -#define AV_BF_ROUNDS 16 - -typedef struct AVBlowfish { - uint32_t p[AV_BF_ROUNDS + 2]; - uint32_t s[4][256]; -} AVBlowfish; - -/** - * Initialize an AVBlowfish context. - * - * @param ctx an AVBlowfish context - * @param key a key - * @param key_len length of the key - */ -void av_blowfish_init(struct AVBlowfish *ctx, const uint8_t *key, int key_len); - -/** - * Encrypt or decrypt a buffer using a previously initialized context. - * - * @param ctx an AVBlowfish context - * @param xl left four bytes halves of input to be encrypted - * @param xr right four bytes halves of input to be encrypted - * @param decrypt 0 for encryption, 1 for decryption - */ -void av_blowfish_crypt_ecb(struct AVBlowfish *ctx, uint32_t *xl, uint32_t *xr, - int decrypt); - -/** - * Encrypt or decrypt a buffer using a previously initialized context. - * - * @param ctx an AVBlowfish context - * @param dst destination array, can be equal to src - * @param src source array, can be equal to dst - * @param count number of 8 byte blocks - * @param iv initialization vector for CBC mode, if NULL ECB will be used - * @param decrypt 0 for encryption, 1 for decryption - */ -void av_blowfish_crypt(struct AVBlowfish *ctx, uint8_t *dst, const uint8_t *src, - int count, uint8_t *iv, int decrypt); - -/** - * @} - */ - -#endif /* AVUTIL_BLOWFISH_H */ diff --git a/dji_sdk_manifold_read_cam/include/libavutil/bprint.h b/dji_sdk_manifold_read_cam/include/libavutil/bprint.h deleted file mode 100644 index 839ec1e..0000000 --- a/dji_sdk_manifold_read_cam/include/libavutil/bprint.h +++ /dev/null @@ -1,216 +0,0 @@ -/* - * Copyright (c) 2012 Nicolas George - * - * This file is part of FFmpeg. - * - * FFmpeg is free software; you can redistribute it and/or - * modify it under the terms of the GNU Lesser General Public - * License as published by the Free Software Foundation; either - * version 2.1 of the License, or (at your option) any later version. - * - * FFmpeg is distributed in the hope that it will be useful, - * but WITHOUT ANY WARRANTY; without even the implied warranty of - * MERCHANTABILITY or FITNESS FOR A PARTICULAR PURPOSE. See the GNU - * Lesser General Public License for more details. - * - * You should have received a copy of the GNU Lesser General Public - * License along with FFmpeg; if not, write to the Free Software - * Foundation, Inc., 51 Franklin Street, Fifth Floor, Boston, MA 02110-1301 USA - */ - -#ifndef AVUTIL_BPRINT_H -#define AVUTIL_BPRINT_H - -#include - -#include "attributes.h" -#include "avstring.h" - -/** - * Define a structure with extra padding to a fixed size - * This helps ensuring binary compatibility with future versions. - */ -#define FF_PAD_STRUCTURE(size, ...) \ - __VA_ARGS__ \ - char reserved_padding[size - sizeof(struct { __VA_ARGS__ })]; - -/** - * Buffer to print data progressively - * - * The string buffer grows as necessary and is always 0-terminated. - * The content of the string is never accessed, and thus is - * encoding-agnostic and can even hold binary data. - * - * Small buffers are kept in the structure itself, and thus require no - * memory allocation at all (unless the contents of the buffer is needed - * after the structure goes out of scope). This is almost as lightweight as - * declaring a local "char buf[512]". - * - * The length of the string can go beyond the allocated size: the buffer is - * then truncated, but the functions still keep account of the actual total - * length. - * - * In other words, buf->len can be greater than buf->size and records the - * total length of what would have been to the buffer if there had been - * enough memory. - * - * Append operations do not need to be tested for failure: if a memory - * allocation fails, data stop being appended to the buffer, but the length - * is still updated. This situation can be tested with - * av_bprint_is_complete(). - * - * The size_max field determines several possible behaviours: - * - * size_max = -1 (= UINT_MAX) or any large value will let the buffer be - * reallocated as necessary, with an amortized linear cost. - * - * size_max = 0 prevents writing anything to the buffer: only the total - * length is computed. The write operations can then possibly be repeated in - * a buffer with exactly the necessary size - * (using size_init = size_max = len + 1). - * - * size_max = 1 is automatically replaced by the exact size available in the - * structure itself, thus ensuring no dynamic memory allocation. The - * internal buffer is large enough to hold a reasonable paragraph of text, - * such as the current paragraph. - */ -typedef struct AVBPrint { - FF_PAD_STRUCTURE(1024, - char *str; /**< string so far */ - unsigned len; /**< length so far */ - unsigned size; /**< allocated memory */ - unsigned size_max; /**< maximum allocated memory */ - char reserved_internal_buffer[1]; - ) -} AVBPrint; - -/** - * Convenience macros for special values for av_bprint_init() size_max - * parameter. - */ -#define AV_BPRINT_SIZE_UNLIMITED ((unsigned)-1) -#define AV_BPRINT_SIZE_AUTOMATIC 1 -#define AV_BPRINT_SIZE_COUNT_ONLY 0 - -/** - * Init a print buffer. - * - * @param buf buffer to init - * @param size_init initial size (including the final 0) - * @param size_max maximum size; - * 0 means do not write anything, just count the length; - * 1 is replaced by the maximum value for automatic storage; - * any large value means that the internal buffer will be - * reallocated as needed up to that limit; -1 is converted to - * UINT_MAX, the largest limit possible. - * Check also AV_BPRINT_SIZE_* macros. - */ -void av_bprint_init(AVBPrint *buf, unsigned size_init, unsigned size_max); - -/** - * Init a print buffer using a pre-existing buffer. - * - * The buffer will not be reallocated. - * - * @param buf buffer structure to init - * @param buffer byte buffer to use for the string data - * @param size size of buffer - */ -void av_bprint_init_for_buffer(AVBPrint *buf, char *buffer, unsigned size); - -/** - * Append a formatted string to a print buffer. - */ -void av_bprintf(AVBPrint *buf, const char *fmt, ...) av_printf_format(2, 3); - -/** - * Append a formatted string to a print buffer. - */ -void av_vbprintf(AVBPrint *buf, const char *fmt, va_list vl_arg); - -/** - * Append char c n times to a print buffer. - */ -void av_bprint_chars(AVBPrint *buf, char c, unsigned n); - -/** - * Append data to a print buffer. - * - * param buf bprint buffer to use - * param data pointer to data - * param size size of data - */ -void av_bprint_append_data(AVBPrint *buf, const char *data, unsigned size); - -struct tm; -/** - * Append a formatted date and time to a print buffer. - * - * param buf bprint buffer to use - * param fmt date and time format string, see strftime() - * param tm broken-down time structure to translate - * - * @note due to poor design of the standard strftime function, it may - * produce poor results if the format string expands to a very long text and - * the bprint buffer is near the limit stated by the size_max option. - */ -void av_bprint_strftime(AVBPrint *buf, const char *fmt, const struct tm *tm); - -/** - * Allocate bytes in the buffer for external use. - * - * @param[in] buf buffer structure - * @param[in] size required size - * @param[out] mem pointer to the memory area - * @param[out] actual_size size of the memory area after allocation; - * can be larger or smaller than size - */ -void av_bprint_get_buffer(AVBPrint *buf, unsigned size, - unsigned char **mem, unsigned *actual_size); - -/** - * Reset the string to "" but keep internal allocated data. - */ -void av_bprint_clear(AVBPrint *buf); - -/** - * Test if the print buffer is complete (not truncated). - * - * It may have been truncated due to a memory allocation failure - * or the size_max limit (compare size and size_max if necessary). - */ -static inline int av_bprint_is_complete(AVBPrint *buf) -{ - return buf->len < buf->size; -} - -/** - * Finalize a print buffer. - * - * The print buffer can no longer be used afterwards, - * but the len and size fields are still valid. - * - * @arg[out] ret_str if not NULL, used to return a permanent copy of the - * buffer contents, or NULL if memory allocation fails; - * if NULL, the buffer is discarded and freed - * @return 0 for success or error code (probably AVERROR(ENOMEM)) - */ -int av_bprint_finalize(AVBPrint *buf, char **ret_str); - -/** - * Escape the content in src and append it to dstbuf. - * - * @param dstbuf already inited destination bprint buffer - * @param src string containing the text to escape - * @param special_chars string containing the special characters which - * need to be escaped, can be NULL - * @param mode escape mode to employ, see AV_ESCAPE_MODE_* macros. - * Any unknown value for mode will be considered equivalent to - * AV_ESCAPE_MODE_BACKSLASH, but this behaviour can change without - * notice. - * @param flags flags which control how to escape, see AV_ESCAPE_FLAG_* macros - */ -void av_bprint_escape(AVBPrint *dstbuf, const char *src, const char *special_chars, - enum AVEscapeMode mode, int flags); - -#endif /* AVUTIL_BPRINT_H */ diff --git a/dji_sdk_manifold_read_cam/include/libavutil/bswap.h b/dji_sdk_manifold_read_cam/include/libavutil/bswap.h deleted file mode 100644 index f38e1de..0000000 --- a/dji_sdk_manifold_read_cam/include/libavutil/bswap.h +++ /dev/null @@ -1,111 +0,0 @@ -/* - * copyright (c) 2006 Michael Niedermayer - * - * This file is part of FFmpeg. - * - * FFmpeg is free software; you can redistribute it and/or - * modify it under the terms of the GNU Lesser General Public - * License as published by the Free Software Foundation; either - * version 2.1 of the License, or (at your option) any later version. - * - * FFmpeg is distributed in the hope that it will be useful, - * but WITHOUT ANY WARRANTY; without even the implied warranty of - * MERCHANTABILITY or FITNESS FOR A PARTICULAR PURPOSE. See the GNU - * Lesser General Public License for more details. - * - * You should have received a copy of the GNU Lesser General Public - * License along with FFmpeg; if not, write to the Free Software - * Foundation, Inc., 51 Franklin Street, Fifth Floor, Boston, MA 02110-1301 USA - */ - -/** - * @file - * byte swapping routines - */ - -#ifndef AVUTIL_BSWAP_H -#define AVUTIL_BSWAP_H - -#include -#include "libavutil/avconfig.h" -#include "attributes.h" - -#ifdef HAVE_AV_CONFIG_H - -#include "config.h" - -#if ARCH_AARCH64 -# include "aarch64/bswap.h" -#elif ARCH_ARM -# include "arm/bswap.h" -#elif ARCH_AVR32 -# include "avr32/bswap.h" -#elif ARCH_BFIN -# include "bfin/bswap.h" -#elif ARCH_SH4 -# include "sh4/bswap.h" -#elif ARCH_X86 -# include "x86/bswap.h" -#endif - -#endif /* HAVE_AV_CONFIG_H */ - -#define AV_BSWAP16C(x) (((x) << 8 & 0xff00) | ((x) >> 8 & 0x00ff)) -#define AV_BSWAP32C(x) (AV_BSWAP16C(x) << 16 | AV_BSWAP16C((x) >> 16)) -#define AV_BSWAP64C(x) (AV_BSWAP32C(x) << 32 | AV_BSWAP32C((x) >> 32)) - -#define AV_BSWAPC(s, x) AV_BSWAP##s##C(x) - -#ifndef av_bswap16 -static av_always_inline av_const uint16_t av_bswap16(uint16_t x) -{ - x= (x>>8) | (x<<8); - return x; -} -#endif - -#ifndef av_bswap32 -static av_always_inline av_const uint32_t av_bswap32(uint32_t x) -{ - return AV_BSWAP32C(x); -} -#endif - -#ifndef av_bswap64 -static inline uint64_t av_const av_bswap64(uint64_t x) -{ - return (uint64_t)av_bswap32(x) << 32 | av_bswap32(x >> 32); -} -#endif - -// be2ne ... big-endian to native-endian -// le2ne ... little-endian to native-endian - -#if AV_HAVE_BIGENDIAN -#define av_be2ne16(x) (x) -#define av_be2ne32(x) (x) -#define av_be2ne64(x) (x) -#define av_le2ne16(x) av_bswap16(x) -#define av_le2ne32(x) av_bswap32(x) -#define av_le2ne64(x) av_bswap64(x) -#define AV_BE2NEC(s, x) (x) -#define AV_LE2NEC(s, x) AV_BSWAPC(s, x) -#else -#define av_be2ne16(x) av_bswap16(x) -#define av_be2ne32(x) av_bswap32(x) -#define av_be2ne64(x) av_bswap64(x) -#define av_le2ne16(x) (x) -#define av_le2ne32(x) (x) -#define av_le2ne64(x) (x) -#define AV_BE2NEC(s, x) AV_BSWAPC(s, x) -#define AV_LE2NEC(s, x) (x) -#endif - -#define AV_BE2NE16C(x) AV_BE2NEC(16, x) -#define AV_BE2NE32C(x) AV_BE2NEC(32, x) -#define AV_BE2NE64C(x) AV_BE2NEC(64, x) -#define AV_LE2NE16C(x) AV_LE2NEC(16, x) -#define AV_LE2NE32C(x) AV_LE2NEC(32, x) -#define AV_LE2NE64C(x) AV_LE2NEC(64, x) - -#endif /* AVUTIL_BSWAP_H */ diff --git a/dji_sdk_manifold_read_cam/include/libavutil/buffer.h b/dji_sdk_manifold_read_cam/include/libavutil/buffer.h deleted file mode 100644 index b4399fd..0000000 --- a/dji_sdk_manifold_read_cam/include/libavutil/buffer.h +++ /dev/null @@ -1,274 +0,0 @@ -/* - * This file is part of FFmpeg. - * - * FFmpeg is free software; you can redistribute it and/or - * modify it under the terms of the GNU Lesser General Public - * License as published by the Free Software Foundation; either - * version 2.1 of the License, or (at your option) any later version. - * - * FFmpeg is distributed in the hope that it will be useful, - * but WITHOUT ANY WARRANTY; without even the implied warranty of - * MERCHANTABILITY or FITNESS FOR A PARTICULAR PURPOSE. See the GNU - * Lesser General Public License for more details. - * - * You should have received a copy of the GNU Lesser General Public - * License along with FFmpeg; if not, write to the Free Software - * Foundation, Inc., 51 Franklin Street, Fifth Floor, Boston, MA 02110-1301 USA - */ - -/** - * @file - * @ingroup lavu_buffer - * refcounted data buffer API - */ - -#ifndef AVUTIL_BUFFER_H -#define AVUTIL_BUFFER_H - -#include - -/** - * @defgroup lavu_buffer AVBuffer - * @ingroup lavu_data - * - * @{ - * AVBuffer is an API for reference-counted data buffers. - * - * There are two core objects in this API -- AVBuffer and AVBufferRef. AVBuffer - * represents the data buffer itself; it is opaque and not meant to be accessed - * by the caller directly, but only through AVBufferRef. However, the caller may - * e.g. compare two AVBuffer pointers to check whether two different references - * are describing the same data buffer. AVBufferRef represents a single - * reference to an AVBuffer and it is the object that may be manipulated by the - * caller directly. - * - * There are two functions provided for creating a new AVBuffer with a single - * reference -- av_buffer_alloc() to just allocate a new buffer, and - * av_buffer_create() to wrap an existing array in an AVBuffer. From an existing - * reference, additional references may be created with av_buffer_ref(). - * Use av_buffer_unref() to free a reference (this will automatically free the - * data once all the references are freed). - * - * The convention throughout this API and the rest of FFmpeg is such that the - * buffer is considered writable if there exists only one reference to it (and - * it has not been marked as read-only). The av_buffer_is_writable() function is - * provided to check whether this is true and av_buffer_make_writable() will - * automatically create a new writable buffer when necessary. - * Of course nothing prevents the calling code from violating this convention, - * however that is safe only when all the existing references are under its - * control. - * - * @note Referencing and unreferencing the buffers is thread-safe and thus - * may be done from multiple threads simultaneously without any need for - * additional locking. - * - * @note Two different references to the same buffer can point to different - * parts of the buffer (i.e. their AVBufferRef.data will not be equal). - */ - -/** - * A reference counted buffer type. It is opaque and is meant to be used through - * references (AVBufferRef). - */ -typedef struct AVBuffer AVBuffer; - -/** - * A reference to a data buffer. - * - * The size of this struct is not a part of the public ABI and it is not meant - * to be allocated directly. - */ -typedef struct AVBufferRef { - AVBuffer *buffer; - - /** - * The data buffer. It is considered writable if and only if - * this is the only reference to the buffer, in which case - * av_buffer_is_writable() returns 1. - */ - uint8_t *data; - /** - * Size of data in bytes. - */ - int size; -} AVBufferRef; - -/** - * Allocate an AVBuffer of the given size using av_malloc(). - * - * @return an AVBufferRef of given size or NULL when out of memory - */ -AVBufferRef *av_buffer_alloc(int size); - -/** - * Same as av_buffer_alloc(), except the returned buffer will be initialized - * to zero. - */ -AVBufferRef *av_buffer_allocz(int size); - -/** - * Always treat the buffer as read-only, even when it has only one - * reference. - */ -#define AV_BUFFER_FLAG_READONLY (1 << 0) - -/** - * Create an AVBuffer from an existing array. - * - * If this function is successful, data is owned by the AVBuffer. The caller may - * only access data through the returned AVBufferRef and references derived from - * it. - * If this function fails, data is left untouched. - * @param data data array - * @param size size of data in bytes - * @param free a callback for freeing this buffer's data - * @param opaque parameter to be got for processing or passed to free - * @param flags a combination of AV_BUFFER_FLAG_* - * - * @return an AVBufferRef referring to data on success, NULL on failure. - */ -AVBufferRef *av_buffer_create(uint8_t *data, int size, - void (*free)(void *opaque, uint8_t *data), - void *opaque, int flags); - -/** - * Default free callback, which calls av_free() on the buffer data. - * This function is meant to be passed to av_buffer_create(), not called - * directly. - */ -void av_buffer_default_free(void *opaque, uint8_t *data); - -/** - * Create a new reference to an AVBuffer. - * - * @return a new AVBufferRef referring to the same AVBuffer as buf or NULL on - * failure. - */ -AVBufferRef *av_buffer_ref(AVBufferRef *buf); - -/** - * Free a given reference and automatically free the buffer if there are no more - * references to it. - * - * @param buf the reference to be freed. The pointer is set to NULL on return. - */ -void av_buffer_unref(AVBufferRef **buf); - -/** - * @return 1 if the caller may write to the data referred to by buf (which is - * true if and only if buf is the only reference to the underlying AVBuffer). - * Return 0 otherwise. - * A positive answer is valid until av_buffer_ref() is called on buf. - */ -int av_buffer_is_writable(const AVBufferRef *buf); - -/** - * @return the opaque parameter set by av_buffer_create. - */ -void *av_buffer_get_opaque(const AVBufferRef *buf); - -int av_buffer_get_ref_count(const AVBufferRef *buf); - -/** - * Create a writable reference from a given buffer reference, avoiding data copy - * if possible. - * - * @param buf buffer reference to make writable. On success, buf is either left - * untouched, or it is unreferenced and a new writable AVBufferRef is - * written in its place. On failure, buf is left untouched. - * @return 0 on success, a negative AVERROR on failure. - */ -int av_buffer_make_writable(AVBufferRef **buf); - -/** - * Reallocate a given buffer. - * - * @param buf a buffer reference to reallocate. On success, buf will be - * unreferenced and a new reference with the required size will be - * written in its place. On failure buf will be left untouched. *buf - * may be NULL, then a new buffer is allocated. - * @param size required new buffer size. - * @return 0 on success, a negative AVERROR on failure. - * - * @note the buffer is actually reallocated with av_realloc() only if it was - * initially allocated through av_buffer_realloc(NULL) and there is only one - * reference to it (i.e. the one passed to this function). In all other cases - * a new buffer is allocated and the data is copied. - */ -int av_buffer_realloc(AVBufferRef **buf, int size); - -/** - * @} - */ - -/** - * @defgroup lavu_bufferpool AVBufferPool - * @ingroup lavu_data - * - * @{ - * AVBufferPool is an API for a lock-free thread-safe pool of AVBuffers. - * - * Frequently allocating and freeing large buffers may be slow. AVBufferPool is - * meant to solve this in cases when the caller needs a set of buffers of the - * same size (the most obvious use case being buffers for raw video or audio - * frames). - * - * At the beginning, the user must call av_buffer_pool_init() to create the - * buffer pool. Then whenever a buffer is needed, call av_buffer_pool_get() to - * get a reference to a new buffer, similar to av_buffer_alloc(). This new - * reference works in all aspects the same way as the one created by - * av_buffer_alloc(). However, when the last reference to this buffer is - * unreferenced, it is returned to the pool instead of being freed and will be - * reused for subsequent av_buffer_pool_get() calls. - * - * When the caller is done with the pool and no longer needs to allocate any new - * buffers, av_buffer_pool_uninit() must be called to mark the pool as freeable. - * Once all the buffers are released, it will automatically be freed. - * - * Allocating and releasing buffers with this API is thread-safe as long as - * either the default alloc callback is used, or the user-supplied one is - * thread-safe. - */ - -/** - * The buffer pool. This structure is opaque and not meant to be accessed - * directly. It is allocated with av_buffer_pool_init() and freed with - * av_buffer_pool_uninit(). - */ -typedef struct AVBufferPool AVBufferPool; - -/** - * Allocate and initialize a buffer pool. - * - * @param size size of each buffer in this pool - * @param alloc a function that will be used to allocate new buffers when the - * pool is empty. May be NULL, then the default allocator will be used - * (av_buffer_alloc()). - * @return newly created buffer pool on success, NULL on error. - */ -AVBufferPool *av_buffer_pool_init(int size, AVBufferRef* (*alloc)(int size)); - -/** - * Mark the pool as being available for freeing. It will actually be freed only - * once all the allocated buffers associated with the pool are released. Thus it - * is safe to call this function while some of the allocated buffers are still - * in use. - * - * @param pool pointer to the pool to be freed. It will be set to NULL. - * @see av_buffer_pool_can_uninit() - */ -void av_buffer_pool_uninit(AVBufferPool **pool); - -/** - * Allocate a new AVBuffer, reusing an old buffer from the pool when available. - * This function may be called simultaneously from multiple threads. - * - * @return a reference to the new buffer on success, NULL on error. - */ -AVBufferRef *av_buffer_pool_get(AVBufferPool *pool); - -/** - * @} - */ - -#endif /* AVUTIL_BUFFER_H */ diff --git a/dji_sdk_manifold_read_cam/include/libavutil/channel_layout.h b/dji_sdk_manifold_read_cam/include/libavutil/channel_layout.h deleted file mode 100644 index bc6befd..0000000 --- a/dji_sdk_manifold_read_cam/include/libavutil/channel_layout.h +++ /dev/null @@ -1,225 +0,0 @@ -/* - * Copyright (c) 2006 Michael Niedermayer - * Copyright (c) 2008 Peter Ross - * - * This file is part of FFmpeg. - * - * FFmpeg is free software; you can redistribute it and/or - * modify it under the terms of the GNU Lesser General Public - * License as published by the Free Software Foundation; either - * version 2.1 of the License, or (at your option) any later version. - * - * FFmpeg is distributed in the hope that it will be useful, - * but WITHOUT ANY WARRANTY; without even the implied warranty of - * MERCHANTABILITY or FITNESS FOR A PARTICULAR PURPOSE. See the GNU - * Lesser General Public License for more details. - * - * You should have received a copy of the GNU Lesser General Public - * License along with FFmpeg; if not, write to the Free Software - * Foundation, Inc., 51 Franklin Street, Fifth Floor, Boston, MA 02110-1301 USA - */ - -#ifndef AVUTIL_CHANNEL_LAYOUT_H -#define AVUTIL_CHANNEL_LAYOUT_H - -#include - -/** - * @file - * audio channel layout utility functions - */ - -/** - * @addtogroup lavu_audio - * @{ - */ - -/** - * @defgroup channel_masks Audio channel masks - * - * A channel layout is a 64-bits integer with a bit set for every channel. - * The number of bits set must be equal to the number of channels. - * The value 0 means that the channel layout is not known. - * @note this data structure is not powerful enough to handle channels - * combinations that have the same channel multiple times, such as - * dual-mono. - * - * @{ - */ -#define AV_CH_FRONT_LEFT 0x00000001 -#define AV_CH_FRONT_RIGHT 0x00000002 -#define AV_CH_FRONT_CENTER 0x00000004 -#define AV_CH_LOW_FREQUENCY 0x00000008 -#define AV_CH_BACK_LEFT 0x00000010 -#define AV_CH_BACK_RIGHT 0x00000020 -#define AV_CH_FRONT_LEFT_OF_CENTER 0x00000040 -#define AV_CH_FRONT_RIGHT_OF_CENTER 0x00000080 -#define AV_CH_BACK_CENTER 0x00000100 -#define AV_CH_SIDE_LEFT 0x00000200 -#define AV_CH_SIDE_RIGHT 0x00000400 -#define AV_CH_TOP_CENTER 0x00000800 -#define AV_CH_TOP_FRONT_LEFT 0x00001000 -#define AV_CH_TOP_FRONT_CENTER 0x00002000 -#define AV_CH_TOP_FRONT_RIGHT 0x00004000 -#define AV_CH_TOP_BACK_LEFT 0x00008000 -#define AV_CH_TOP_BACK_CENTER 0x00010000 -#define AV_CH_TOP_BACK_RIGHT 0x00020000 -#define AV_CH_STEREO_LEFT 0x20000000 ///< Stereo downmix. -#define AV_CH_STEREO_RIGHT 0x40000000 ///< See AV_CH_STEREO_LEFT. -#define AV_CH_WIDE_LEFT 0x0000000080000000ULL -#define AV_CH_WIDE_RIGHT 0x0000000100000000ULL -#define AV_CH_SURROUND_DIRECT_LEFT 0x0000000200000000ULL -#define AV_CH_SURROUND_DIRECT_RIGHT 0x0000000400000000ULL -#define AV_CH_LOW_FREQUENCY_2 0x0000000800000000ULL - -/** Channel mask value used for AVCodecContext.request_channel_layout - to indicate that the user requests the channel order of the decoder output - to be the native codec channel order. */ -#define AV_CH_LAYOUT_NATIVE 0x8000000000000000ULL - -/** - * @} - * @defgroup channel_mask_c Audio channel convenience macros - * @{ - * */ -#define AV_CH_LAYOUT_MONO (AV_CH_FRONT_CENTER) -#define AV_CH_LAYOUT_STEREO (AV_CH_FRONT_LEFT|AV_CH_FRONT_RIGHT) -#define AV_CH_LAYOUT_2POINT1 (AV_CH_LAYOUT_STEREO|AV_CH_LOW_FREQUENCY) -#define AV_CH_LAYOUT_2_1 (AV_CH_LAYOUT_STEREO|AV_CH_BACK_CENTER) -#define AV_CH_LAYOUT_SURROUND (AV_CH_LAYOUT_STEREO|AV_CH_FRONT_CENTER) -#define AV_CH_LAYOUT_3POINT1 (AV_CH_LAYOUT_SURROUND|AV_CH_LOW_FREQUENCY) -#define AV_CH_LAYOUT_4POINT0 (AV_CH_LAYOUT_SURROUND|AV_CH_BACK_CENTER) -#define AV_CH_LAYOUT_4POINT1 (AV_CH_LAYOUT_4POINT0|AV_CH_LOW_FREQUENCY) -#define AV_CH_LAYOUT_2_2 (AV_CH_LAYOUT_STEREO|AV_CH_SIDE_LEFT|AV_CH_SIDE_RIGHT) -#define AV_CH_LAYOUT_QUAD (AV_CH_LAYOUT_STEREO|AV_CH_BACK_LEFT|AV_CH_BACK_RIGHT) -#define AV_CH_LAYOUT_5POINT0 (AV_CH_LAYOUT_SURROUND|AV_CH_SIDE_LEFT|AV_CH_SIDE_RIGHT) -#define AV_CH_LAYOUT_5POINT1 (AV_CH_LAYOUT_5POINT0|AV_CH_LOW_FREQUENCY) -#define AV_CH_LAYOUT_5POINT0_BACK (AV_CH_LAYOUT_SURROUND|AV_CH_BACK_LEFT|AV_CH_BACK_RIGHT) -#define AV_CH_LAYOUT_5POINT1_BACK (AV_CH_LAYOUT_5POINT0_BACK|AV_CH_LOW_FREQUENCY) -#define AV_CH_LAYOUT_6POINT0 (AV_CH_LAYOUT_5POINT0|AV_CH_BACK_CENTER) -#define AV_CH_LAYOUT_6POINT0_FRONT (AV_CH_LAYOUT_2_2|AV_CH_FRONT_LEFT_OF_CENTER|AV_CH_FRONT_RIGHT_OF_CENTER) -#define AV_CH_LAYOUT_HEXAGONAL (AV_CH_LAYOUT_5POINT0_BACK|AV_CH_BACK_CENTER) -#define AV_CH_LAYOUT_6POINT1 (AV_CH_LAYOUT_5POINT1|AV_CH_BACK_CENTER) -#define AV_CH_LAYOUT_6POINT1_BACK (AV_CH_LAYOUT_5POINT1_BACK|AV_CH_BACK_CENTER) -#define AV_CH_LAYOUT_6POINT1_FRONT (AV_CH_LAYOUT_6POINT0_FRONT|AV_CH_LOW_FREQUENCY) -#define AV_CH_LAYOUT_7POINT0 (AV_CH_LAYOUT_5POINT0|AV_CH_BACK_LEFT|AV_CH_BACK_RIGHT) -#define AV_CH_LAYOUT_7POINT0_FRONT (AV_CH_LAYOUT_5POINT0|AV_CH_FRONT_LEFT_OF_CENTER|AV_CH_FRONT_RIGHT_OF_CENTER) -#define AV_CH_LAYOUT_7POINT1 (AV_CH_LAYOUT_5POINT1|AV_CH_BACK_LEFT|AV_CH_BACK_RIGHT) -#define AV_CH_LAYOUT_7POINT1_WIDE (AV_CH_LAYOUT_5POINT1|AV_CH_FRONT_LEFT_OF_CENTER|AV_CH_FRONT_RIGHT_OF_CENTER) -#define AV_CH_LAYOUT_7POINT1_WIDE_BACK (AV_CH_LAYOUT_5POINT1_BACK|AV_CH_FRONT_LEFT_OF_CENTER|AV_CH_FRONT_RIGHT_OF_CENTER) -#define AV_CH_LAYOUT_OCTAGONAL (AV_CH_LAYOUT_5POINT0|AV_CH_BACK_LEFT|AV_CH_BACK_CENTER|AV_CH_BACK_RIGHT) -#define AV_CH_LAYOUT_STEREO_DOWNMIX (AV_CH_STEREO_LEFT|AV_CH_STEREO_RIGHT) - -enum AVMatrixEncoding { - AV_MATRIX_ENCODING_NONE, - AV_MATRIX_ENCODING_DOLBY, - AV_MATRIX_ENCODING_DPLII, - AV_MATRIX_ENCODING_DPLIIX, - AV_MATRIX_ENCODING_DPLIIZ, - AV_MATRIX_ENCODING_DOLBYEX, - AV_MATRIX_ENCODING_DOLBYHEADPHONE, - AV_MATRIX_ENCODING_NB -}; - -/** - * @} - */ - -/** - * Return a channel layout id that matches name, or 0 if no match is found. - * - * name can be one or several of the following notations, - * separated by '+' or '|': - * - the name of an usual channel layout (mono, stereo, 4.0, quad, 5.0, - * 5.0(side), 5.1, 5.1(side), 7.1, 7.1(wide), downmix); - * - the name of a single channel (FL, FR, FC, LFE, BL, BR, FLC, FRC, BC, - * SL, SR, TC, TFL, TFC, TFR, TBL, TBC, TBR, DL, DR); - * - a number of channels, in decimal, optionally followed by 'c', yielding - * the default channel layout for that number of channels (@see - * av_get_default_channel_layout); - * - a channel layout mask, in hexadecimal starting with "0x" (see the - * AV_CH_* macros). - * - * @warning Starting from the next major bump the trailing character - * 'c' to specify a number of channels will be required, while a - * channel layout mask could also be specified as a decimal number - * (if and only if not followed by "c"). - * - * Example: "stereo+FC" = "2c+FC" = "2c+1c" = "0x7" - */ -uint64_t av_get_channel_layout(const char *name); - -/** - * Return a description of a channel layout. - * If nb_channels is <= 0, it is guessed from the channel_layout. - * - * @param buf put here the string containing the channel layout - * @param buf_size size in bytes of the buffer - */ -void av_get_channel_layout_string(char *buf, int buf_size, int nb_channels, uint64_t channel_layout); - -struct AVBPrint; -/** - * Append a description of a channel layout to a bprint buffer. - */ -void av_bprint_channel_layout(struct AVBPrint *bp, int nb_channels, uint64_t channel_layout); - -/** - * Return the number of channels in the channel layout. - */ -int av_get_channel_layout_nb_channels(uint64_t channel_layout); - -/** - * Return default channel layout for a given number of channels. - */ -int64_t av_get_default_channel_layout(int nb_channels); - -/** - * Get the index of a channel in channel_layout. - * - * @param channel a channel layout describing exactly one channel which must be - * present in channel_layout. - * - * @return index of channel in channel_layout on success, a negative AVERROR - * on error. - */ -int av_get_channel_layout_channel_index(uint64_t channel_layout, - uint64_t channel); - -/** - * Get the channel with the given index in channel_layout. - */ -uint64_t av_channel_layout_extract_channel(uint64_t channel_layout, int index); - -/** - * Get the name of a given channel. - * - * @return channel name on success, NULL on error. - */ -const char *av_get_channel_name(uint64_t channel); - -/** - * Get the description of a given channel. - * - * @param channel a channel layout with a single channel - * @return channel description on success, NULL on error - */ -const char *av_get_channel_description(uint64_t channel); - -/** - * Get the value and name of a standard channel layout. - * - * @param[in] index index in an internal list, starting at 0 - * @param[out] layout channel layout mask - * @param[out] name name of the layout - * @return 0 if the layout exists, - * <0 if index is beyond the limits - */ -int av_get_standard_channel_layout(unsigned index, uint64_t *layout, - const char **name); - -/** - * @} - */ - -#endif /* AVUTIL_CHANNEL_LAYOUT_H */ diff --git a/dji_sdk_manifold_read_cam/include/libavutil/common.h b/dji_sdk_manifold_read_cam/include/libavutil/common.h deleted file mode 100644 index c82a3a6..0000000 --- a/dji_sdk_manifold_read_cam/include/libavutil/common.h +++ /dev/null @@ -1,469 +0,0 @@ -/* - * copyright (c) 2006 Michael Niedermayer - * - * This file is part of FFmpeg. - * - * FFmpeg is free software; you can redistribute it and/or - * modify it under the terms of the GNU Lesser General Public - * License as published by the Free Software Foundation; either - * version 2.1 of the License, or (at your option) any later version. - * - * FFmpeg is distributed in the hope that it will be useful, - * but WITHOUT ANY WARRANTY; without even the implied warranty of - * MERCHANTABILITY or FITNESS FOR A PARTICULAR PURPOSE. See the GNU - * Lesser General Public License for more details. - * - * You should have received a copy of the GNU Lesser General Public - * License along with FFmpeg; if not, write to the Free Software - * Foundation, Inc., 51 Franklin Street, Fifth Floor, Boston, MA 02110-1301 USA - */ - -/** - * @file - * common internal and external API header - */ - -#ifndef AVUTIL_COMMON_H -#define AVUTIL_COMMON_H - -#if defined(__cplusplus) && !defined(__STDC_CONSTANT_MACROS) && !defined(UINT64_C) -#error missing -D__STDC_CONSTANT_MACROS / #define __STDC_CONSTANT_MACROS -#endif - -#include -#include -#include -#include -#include -#include -#include -#include - -#include "attributes.h" -#include "version.h" -#include "libavutil/avconfig.h" - -#if AV_HAVE_BIGENDIAN -# define AV_NE(be, le) (be) -#else -# define AV_NE(be, le) (le) -#endif - -//rounded division & shift -#define RSHIFT(a,b) ((a) > 0 ? ((a) + ((1<<(b))>>1))>>(b) : ((a) + ((1<<(b))>>1)-1)>>(b)) -/* assume b>0 */ -#define ROUNDED_DIV(a,b) (((a)>0 ? (a) + ((b)>>1) : (a) - ((b)>>1))/(b)) -/* assume a>0 and b>0 */ -#define FF_CEIL_RSHIFT(a,b) (!av_builtin_constant_p(b) ? -((-(a)) >> (b)) \ - : ((a) + (1<<(b)) - 1) >> (b)) -#define FFUDIV(a,b) (((a)>0 ?(a):(a)-(b)+1) / (b)) -#define FFUMOD(a,b) ((a)-(b)*FFUDIV(a,b)) -#define FFABS(a) ((a) >= 0 ? (a) : (-(a))) -#define FFSIGN(a) ((a) > 0 ? 1 : -1) - -#define FFMAX(a,b) ((a) > (b) ? (a) : (b)) -#define FFMAX3(a,b,c) FFMAX(FFMAX(a,b),c) -#define FFMIN(a,b) ((a) > (b) ? (b) : (a)) -#define FFMIN3(a,b,c) FFMIN(FFMIN(a,b),c) - -#define FFSWAP(type,a,b) do{type SWAP_tmp= b; b= a; a= SWAP_tmp;}while(0) -#define FF_ARRAY_ELEMS(a) (sizeof(a) / sizeof((a)[0])) -#define FFALIGN(x, a) (((x)+(a)-1)&~((a)-1)) - -/* misc math functions */ - -/** - * Reverse the order of the bits of an 8-bits unsigned integer. - */ -#if FF_API_AV_REVERSE -extern attribute_deprecated const uint8_t av_reverse[256]; -#endif - -#ifdef HAVE_AV_CONFIG_H -# include "config.h" -# include "intmath.h" -#endif - -/* Pull in unguarded fallback defines at the end of this file. */ -#include "common.h" - -#ifndef av_log2 -av_const int av_log2(unsigned v); -#endif - -#ifndef av_log2_16bit -av_const int av_log2_16bit(unsigned v); -#endif - -/** - * Clip a signed integer value into the amin-amax range. - * @param a value to clip - * @param amin minimum value of the clip range - * @param amax maximum value of the clip range - * @return clipped value - */ -static av_always_inline av_const int av_clip_c(int a, int amin, int amax) -{ -#if defined(HAVE_AV_CONFIG_H) && defined(ASSERT_LEVEL) && ASSERT_LEVEL >= 2 - if (amin > amax) abort(); -#endif - if (a < amin) return amin; - else if (a > amax) return amax; - else return a; -} - -/** - * Clip a signed 64bit integer value into the amin-amax range. - * @param a value to clip - * @param amin minimum value of the clip range - * @param amax maximum value of the clip range - * @return clipped value - */ -static av_always_inline av_const int64_t av_clip64_c(int64_t a, int64_t amin, int64_t amax) -{ -#if defined(HAVE_AV_CONFIG_H) && defined(ASSERT_LEVEL) && ASSERT_LEVEL >= 2 - if (amin > amax) abort(); -#endif - if (a < amin) return amin; - else if (a > amax) return amax; - else return a; -} - -/** - * Clip a signed integer value into the 0-255 range. - * @param a value to clip - * @return clipped value - */ -static av_always_inline av_const uint8_t av_clip_uint8_c(int a) -{ - if (a&(~0xFF)) return (-a)>>31; - else return a; -} - -/** - * Clip a signed integer value into the -128,127 range. - * @param a value to clip - * @return clipped value - */ -static av_always_inline av_const int8_t av_clip_int8_c(int a) -{ - if ((a+0x80) & ~0xFF) return (a>>31) ^ 0x7F; - else return a; -} - -/** - * Clip a signed integer value into the 0-65535 range. - * @param a value to clip - * @return clipped value - */ -static av_always_inline av_const uint16_t av_clip_uint16_c(int a) -{ - if (a&(~0xFFFF)) return (-a)>>31; - else return a; -} - -/** - * Clip a signed integer value into the -32768,32767 range. - * @param a value to clip - * @return clipped value - */ -static av_always_inline av_const int16_t av_clip_int16_c(int a) -{ - if ((a+0x8000) & ~0xFFFF) return (a>>31) ^ 0x7FFF; - else return a; -} - -/** - * Clip a signed 64-bit integer value into the -2147483648,2147483647 range. - * @param a value to clip - * @return clipped value - */ -static av_always_inline av_const int32_t av_clipl_int32_c(int64_t a) -{ - if ((a+0x80000000u) & ~UINT64_C(0xFFFFFFFF)) return (int32_t)((a>>63) ^ 0x7FFFFFFF); - else return (int32_t)a; -} - -/** - * Clip a signed integer to an unsigned power of two range. - * @param a value to clip - * @param p bit position to clip at - * @return clipped value - */ -static av_always_inline av_const unsigned av_clip_uintp2_c(int a, int p) -{ - if (a & ~((1<> 31 & ((1<= 2 - if (amin > amax) abort(); -#endif - if (a < amin) return amin; - else if (a > amax) return amax; - else return a; -} - -/** - * Clip a double value into the amin-amax range. - * @param a value to clip - * @param amin minimum value of the clip range - * @param amax maximum value of the clip range - * @return clipped value - */ -static av_always_inline av_const double av_clipd_c(double a, double amin, double amax) -{ -#if defined(HAVE_AV_CONFIG_H) && defined(ASSERT_LEVEL) && ASSERT_LEVEL >= 2 - if (amin > amax) abort(); -#endif - if (a < amin) return amin; - else if (a > amax) return amax; - else return a; -} - -/** Compute ceil(log2(x)). - * @param x value used to compute ceil(log2(x)) - * @return computed ceiling of log2(x) - */ -static av_always_inline av_const int av_ceil_log2_c(int x) -{ - return av_log2((x - 1) << 1); -} - -/** - * Count number of bits set to one in x - * @param x value to count bits of - * @return the number of bits set to one in x - */ -static av_always_inline av_const int av_popcount_c(uint32_t x) -{ - x -= (x >> 1) & 0x55555555; - x = (x & 0x33333333) + ((x >> 2) & 0x33333333); - x = (x + (x >> 4)) & 0x0F0F0F0F; - x += x >> 8; - return (x + (x >> 16)) & 0x3F; -} - -/** - * Count number of bits set to one in x - * @param x value to count bits of - * @return the number of bits set to one in x - */ -static av_always_inline av_const int av_popcount64_c(uint64_t x) -{ - return av_popcount((uint32_t)x) + av_popcount((uint32_t)(x >> 32)); -} - -#define MKTAG(a,b,c,d) ((a) | ((b) << 8) | ((c) << 16) | ((unsigned)(d) << 24)) -#define MKBETAG(a,b,c,d) ((d) | ((c) << 8) | ((b) << 16) | ((unsigned)(a) << 24)) - -/** - * Convert a UTF-8 character (up to 4 bytes) to its 32-bit UCS-4 encoded form. - * - * @param val Output value, must be an lvalue of type uint32_t. - * @param GET_BYTE Expression reading one byte from the input. - * Evaluated up to 7 times (4 for the currently - * assigned Unicode range). With a memory buffer - * input, this could be *ptr++. - * @param ERROR Expression to be evaluated on invalid input, - * typically a goto statement. - * - * @warning ERROR should not contain a loop control statement which - * could interact with the internal while loop, and should force an - * exit from the macro code (e.g. through a goto or a return) in order - * to prevent undefined results. - */ -#define GET_UTF8(val, GET_BYTE, ERROR)\ - val= GET_BYTE;\ - {\ - uint32_t top = (val & 128) >> 1;\ - if ((val & 0xc0) == 0x80 || val >= 0xFE)\ - ERROR\ - while (val & top) {\ - int tmp= GET_BYTE - 128;\ - if(tmp>>6)\ - ERROR\ - val= (val<<6) + tmp;\ - top <<= 5;\ - }\ - val &= (top << 1) - 1;\ - } - -/** - * Convert a UTF-16 character (2 or 4 bytes) to its 32-bit UCS-4 encoded form. - * - * @param val Output value, must be an lvalue of type uint32_t. - * @param GET_16BIT Expression returning two bytes of UTF-16 data converted - * to native byte order. Evaluated one or two times. - * @param ERROR Expression to be evaluated on invalid input, - * typically a goto statement. - */ -#define GET_UTF16(val, GET_16BIT, ERROR)\ - val = GET_16BIT;\ - {\ - unsigned int hi = val - 0xD800;\ - if (hi < 0x800) {\ - val = GET_16BIT - 0xDC00;\ - if (val > 0x3FFU || hi > 0x3FFU)\ - ERROR\ - val += (hi<<10) + 0x10000;\ - }\ - }\ - -/** - * @def PUT_UTF8(val, tmp, PUT_BYTE) - * Convert a 32-bit Unicode character to its UTF-8 encoded form (up to 4 bytes long). - * @param val is an input-only argument and should be of type uint32_t. It holds - * a UCS-4 encoded Unicode character that is to be converted to UTF-8. If - * val is given as a function it is executed only once. - * @param tmp is a temporary variable and should be of type uint8_t. It - * represents an intermediate value during conversion that is to be - * output by PUT_BYTE. - * @param PUT_BYTE writes the converted UTF-8 bytes to any proper destination. - * It could be a function or a statement, and uses tmp as the input byte. - * For example, PUT_BYTE could be "*output++ = tmp;" PUT_BYTE will be - * executed up to 4 times for values in the valid UTF-8 range and up to - * 7 times in the general case, depending on the length of the converted - * Unicode character. - */ -#define PUT_UTF8(val, tmp, PUT_BYTE)\ - {\ - int bytes, shift;\ - uint32_t in = val;\ - if (in < 0x80) {\ - tmp = in;\ - PUT_BYTE\ - } else {\ - bytes = (av_log2(in) + 4) / 5;\ - shift = (bytes - 1) * 6;\ - tmp = (256 - (256 >> bytes)) | (in >> shift);\ - PUT_BYTE\ - while (shift >= 6) {\ - shift -= 6;\ - tmp = 0x80 | ((in >> shift) & 0x3f);\ - PUT_BYTE\ - }\ - }\ - } - -/** - * @def PUT_UTF16(val, tmp, PUT_16BIT) - * Convert a 32-bit Unicode character to its UTF-16 encoded form (2 or 4 bytes). - * @param val is an input-only argument and should be of type uint32_t. It holds - * a UCS-4 encoded Unicode character that is to be converted to UTF-16. If - * val is given as a function it is executed only once. - * @param tmp is a temporary variable and should be of type uint16_t. It - * represents an intermediate value during conversion that is to be - * output by PUT_16BIT. - * @param PUT_16BIT writes the converted UTF-16 data to any proper destination - * in desired endianness. It could be a function or a statement, and uses tmp - * as the input byte. For example, PUT_BYTE could be "*output++ = tmp;" - * PUT_BYTE will be executed 1 or 2 times depending on input character. - */ -#define PUT_UTF16(val, tmp, PUT_16BIT)\ - {\ - uint32_t in = val;\ - if (in < 0x10000) {\ - tmp = in;\ - PUT_16BIT\ - } else {\ - tmp = 0xD800 | ((in - 0x10000) >> 10);\ - PUT_16BIT\ - tmp = 0xDC00 | ((in - 0x10000) & 0x3FF);\ - PUT_16BIT\ - }\ - }\ - - - -#include "mem.h" - -#ifdef HAVE_AV_CONFIG_H -# include "internal.h" -#endif /* HAVE_AV_CONFIG_H */ - -#endif /* AVUTIL_COMMON_H */ - -/* - * The following definitions are outside the multiple inclusion guard - * to ensure they are immediately available in intmath.h. - */ - -#ifndef av_ceil_log2 -# define av_ceil_log2 av_ceil_log2_c -#endif -#ifndef av_clip -# define av_clip av_clip_c -#endif -#ifndef av_clip64 -# define av_clip64 av_clip64_c -#endif -#ifndef av_clip_uint8 -# define av_clip_uint8 av_clip_uint8_c -#endif -#ifndef av_clip_int8 -# define av_clip_int8 av_clip_int8_c -#endif -#ifndef av_clip_uint16 -# define av_clip_uint16 av_clip_uint16_c -#endif -#ifndef av_clip_int16 -# define av_clip_int16 av_clip_int16_c -#endif -#ifndef av_clipl_int32 -# define av_clipl_int32 av_clipl_int32_c -#endif -#ifndef av_clip_uintp2 -# define av_clip_uintp2 av_clip_uintp2_c -#endif -#ifndef av_sat_add32 -# define av_sat_add32 av_sat_add32_c -#endif -#ifndef av_sat_dadd32 -# define av_sat_dadd32 av_sat_dadd32_c -#endif -#ifndef av_clipf -# define av_clipf av_clipf_c -#endif -#ifndef av_clipd -# define av_clipd av_clipd_c -#endif -#ifndef av_popcount -# define av_popcount av_popcount_c -#endif -#ifndef av_popcount64 -# define av_popcount64 av_popcount64_c -#endif diff --git a/dji_sdk_manifold_read_cam/include/libavutil/cpu.h b/dji_sdk_manifold_read_cam/include/libavutil/cpu.h deleted file mode 100644 index 8ff14d3..0000000 --- a/dji_sdk_manifold_read_cam/include/libavutil/cpu.h +++ /dev/null @@ -1,115 +0,0 @@ -/* - * Copyright (c) 2000, 2001, 2002 Fabrice Bellard - * - * This file is part of FFmpeg. - * - * FFmpeg is free software; you can redistribute it and/or - * modify it under the terms of the GNU Lesser General Public - * License as published by the Free Software Foundation; either - * version 2.1 of the License, or (at your option) any later version. - * - * FFmpeg is distributed in the hope that it will be useful, - * but WITHOUT ANY WARRANTY; without even the implied warranty of - * MERCHANTABILITY or FITNESS FOR A PARTICULAR PURPOSE. See the GNU - * Lesser General Public License for more details. - * - * You should have received a copy of the GNU Lesser General Public - * License along with FFmpeg; if not, write to the Free Software - * Foundation, Inc., 51 Franklin Street, Fifth Floor, Boston, MA 02110-1301 USA - */ - -#ifndef AVUTIL_CPU_H -#define AVUTIL_CPU_H - -#include "attributes.h" - -#define AV_CPU_FLAG_FORCE 0x80000000 /* force usage of selected flags (OR) */ - - /* lower 16 bits - CPU features */ -#define AV_CPU_FLAG_MMX 0x0001 ///< standard MMX -#define AV_CPU_FLAG_MMXEXT 0x0002 ///< SSE integer functions or AMD MMX ext -#define AV_CPU_FLAG_MMX2 0x0002 ///< SSE integer functions or AMD MMX ext -#define AV_CPU_FLAG_3DNOW 0x0004 ///< AMD 3DNOW -#define AV_CPU_FLAG_SSE 0x0008 ///< SSE functions -#define AV_CPU_FLAG_SSE2 0x0010 ///< PIV SSE2 functions -#define AV_CPU_FLAG_SSE2SLOW 0x40000000 ///< SSE2 supported, but usually not faster - ///< than regular MMX/SSE (e.g. Core1) -#define AV_CPU_FLAG_3DNOWEXT 0x0020 ///< AMD 3DNowExt -#define AV_CPU_FLAG_SSE3 0x0040 ///< Prescott SSE3 functions -#define AV_CPU_FLAG_SSE3SLOW 0x20000000 ///< SSE3 supported, but usually not faster - ///< than regular MMX/SSE (e.g. Core1) -#define AV_CPU_FLAG_SSSE3 0x0080 ///< Conroe SSSE3 functions -#define AV_CPU_FLAG_ATOM 0x10000000 ///< Atom processor, some SSSE3 instructions are slower -#define AV_CPU_FLAG_SSE4 0x0100 ///< Penryn SSE4.1 functions -#define AV_CPU_FLAG_SSE42 0x0200 ///< Nehalem SSE4.2 functions -#define AV_CPU_FLAG_AVX 0x4000 ///< AVX functions: requires OS support even if YMM registers aren't used -#define AV_CPU_FLAG_XOP 0x0400 ///< Bulldozer XOP functions -#define AV_CPU_FLAG_FMA4 0x0800 ///< Bulldozer FMA4 functions -// #if LIBAVUTIL_VERSION_MAJOR <52 -#define AV_CPU_FLAG_CMOV 0x1001000 ///< supports cmov instruction -// #else -// #define AV_CPU_FLAG_CMOV 0x1000 ///< supports cmov instruction -// #endif -#define AV_CPU_FLAG_AVX2 0x8000 ///< AVX2 functions: requires OS support even if YMM registers aren't used -#define AV_CPU_FLAG_FMA3 0x10000 ///< Haswell FMA3 functions -#define AV_CPU_FLAG_BMI1 0x20000 ///< Bit Manipulation Instruction Set 1 -#define AV_CPU_FLAG_BMI2 0x40000 ///< Bit Manipulation Instruction Set 2 - -#define AV_CPU_FLAG_ALTIVEC 0x0001 ///< standard - -#define AV_CPU_FLAG_ARMV5TE (1 << 0) -#define AV_CPU_FLAG_ARMV6 (1 << 1) -#define AV_CPU_FLAG_ARMV6T2 (1 << 2) -#define AV_CPU_FLAG_VFP (1 << 3) -#define AV_CPU_FLAG_VFPV3 (1 << 4) -#define AV_CPU_FLAG_NEON (1 << 5) -#define AV_CPU_FLAG_ARMV8 (1 << 6) - -/** - * Return the flags which specify extensions supported by the CPU. - * The returned value is affected by av_force_cpu_flags() if that was used - * before. So av_get_cpu_flags() can easily be used in a application to - * detect the enabled cpu flags. - */ -int av_get_cpu_flags(void); - -/** - * Disables cpu detection and forces the specified flags. - * -1 is a special case that disables forcing of specific flags. - */ -void av_force_cpu_flags(int flags); - -/** - * Set a mask on flags returned by av_get_cpu_flags(). - * This function is mainly useful for testing. - * Please use av_force_cpu_flags() and av_get_cpu_flags() instead which are more flexible - * - * @warning this function is not thread safe. - */ -attribute_deprecated void av_set_cpu_flags_mask(int mask); - -/** - * Parse CPU flags from a string. - * - * The returned flags contain the specified flags as well as related unspecified flags. - * - * This function exists only for compatibility with libav. - * Please use av_parse_cpu_caps() when possible. - * @return a combination of AV_CPU_* flags, negative on error. - */ -attribute_deprecated -int av_parse_cpu_flags(const char *s); - -/** - * Parse CPU caps from a string and update the given AV_CPU_* flags based on that. - * - * @return negative on error. - */ -int av_parse_cpu_caps(unsigned *flags, const char *s); - -/** - * @return the number of logical CPU cores present. - */ -int av_cpu_count(void); - -#endif /* AVUTIL_CPU_H */ diff --git a/dji_sdk_manifold_read_cam/include/libavutil/crc.h b/dji_sdk_manifold_read_cam/include/libavutil/crc.h deleted file mode 100644 index e86bf1d..0000000 --- a/dji_sdk_manifold_read_cam/include/libavutil/crc.h +++ /dev/null @@ -1,86 +0,0 @@ -/* - * copyright (c) 2006 Michael Niedermayer - * - * This file is part of FFmpeg. - * - * FFmpeg is free software; you can redistribute it and/or - * modify it under the terms of the GNU Lesser General Public - * License as published by the Free Software Foundation; either - * version 2.1 of the License, or (at your option) any later version. - * - * FFmpeg is distributed in the hope that it will be useful, - * but WITHOUT ANY WARRANTY; without even the implied warranty of - * MERCHANTABILITY or FITNESS FOR A PARTICULAR PURPOSE. See the GNU - * Lesser General Public License for more details. - * - * You should have received a copy of the GNU Lesser General Public - * License along with FFmpeg; if not, write to the Free Software - * Foundation, Inc., 51 Franklin Street, Fifth Floor, Boston, MA 02110-1301 USA - */ - -#ifndef AVUTIL_CRC_H -#define AVUTIL_CRC_H - -#include -#include -#include "attributes.h" - -/** - * @defgroup lavu_crc32 CRC32 - * @ingroup lavu_crypto - * @{ - */ - -typedef uint32_t AVCRC; - -typedef enum { - AV_CRC_8_ATM, - AV_CRC_16_ANSI, - AV_CRC_16_CCITT, - AV_CRC_32_IEEE, - AV_CRC_32_IEEE_LE, /*< reversed bitorder version of AV_CRC_32_IEEE */ - AV_CRC_16_ANSI_LE, /*< reversed bitorder version of AV_CRC_16_ANSI */ - AV_CRC_24_IEEE = 12, - AV_CRC_MAX, /*< Not part of public API! Do not use outside libavutil. */ -}AVCRCId; - -/** - * Initialize a CRC table. - * @param ctx must be an array of size sizeof(AVCRC)*257 or sizeof(AVCRC)*1024 - * @param le If 1, the lowest bit represents the coefficient for the highest - * exponent of the corresponding polynomial (both for poly and - * actual CRC). - * If 0, you must swap the CRC parameter and the result of av_crc - * if you need the standard representation (can be simplified in - * most cases to e.g. bswap16): - * av_bswap32(crc << (32-bits)) - * @param bits number of bits for the CRC - * @param poly generator polynomial without the x**bits coefficient, in the - * representation as specified by le - * @param ctx_size size of ctx in bytes - * @return <0 on failure - */ -int av_crc_init(AVCRC *ctx, int le, int bits, uint32_t poly, int ctx_size); - -/** - * Get an initialized standard CRC table. - * @param crc_id ID of a standard CRC - * @return a pointer to the CRC table or NULL on failure - */ -const AVCRC *av_crc_get_table(AVCRCId crc_id); - -/** - * Calculate the CRC of a block. - * @param crc CRC of previous blocks if any or initial value for CRC - * @return CRC updated with the data from the given block - * - * @see av_crc_init() "le" parameter - */ -uint32_t av_crc(const AVCRC *ctx, uint32_t crc, - const uint8_t *buffer, size_t length) av_pure; - -/** - * @} - */ - -#endif /* AVUTIL_CRC_H */ diff --git a/dji_sdk_manifold_read_cam/include/libavutil/dict.h b/dji_sdk_manifold_read_cam/include/libavutil/dict.h deleted file mode 100644 index a39a5ee..0000000 --- a/dji_sdk_manifold_read_cam/include/libavutil/dict.h +++ /dev/null @@ -1,163 +0,0 @@ -/* - * - * This file is part of FFmpeg. - * - * FFmpeg is free software; you can redistribute it and/or - * modify it under the terms of the GNU Lesser General Public - * License as published by the Free Software Foundation; either - * version 2.1 of the License, or (at your option) any later version. - * - * FFmpeg is distributed in the hope that it will be useful, - * but WITHOUT ANY WARRANTY; without even the implied warranty of - * MERCHANTABILITY or FITNESS FOR A PARTICULAR PURPOSE. See the GNU - * Lesser General Public License for more details. - * - * You should have received a copy of the GNU Lesser General Public - * License along with FFmpeg; if not, write to the Free Software - * Foundation, Inc., 51 Franklin Street, Fifth Floor, Boston, MA 02110-1301 USA - */ - -/** - * @file - * Public dictionary API. - * @deprecated - * AVDictionary is provided for compatibility with libav. It is both in - * implementation as well as API inefficient. It does not scale and is - * extremely slow with large dictionaries. - * It is recommended that new code uses our tree container from tree.c/h - * where applicable, which uses AVL trees to achieve O(log n) performance. - */ - -#ifndef AVUTIL_DICT_H -#define AVUTIL_DICT_H - -/** - * @addtogroup lavu_dict AVDictionary - * @ingroup lavu_data - * - * @brief Simple key:value store - * - * @{ - * Dictionaries are used for storing key:value pairs. To create - * an AVDictionary, simply pass an address of a NULL pointer to - * av_dict_set(). NULL can be used as an empty dictionary wherever - * a pointer to an AVDictionary is required. - * Use av_dict_get() to retrieve an entry or iterate over all - * entries and finally av_dict_free() to free the dictionary - * and all its contents. - * - @code - AVDictionary *d = NULL; // "create" an empty dictionary - AVDictionaryEntry *t = NULL; - - av_dict_set(&d, "foo", "bar", 0); // add an entry - - char *k = av_strdup("key"); // if your strings are already allocated, - char *v = av_strdup("value"); // you can avoid copying them like this - av_dict_set(&d, k, v, AV_DICT_DONT_STRDUP_KEY | AV_DICT_DONT_STRDUP_VAL); - - while (t = av_dict_get(d, "", t, AV_DICT_IGNORE_SUFFIX)) { - <....> // iterate over all entries in d - } - av_dict_free(&d); - @endcode - * - */ - -#define AV_DICT_MATCH_CASE 1 /**< Only get an entry with exact-case key match. Only relevant in av_dict_get(). */ -#define AV_DICT_IGNORE_SUFFIX 2 /**< Return first entry in a dictionary whose first part corresponds to the search key, - ignoring the suffix of the found key string. Only relevant in av_dict_get(). */ -#define AV_DICT_DONT_STRDUP_KEY 4 /**< Take ownership of a key that's been - allocated with av_malloc() or another memory allocation function. */ -#define AV_DICT_DONT_STRDUP_VAL 8 /**< Take ownership of a value that's been - allocated with av_malloc() or another memory allocation function. */ -#define AV_DICT_DONT_OVERWRITE 16 ///< Don't overwrite existing entries. -#define AV_DICT_APPEND 32 /**< If the entry already exists, append to it. Note that no - delimiter is added, the strings are simply concatenated. */ - -typedef struct AVDictionaryEntry { - char *key; - char *value; -} AVDictionaryEntry; - -typedef struct AVDictionary AVDictionary; - -/** - * Get a dictionary entry with matching key. - * - * The returned entry key or value must not be changed, or it will - * cause undefined behavior. - * - * To iterate through all the dictionary entries, you can set the matching key - * to the null string "" and set the AV_DICT_IGNORE_SUFFIX flag. - * - * @param prev Set to the previous matching element to find the next. - * If set to NULL the first matching element is returned. - * @param key matching key - * @param flags a collection of AV_DICT_* flags controlling how the entry is retrieved - * @return found entry or NULL in case no matching entry was found in the dictionary - */ -AVDictionaryEntry * -av_dict_get(const AVDictionary *m, const char *key, const AVDictionaryEntry *prev, int flags); - -/** - * Get number of entries in dictionary. - * - * @param m dictionary - * @return number of entries in dictionary - */ -int av_dict_count(const AVDictionary *m); - -/** - * Set the given entry in *pm, overwriting an existing entry. - * - * @param pm pointer to a pointer to a dictionary struct. If *pm is NULL - * a dictionary struct is allocated and put in *pm. - * @param key entry key to add to *pm (will be av_strduped depending on flags) - * @param value entry value to add to *pm (will be av_strduped depending on flags). - * Passing a NULL value will cause an existing entry to be deleted. - * @return >= 0 on success otherwise an error code <0 - */ -int av_dict_set(AVDictionary **pm, const char *key, const char *value, int flags); - -/** - * Parse the key/value pairs list and add the parsed entries to a dictionary. - * - * In case of failure, all the successfully set entries are stored in - * *pm. You may need to manually free the created dictionary. - * - * @param key_val_sep a 0-terminated list of characters used to separate - * key from value - * @param pairs_sep a 0-terminated list of characters used to separate - * two pairs from each other - * @param flags flags to use when adding to dictionary. - * AV_DICT_DONT_STRDUP_KEY and AV_DICT_DONT_STRDUP_VAL - * are ignored since the key/value tokens will always - * be duplicated. - * @return 0 on success, negative AVERROR code on failure - */ -int av_dict_parse_string(AVDictionary **pm, const char *str, - const char *key_val_sep, const char *pairs_sep, - int flags); - -/** - * Copy entries from one AVDictionary struct into another. - * @param dst pointer to a pointer to a AVDictionary struct. If *dst is NULL, - * this function will allocate a struct for you and put it in *dst - * @param src pointer to source AVDictionary struct - * @param flags flags to use when setting entries in *dst - * @note metadata is read using the AV_DICT_IGNORE_SUFFIX flag - */ -void av_dict_copy(AVDictionary **dst, const AVDictionary *src, int flags); - -/** - * Free all the memory allocated for an AVDictionary struct - * and all keys and values. - */ -void av_dict_free(AVDictionary **m); - -/** - * @} - */ - -#endif /* AVUTIL_DICT_H */ diff --git a/dji_sdk_manifold_read_cam/include/libavutil/downmix_info.h b/dji_sdk_manifold_read_cam/include/libavutil/downmix_info.h deleted file mode 100644 index c369891..0000000 --- a/dji_sdk_manifold_read_cam/include/libavutil/downmix_info.h +++ /dev/null @@ -1,114 +0,0 @@ -/* - * Copyright (c) 2014 Tim Walker - * - * This file is part of FFmpeg. - * - * FFmpeg is free software; you can redistribute it and/or - * modify it under the terms of the GNU Lesser General Public - * License as published by the Free Software Foundation; either - * version 2.1 of the License, or (at your option) any later version. - * - * FFmpeg is distributed in the hope that it will be useful, - * but WITHOUT ANY WARRANTY; without even the implied warranty of - * MERCHANTABILITY or FITNESS FOR A PARTICULAR PURPOSE. See the GNU - * Lesser General Public License for more details. - * - * You should have received a copy of the GNU Lesser General Public - * License along with FFmpeg; if not, write to the Free Software - * Foundation, Inc., 51 Franklin Street, Fifth Floor, Boston, MA 02110-1301 USA - */ - -#ifndef AVUTIL_DOWNMIX_INFO_H -#define AVUTIL_DOWNMIX_INFO_H - -#include "frame.h" - -/** - * @file - * audio downmix medatata - */ - -/** - * @addtogroup lavu_audio - * @{ - */ - -/** - * @defgroup downmix_info Audio downmix metadata - * @{ - */ - -/** - * Possible downmix types. - */ -enum AVDownmixType { - AV_DOWNMIX_TYPE_UNKNOWN, /**< Not indicated. */ - AV_DOWNMIX_TYPE_LORO, /**< Lo/Ro 2-channel downmix (Stereo). */ - AV_DOWNMIX_TYPE_LTRT, /**< Lt/Rt 2-channel downmix, Dolby Surround compatible. */ - AV_DOWNMIX_TYPE_DPLII, /**< Lt/Rt 2-channel downmix, Dolby Pro Logic II compatible. */ - AV_DOWNMIX_TYPE_NB /**< Number of downmix types. Not part of ABI. */ -}; - -/** - * This structure describes optional metadata relevant to a downmix procedure. - * - * All fields are set by the decoder to the value indicated in the audio - * bitstream (if present), or to a "sane" default otherwise. - */ -typedef struct AVDownmixInfo { - /** - * Type of downmix preferred by the mastering engineer. - */ - enum AVDownmixType preferred_downmix_type; - - /** - * Absolute scale factor representing the nominal level of the center - * channel during a regular downmix. - */ - double center_mix_level; - - /** - * Absolute scale factor representing the nominal level of the center - * channel during an Lt/Rt compatible downmix. - */ - double center_mix_level_ltrt; - - /** - * Absolute scale factor representing the nominal level of the surround - * channels during a regular downmix. - */ - double surround_mix_level; - - /** - * Absolute scale factor representing the nominal level of the surround - * channels during an Lt/Rt compatible downmix. - */ - double surround_mix_level_ltrt; - - /** - * Absolute scale factor representing the level at which the LFE data is - * mixed into L/R channels during downmixing. - */ - double lfe_mix_level; -} AVDownmixInfo; - -/** - * Get a frame's AV_FRAME_DATA_DOWNMIX_INFO side data for editing. - * - * The side data is created and added to the frame if it's absent. - * - * @param frame the frame for which the side data is to be obtained. - * - * @return the AVDownmixInfo structure to be edited by the caller. - */ -AVDownmixInfo *av_downmix_info_update_side_data(AVFrame *frame); - -/** - * @} - */ - -/** - * @} - */ - -#endif /* AVUTIL_DOWNMIX_INFO_H */ diff --git a/dji_sdk_manifold_read_cam/include/libavutil/error.h b/dji_sdk_manifold_read_cam/include/libavutil/error.h deleted file mode 100644 index f3fd7bb..0000000 --- a/dji_sdk_manifold_read_cam/include/libavutil/error.h +++ /dev/null @@ -1,117 +0,0 @@ -/* - * This file is part of FFmpeg. - * - * FFmpeg is free software; you can redistribute it and/or - * modify it under the terms of the GNU Lesser General Public - * License as published by the Free Software Foundation; either - * version 2.1 of the License, or (at your option) any later version. - * - * FFmpeg is distributed in the hope that it will be useful, - * but WITHOUT ANY WARRANTY; without even the implied warranty of - * MERCHANTABILITY or FITNESS FOR A PARTICULAR PURPOSE. See the GNU - * Lesser General Public License for more details. - * - * You should have received a copy of the GNU Lesser General Public - * License along with FFmpeg; if not, write to the Free Software - * Foundation, Inc., 51 Franklin Street, Fifth Floor, Boston, MA 02110-1301 USA - */ - -/** - * @file - * error code definitions - */ - -#ifndef AVUTIL_ERROR_H -#define AVUTIL_ERROR_H - -#include -#include - -/** - * @addtogroup lavu_error - * - * @{ - */ - - -/* error handling */ -#if EDOM > 0 -#define AVERROR(e) (-(e)) ///< Returns a negative error code from a POSIX error code, to return from library functions. -#define AVUNERROR(e) (-(e)) ///< Returns a POSIX error code from a library function error return value. -#else -/* Some platforms have E* and errno already negated. */ -#define AVERROR(e) (e) -#define AVUNERROR(e) (e) -#endif - -#define FFERRTAG(a, b, c, d) (-(int)MKTAG(a, b, c, d)) - -#define AVERROR_BSF_NOT_FOUND FFERRTAG(0xF8,'B','S','F') ///< Bitstream filter not found -#define AVERROR_BUG FFERRTAG( 'B','U','G','!') ///< Internal bug, also see AVERROR_BUG2 -#define AVERROR_BUFFER_TOO_SMALL FFERRTAG( 'B','U','F','S') ///< Buffer too small -#define AVERROR_DECODER_NOT_FOUND FFERRTAG(0xF8,'D','E','C') ///< Decoder not found -#define AVERROR_DEMUXER_NOT_FOUND FFERRTAG(0xF8,'D','E','M') ///< Demuxer not found -#define AVERROR_ENCODER_NOT_FOUND FFERRTAG(0xF8,'E','N','C') ///< Encoder not found -#define AVERROR_EOF FFERRTAG( 'E','O','F',' ') ///< End of file -#define AVERROR_EXIT FFERRTAG( 'E','X','I','T') ///< Immediate exit was requested; the called function should not be restarted -#define AVERROR_EXTERNAL FFERRTAG( 'E','X','T',' ') ///< Generic error in an external library -#define AVERROR_FILTER_NOT_FOUND FFERRTAG(0xF8,'F','I','L') ///< Filter not found -#define AVERROR_INVALIDDATA FFERRTAG( 'I','N','D','A') ///< Invalid data found when processing input -#define AVERROR_MUXER_NOT_FOUND FFERRTAG(0xF8,'M','U','X') ///< Muxer not found -#define AVERROR_OPTION_NOT_FOUND FFERRTAG(0xF8,'O','P','T') ///< Option not found -#define AVERROR_PATCHWELCOME FFERRTAG( 'P','A','W','E') ///< Not yet implemented in FFmpeg, patches welcome -#define AVERROR_PROTOCOL_NOT_FOUND FFERRTAG(0xF8,'P','R','O') ///< Protocol not found - -#define AVERROR_STREAM_NOT_FOUND FFERRTAG(0xF8,'S','T','R') ///< Stream not found -/** - * This is semantically identical to AVERROR_BUG - * it has been introduced in Libav after our AVERROR_BUG and with a modified value. - */ -#define AVERROR_BUG2 FFERRTAG( 'B','U','G',' ') -#define AVERROR_UNKNOWN FFERRTAG( 'U','N','K','N') ///< Unknown error, typically from an external library -#define AVERROR_EXPERIMENTAL (-0x2bb2afa8) ///< Requested feature is flagged experimental. Set strict_std_compliance if you really want to use it. - -#define AV_ERROR_MAX_STRING_SIZE 64 - -/** - * Put a description of the AVERROR code errnum in errbuf. - * In case of failure the global variable errno is set to indicate the - * error. Even in case of failure av_strerror() will print a generic - * error message indicating the errnum provided to errbuf. - * - * @param errnum error code to describe - * @param errbuf buffer to which description is written - * @param errbuf_size the size in bytes of errbuf - * @return 0 on success, a negative value if a description for errnum - * cannot be found - */ -int av_strerror(int errnum, char *errbuf, size_t errbuf_size); - -/** - * Fill the provided buffer with a string containing an error string - * corresponding to the AVERROR code errnum. - * - * @param errbuf a buffer - * @param errbuf_size size in bytes of errbuf - * @param errnum error code to describe - * @return the buffer in input, filled with the error description - * @see av_strerror() - */ -static inline char *av_make_error_string(char *errbuf, size_t errbuf_size, int errnum) -{ - av_strerror(errnum, errbuf, errbuf_size); - return errbuf; -} - -/** - * Convenience macro, the return value should be used only directly in - * function arguments but never stand-alone. - */ -#define av_err2str(errnum) \ - av_make_error_string((char[AV_ERROR_MAX_STRING_SIZE]){0}, AV_ERROR_MAX_STRING_SIZE, errnum) - -/** - * @} - */ - -#endif /* AVUTIL_ERROR_H */ diff --git a/dji_sdk_manifold_read_cam/include/libavutil/eval.h b/dji_sdk_manifold_read_cam/include/libavutil/eval.h deleted file mode 100644 index 6159b0f..0000000 --- a/dji_sdk_manifold_read_cam/include/libavutil/eval.h +++ /dev/null @@ -1,113 +0,0 @@ -/* - * Copyright (c) 2002 Michael Niedermayer - * - * This file is part of FFmpeg. - * - * FFmpeg is free software; you can redistribute it and/or - * modify it under the terms of the GNU Lesser General Public - * License as published by the Free Software Foundation; either - * version 2.1 of the License, or (at your option) any later version. - * - * FFmpeg is distributed in the hope that it will be useful, - * but WITHOUT ANY WARRANTY; without even the implied warranty of - * MERCHANTABILITY or FITNESS FOR A PARTICULAR PURPOSE. See the GNU - * Lesser General Public License for more details. - * - * You should have received a copy of the GNU Lesser General Public - * License along with FFmpeg; if not, write to the Free Software - * Foundation, Inc., 51 Franklin Street, Fifth Floor, Boston, MA 02110-1301 USA - */ - -/** - * @file - * simple arithmetic expression evaluator - */ - -#ifndef AVUTIL_EVAL_H -#define AVUTIL_EVAL_H - -#include "avutil.h" - -typedef struct AVExpr AVExpr; - -/** - * Parse and evaluate an expression. - * Note, this is significantly slower than av_expr_eval(). - * - * @param res a pointer to a double where is put the result value of - * the expression, or NAN in case of error - * @param s expression as a zero terminated string, for example "1+2^3+5*5+sin(2/3)" - * @param const_names NULL terminated array of zero terminated strings of constant identifiers, for example {"PI", "E", 0} - * @param const_values a zero terminated array of values for the identifiers from const_names - * @param func1_names NULL terminated array of zero terminated strings of funcs1 identifiers - * @param funcs1 NULL terminated array of function pointers for functions which take 1 argument - * @param func2_names NULL terminated array of zero terminated strings of funcs2 identifiers - * @param funcs2 NULL terminated array of function pointers for functions which take 2 arguments - * @param opaque a pointer which will be passed to all functions from funcs1 and funcs2 - * @param log_ctx parent logging context - * @return >= 0 in case of success, a negative value corresponding to an - * AVERROR code otherwise - */ -int av_expr_parse_and_eval(double *res, const char *s, - const char * const *const_names, const double *const_values, - const char * const *func1_names, double (* const *funcs1)(void *, double), - const char * const *func2_names, double (* const *funcs2)(void *, double, double), - void *opaque, int log_offset, void *log_ctx); - -/** - * Parse an expression. - * - * @param expr a pointer where is put an AVExpr containing the parsed - * value in case of successful parsing, or NULL otherwise. - * The pointed to AVExpr must be freed with av_expr_free() by the user - * when it is not needed anymore. - * @param s expression as a zero terminated string, for example "1+2^3+5*5+sin(2/3)" - * @param const_names NULL terminated array of zero terminated strings of constant identifiers, for example {"PI", "E", 0} - * @param func1_names NULL terminated array of zero terminated strings of funcs1 identifiers - * @param funcs1 NULL terminated array of function pointers for functions which take 1 argument - * @param func2_names NULL terminated array of zero terminated strings of funcs2 identifiers - * @param funcs2 NULL terminated array of function pointers for functions which take 2 arguments - * @param log_ctx parent logging context - * @return >= 0 in case of success, a negative value corresponding to an - * AVERROR code otherwise - */ -int av_expr_parse(AVExpr **expr, const char *s, - const char * const *const_names, - const char * const *func1_names, double (* const *funcs1)(void *, double), - const char * const *func2_names, double (* const *funcs2)(void *, double, double), - int log_offset, void *log_ctx); - -/** - * Evaluate a previously parsed expression. - * - * @param const_values a zero terminated array of values for the identifiers from av_expr_parse() const_names - * @param opaque a pointer which will be passed to all functions from funcs1 and funcs2 - * @return the value of the expression - */ -double av_expr_eval(AVExpr *e, const double *const_values, void *opaque); - -/** - * Free a parsed expression previously created with av_expr_parse(). - */ -void av_expr_free(AVExpr *e); - -/** - * Parse the string in numstr and return its value as a double. If - * the string is empty, contains only whitespaces, or does not contain - * an initial substring that has the expected syntax for a - * floating-point number, no conversion is performed. In this case, - * returns a value of zero and the value returned in tail is the value - * of numstr. - * - * @param numstr a string representing a number, may contain one of - * the International System number postfixes, for example 'K', 'M', - * 'G'. If 'i' is appended after the postfix, powers of 2 are used - * instead of powers of 10. The 'B' postfix multiplies the value for - * 8, and can be appended after another postfix or used alone. This - * allows using for example 'KB', 'MiB', 'G' and 'B' as postfix. - * @param tail if non-NULL puts here the pointer to the char next - * after the last parsed character - */ -double av_strtod(const char *numstr, char **tail); - -#endif /* AVUTIL_EVAL_H */ diff --git a/dji_sdk_manifold_read_cam/include/libavutil/ffversion.h b/dji_sdk_manifold_read_cam/include/libavutil/ffversion.h deleted file mode 100644 index abe0a1e..0000000 --- a/dji_sdk_manifold_read_cam/include/libavutil/ffversion.h +++ /dev/null @@ -1,4 +0,0 @@ -#ifndef AVUTIL_FFVERSION_H -#define AVUTIL_FFVERSION_H -#define FFMPEG_VERSION "N-62994-g2baf1c8" -#endif /* AVUTIL_FFVERSION_H */ diff --git a/dji_sdk_manifold_read_cam/include/libavutil/fifo.h b/dji_sdk_manifold_read_cam/include/libavutil/fifo.h deleted file mode 100644 index fe7364f..0000000 --- a/dji_sdk_manifold_read_cam/include/libavutil/fifo.h +++ /dev/null @@ -1,144 +0,0 @@ -/* - * This file is part of FFmpeg. - * - * FFmpeg is free software; you can redistribute it and/or - * modify it under the terms of the GNU Lesser General Public - * License as published by the Free Software Foundation; either - * version 2.1 of the License, or (at your option) any later version. - * - * FFmpeg is distributed in the hope that it will be useful, - * but WITHOUT ANY WARRANTY; without even the implied warranty of - * MERCHANTABILITY or FITNESS FOR A PARTICULAR PURPOSE. See the GNU - * Lesser General Public License for more details. - * - * You should have received a copy of the GNU Lesser General Public - * License along with FFmpeg; if not, write to the Free Software - * Foundation, Inc., 51 Franklin Street, Fifth Floor, Boston, MA 02110-1301 USA - */ - -/** - * @file - * a very simple circular buffer FIFO implementation - */ - -#ifndef AVUTIL_FIFO_H -#define AVUTIL_FIFO_H - -#include -#include "avutil.h" -#include "attributes.h" - -typedef struct AVFifoBuffer { - uint8_t *buffer; - uint8_t *rptr, *wptr, *end; - uint32_t rndx, wndx; -} AVFifoBuffer; - -/** - * Initialize an AVFifoBuffer. - * @param size of FIFO - * @return AVFifoBuffer or NULL in case of memory allocation failure - */ -AVFifoBuffer *av_fifo_alloc(unsigned int size); - -/** - * Free an AVFifoBuffer. - * @param f AVFifoBuffer to free - */ -void av_fifo_free(AVFifoBuffer *f); - -/** - * Reset the AVFifoBuffer to the state right after av_fifo_alloc, in particular it is emptied. - * @param f AVFifoBuffer to reset - */ -void av_fifo_reset(AVFifoBuffer *f); - -/** - * Return the amount of data in bytes in the AVFifoBuffer, that is the - * amount of data you can read from it. - * @param f AVFifoBuffer to read from - * @return size - */ -int av_fifo_size(const AVFifoBuffer *f); - -/** - * Return the amount of space in bytes in the AVFifoBuffer, that is the - * amount of data you can write into it. - * @param f AVFifoBuffer to write into - * @return size - */ -int av_fifo_space(const AVFifoBuffer *f); - -/** - * Feed data from an AVFifoBuffer to a user-supplied callback. - * @param f AVFifoBuffer to read from - * @param buf_size number of bytes to read - * @param func generic read function - * @param dest data destination - */ -int av_fifo_generic_read(AVFifoBuffer *f, void *dest, int buf_size, void (*func)(void*, void*, int)); - -/** - * Feed data from a user-supplied callback to an AVFifoBuffer. - * @param f AVFifoBuffer to write to - * @param src data source; non-const since it may be used as a - * modifiable context by the function defined in func - * @param size number of bytes to write - * @param func generic write function; the first parameter is src, - * the second is dest_buf, the third is dest_buf_size. - * func must return the number of bytes written to dest_buf, or <= 0 to - * indicate no more data available to write. - * If func is NULL, src is interpreted as a simple byte array for source data. - * @return the number of bytes written to the FIFO - */ -int av_fifo_generic_write(AVFifoBuffer *f, void *src, int size, int (*func)(void*, void*, int)); - -/** - * Resize an AVFifoBuffer. - * In case of reallocation failure, the old FIFO is kept unchanged. - * - * @param f AVFifoBuffer to resize - * @param size new AVFifoBuffer size in bytes - * @return <0 for failure, >=0 otherwise - */ -int av_fifo_realloc2(AVFifoBuffer *f, unsigned int size); - -/** - * Enlarge an AVFifoBuffer. - * In case of reallocation failure, the old FIFO is kept unchanged. - * The new fifo size may be larger than the requested size. - * - * @param f AVFifoBuffer to resize - * @param additional_space the amount of space in bytes to allocate in addition to av_fifo_size() - * @return <0 for failure, >=0 otherwise - */ -int av_fifo_grow(AVFifoBuffer *f, unsigned int additional_space); - -/** - * Read and discard the specified amount of data from an AVFifoBuffer. - * @param f AVFifoBuffer to read from - * @param size amount of data to read in bytes - */ -void av_fifo_drain(AVFifoBuffer *f, int size); - -/** - * Return a pointer to the data stored in a FIFO buffer at a certain offset. - * The FIFO buffer is not modified. - * - * @param f AVFifoBuffer to peek at, f must be non-NULL - * @param offs an offset in bytes, its absolute value must be less - * than the used buffer size or the returned pointer will - * point outside to the buffer data. - * The used buffer size can be checked with av_fifo_size(). - */ -static inline uint8_t *av_fifo_peek2(const AVFifoBuffer *f, int offs) -{ - uint8_t *ptr = f->rptr + offs; - if (ptr >= f->end) - ptr = f->buffer + (ptr - f->end); - else if (ptr < f->buffer) - ptr = f->end - (f->buffer - ptr); - return ptr; -} - -#endif /* AVUTIL_FIFO_H */ diff --git a/dji_sdk_manifold_read_cam/include/libavutil/file.h b/dji_sdk_manifold_read_cam/include/libavutil/file.h deleted file mode 100644 index a7364fe..0000000 --- a/dji_sdk_manifold_read_cam/include/libavutil/file.h +++ /dev/null @@ -1,66 +0,0 @@ -/* - * This file is part of FFmpeg. - * - * FFmpeg is free software; you can redistribute it and/or - * modify it under the terms of the GNU Lesser General Public - * License as published by the Free Software Foundation; either - * version 2.1 of the License, or (at your option) any later version. - * - * FFmpeg is distributed in the hope that it will be useful, - * but WITHOUT ANY WARRANTY; without even the implied warranty of - * MERCHANTABILITY or FITNESS FOR A PARTICULAR PURPOSE. See the GNU - * Lesser General Public License for more details. - * - * You should have received a copy of the GNU Lesser General Public - * License along with FFmpeg; if not, write to the Free Software - * Foundation, Inc., 51 Franklin Street, Fifth Floor, Boston, MA 02110-1301 USA - */ - -#ifndef AVUTIL_FILE_H -#define AVUTIL_FILE_H - -#include - -#include "avutil.h" - -/** - * @file - * Misc file utilities. - */ - -/** - * Read the file with name filename, and put its content in a newly - * allocated buffer or map it with mmap() when available. - * In case of success set *bufptr to the read or mmapped buffer, and - * *size to the size in bytes of the buffer in *bufptr. - * The returned buffer must be released with av_file_unmap(). - * - * @param log_offset loglevel offset used for logging - * @param log_ctx context used for logging - * @return a non negative number in case of success, a negative value - * corresponding to an AVERROR error code in case of failure - */ -int av_file_map(const char *filename, uint8_t **bufptr, size_t *size, - int log_offset, void *log_ctx); - -/** - * Unmap or free the buffer bufptr created by av_file_map(). - * - * @param size size in bytes of bufptr, must be the same as returned - * by av_file_map() - */ -void av_file_unmap(uint8_t *bufptr, size_t size); - -/** - * Wrapper to work around the lack of mkstemp() on mingw. - * Also, tries to create file in /tmp first, if possible. - * *prefix can be a character constant; *filename will be allocated internally. - * @return file descriptor of opened file (or -1 on error) - * and opened file name in **filename. - * @note On very old libcs it is necessary to set a secure umask before - * calling this, av_tempfile() can't call umask itself as it is used in - * libraries and could interfere with the calling application. - */ -int av_tempfile(const char *prefix, char **filename, int log_offset, void *log_ctx); - -#endif /* AVUTIL_FILE_H */ diff --git a/dji_sdk_manifold_read_cam/include/libavutil/frame.h b/dji_sdk_manifold_read_cam/include/libavutil/frame.h deleted file mode 100644 index ccc86d7..0000000 --- a/dji_sdk_manifold_read_cam/include/libavutil/frame.h +++ /dev/null @@ -1,741 +0,0 @@ -/* - * - * This file is part of FFmpeg. - * - * FFmpeg is free software; you can redistribute it and/or - * modify it under the terms of the GNU Lesser General Public - * License as published by the Free Software Foundation; either - * version 2.1 of the License, or (at your option) any later version. - * - * FFmpeg is distributed in the hope that it will be useful, - * but WITHOUT ANY WARRANTY; without even the implied warranty of - * MERCHANTABILITY or FITNESS FOR A PARTICULAR PURPOSE. See the GNU - * Lesser General Public License for more details. - * - * You should have received a copy of the GNU Lesser General Public - * License along with FFmpeg; if not, write to the Free Software - * Foundation, Inc., 51 Franklin Street, Fifth Floor, Boston, MA 02110-1301 USA - */ - -/** - * @file - * @ingroup lavu_frame - * reference-counted frame API - */ - -#ifndef AVUTIL_FRAME_H -#define AVUTIL_FRAME_H - -#include - -#include "avutil.h" -#include "buffer.h" -#include "dict.h" -#include "rational.h" -#include "samplefmt.h" -#include "version.h" - - -enum AVColorSpace{ - AVCOL_SPC_RGB = 0, - AVCOL_SPC_BT709 = 1, ///< also ITU-R BT1361 / IEC 61966-2-4 xvYCC709 / SMPTE RP177 Annex B - AVCOL_SPC_UNSPECIFIED = 2, - AVCOL_SPC_FCC = 4, - AVCOL_SPC_BT470BG = 5, ///< also ITU-R BT601-6 625 / ITU-R BT1358 625 / ITU-R BT1700 625 PAL & SECAM / IEC 61966-2-4 xvYCC601 - AVCOL_SPC_SMPTE170M = 6, ///< also ITU-R BT601-6 525 / ITU-R BT1358 525 / ITU-R BT1700 NTSC / functionally identical to above - AVCOL_SPC_SMPTE240M = 7, - AVCOL_SPC_YCOCG = 8, ///< Used by Dirac / VC-2 and H.264 FRext, see ITU-T SG16 - AVCOL_SPC_BT2020_NCL = 9, ///< ITU-R BT2020 non-constant luminance system - AVCOL_SPC_BT2020_CL = 10, ///< ITU-R BT2020 constant luminance system - AVCOL_SPC_NB , ///< Not part of ABI -}; -#define AVCOL_SPC_YCGCO AVCOL_SPC_YCOCG - -enum AVColorRange{ - AVCOL_RANGE_UNSPECIFIED = 0, - AVCOL_RANGE_MPEG = 1, ///< the normal 219*2^(n-8) "MPEG" YUV ranges - AVCOL_RANGE_JPEG = 2, ///< the normal 2^n-1 "JPEG" YUV ranges - AVCOL_RANGE_NB , ///< Not part of ABI -}; - - -/** - * @defgroup lavu_frame AVFrame - * @ingroup lavu_data - * - * @{ - * AVFrame is an abstraction for reference-counted raw multimedia data. - */ - -enum AVFrameSideDataType { - /** - * The data is the AVPanScan struct defined in libavcodec. - */ - AV_FRAME_DATA_PANSCAN, - /** - * ATSC A53 Part 4 Closed Captions. - * A53 CC bitstream is stored as uint8_t in AVFrameSideData.data. - * The number of bytes of CC data is AVFrameSideData.size. - */ - AV_FRAME_DATA_A53_CC, - /** - * Stereoscopic 3d metadata. - * The data is the AVStereo3D struct defined in libavutil/stereo3d.h. - */ - AV_FRAME_DATA_STEREO3D, - /** - * The data is the AVMatrixEncoding enum defined in libavutil/channel_layout.h. - */ - AV_FRAME_DATA_MATRIXENCODING, - /** - * Metadata relevant to a downmix procedure. - * The data is the AVDownmixInfo struct defined in libavutil/downmix_info.h. - */ - AV_FRAME_DATA_DOWNMIX_INFO, - /** - * ReplayGain information in the form of the AVReplayGain struct. - */ - AV_FRAME_DATA_REPLAYGAIN, -}; - -typedef struct AVFrameSideData { - enum AVFrameSideDataType type; - uint8_t *data; - int size; - AVDictionary *metadata; -} AVFrameSideData; - -/** - * This structure describes decoded (raw) audio or video data. - * - * AVFrame must be allocated using av_frame_alloc(). Note that this only - * allocates the AVFrame itself, the buffers for the data must be managed - * through other means (see below). - * AVFrame must be freed with av_frame_free(). - * - * AVFrame is typically allocated once and then reused multiple times to hold - * different data (e.g. a single AVFrame to hold frames received from a - * decoder). In such a case, av_frame_unref() will free any references held by - * the frame and reset it to its original clean state before it - * is reused again. - * - * The data described by an AVFrame is usually reference counted through the - * AVBuffer API. The underlying buffer references are stored in AVFrame.buf / - * AVFrame.extended_buf. An AVFrame is considered to be reference counted if at - * least one reference is set, i.e. if AVFrame.buf[0] != NULL. In such a case, - * every single data plane must be contained in one of the buffers in - * AVFrame.buf or AVFrame.extended_buf. - * There may be a single buffer for all the data, or one separate buffer for - * each plane, or anything in between. - * - * sizeof(AVFrame) is not a part of the public ABI, so new fields may be added - * to the end with a minor bump. - * Similarly fields that are marked as to be only accessed by - * av_opt_ptr() can be reordered. This allows 2 forks to add fields - * without breaking compatibility with each other. - */ -typedef struct AVFrame { -#define AV_NUM_DATA_POINTERS 8 - /** - * pointer to the picture/channel planes. - * This might be different from the first allocated byte - * - * Some decoders access areas outside 0,0 - width,height, please - * see avcodec_align_dimensions2(). Some filters and swscale can read - * up to 16 bytes beyond the planes, if these filters are to be used, - * then 16 extra bytes must be allocated. - */ - uint8_t *data[AV_NUM_DATA_POINTERS]; - - /** - * For video, size in bytes of each picture line. - * For audio, size in bytes of each plane. - * - * For audio, only linesize[0] may be set. For planar audio, each channel - * plane must be the same size. - * - * For video the linesizes should be multiplies of the CPUs alignment - * preference, this is 16 or 32 for modern desktop CPUs. - * Some code requires such alignment other code can be slower without - * correct alignment, for yet other it makes no difference. - * - * @note The linesize may be larger than the size of usable data -- there - * may be extra padding present for performance reasons. - */ - int linesize[AV_NUM_DATA_POINTERS]; - - /** - * pointers to the data planes/channels. - * - * For video, this should simply point to data[]. - * - * For planar audio, each channel has a separate data pointer, and - * linesize[0] contains the size of each channel buffer. - * For packed audio, there is just one data pointer, and linesize[0] - * contains the total size of the buffer for all channels. - * - * Note: Both data and extended_data should always be set in a valid frame, - * but for planar audio with more channels that can fit in data, - * extended_data must be used in order to access all channels. - */ - uint8_t **extended_data; - - /** - * width and height of the video frame - */ - int width, height; - - /** - * number of audio samples (per channel) described by this frame - */ - int nb_samples; - - /** - * format of the frame, -1 if unknown or unset - * Values correspond to enum AVPixelFormat for video frames, - * enum AVSampleFormat for audio) - */ - int format; - - /** - * 1 -> keyframe, 0-> not - */ - int key_frame; - - /** - * Picture type of the frame. - */ - enum AVPictureType pict_type; - -#if FF_API_AVFRAME_LAVC - attribute_deprecated - uint8_t *base[AV_NUM_DATA_POINTERS]; -#endif - - /** - * Sample aspect ratio for the video frame, 0/1 if unknown/unspecified. - */ - AVRational sample_aspect_ratio; - - /** - * Presentation timestamp in time_base units (time when frame should be shown to user). - */ - int64_t pts; - - /** - * PTS copied from the AVPacket that was decoded to produce this frame. - */ - int64_t pkt_pts; - - /** - * DTS copied from the AVPacket that triggered returning this frame. (if frame threading isnt used) - * This is also the Presentation time of this AVFrame calculated from - * only AVPacket.dts values without pts values. - */ - int64_t pkt_dts; - - /** - * picture number in bitstream order - */ - int coded_picture_number; - /** - * picture number in display order - */ - int display_picture_number; - - /** - * quality (between 1 (good) and FF_LAMBDA_MAX (bad)) - */ - int quality; - -#if FF_API_AVFRAME_LAVC - attribute_deprecated - int reference; - - /** - * QP table - */ - attribute_deprecated - int8_t *qscale_table; - /** - * QP store stride - */ - attribute_deprecated - int qstride; - - attribute_deprecated - int qscale_type; - - /** - * mbskip_table[mb]>=1 if MB didn't change - * stride= mb_width = (width+15)>>4 - */ - attribute_deprecated - uint8_t *mbskip_table; - - /** - * motion vector table - * @code - * example: - * int mv_sample_log2= 4 - motion_subsample_log2; - * int mb_width= (width+15)>>4; - * int mv_stride= (mb_width << mv_sample_log2) + 1; - * motion_val[direction][x + y*mv_stride][0->mv_x, 1->mv_y]; - * @endcode - */ - int16_t (*motion_val[2])[2]; - - /** - * macroblock type table - * mb_type_base + mb_width + 2 - */ - attribute_deprecated - uint32_t *mb_type; - - /** - * DCT coefficients - */ - attribute_deprecated - short *dct_coeff; - - /** - * motion reference frame index - * the order in which these are stored can depend on the codec. - */ - attribute_deprecated - int8_t *ref_index[2]; -#endif - - /** - * for some private data of the user - */ - void *opaque; - - /** - * error - */ - uint64_t error[AV_NUM_DATA_POINTERS]; - -#if FF_API_AVFRAME_LAVC - attribute_deprecated - int type; -#endif - - /** - * When decoding, this signals how much the picture must be delayed. - * extra_delay = repeat_pict / (2*fps) - */ - int repeat_pict; - - /** - * The content of the picture is interlaced. - */ - int interlaced_frame; - - /** - * If the content is interlaced, is top field displayed first. - */ - int top_field_first; - - /** - * Tell user application that palette has changed from previous frame. - */ - int palette_has_changed; - -#if FF_API_AVFRAME_LAVC - attribute_deprecated - int buffer_hints; - - /** - * Pan scan. - */ - attribute_deprecated - struct AVPanScan *pan_scan; -#endif - - /** - * reordered opaque 64bit (generally an integer or a double precision float - * PTS but can be anything). - * The user sets AVCodecContext.reordered_opaque to represent the input at - * that time, - * the decoder reorders values as needed and sets AVFrame.reordered_opaque - * to exactly one of the values provided by the user through AVCodecContext.reordered_opaque - * @deprecated in favor of pkt_pts - */ - int64_t reordered_opaque; - -#if FF_API_AVFRAME_LAVC - /** - * @deprecated this field is unused - */ - attribute_deprecated void *hwaccel_picture_private; - - attribute_deprecated - struct AVCodecContext *owner; - attribute_deprecated - void *thread_opaque; - - /** - * log2 of the size of the block which a single vector in motion_val represents: - * (4->16x16, 3->8x8, 2-> 4x4, 1-> 2x2) - */ - uint8_t motion_subsample_log2; -#endif - - /** - * Sample rate of the audio data. - */ - int sample_rate; - - /** - * Channel layout of the audio data. - */ - uint64_t channel_layout; - - /** - * AVBuffer references backing the data for this frame. If all elements of - * this array are NULL, then this frame is not reference counted. - * - * There may be at most one AVBuffer per data plane, so for video this array - * always contains all the references. For planar audio with more than - * AV_NUM_DATA_POINTERS channels, there may be more buffers than can fit in - * this array. Then the extra AVBufferRef pointers are stored in the - * extended_buf array. - */ - AVBufferRef *buf[AV_NUM_DATA_POINTERS]; - - /** - * For planar audio which requires more than AV_NUM_DATA_POINTERS - * AVBufferRef pointers, this array will hold all the references which - * cannot fit into AVFrame.buf. - * - * Note that this is different from AVFrame.extended_data, which always - * contains all the pointers. This array only contains the extra pointers, - * which cannot fit into AVFrame.buf. - * - * This array is always allocated using av_malloc() by whoever constructs - * the frame. It is freed in av_frame_unref(). - */ - AVBufferRef **extended_buf; - /** - * Number of elements in extended_buf. - */ - int nb_extended_buf; - - AVFrameSideData **side_data; - int nb_side_data; - -/** - * @defgroup lavu_frame_flags AV_FRAME_FLAGS - * Flags describing additional frame properties. - * - * @{ - */ - -/** - * The frame data may be corrupted, e.g. due to decoding errors. - */ -#define AV_FRAME_FLAG_CORRUPT (1 << 0) -/** - * @} - */ - - /** - * Frame flags, a combination of @ref lavu_frame_flags - */ - int flags; - - /** - * frame timestamp estimated using various heuristics, in stream time base - * Code outside libavcodec should access this field using: - * av_frame_get_best_effort_timestamp(frame) - * - encoding: unused - * - decoding: set by libavcodec, read by user. - */ - int64_t best_effort_timestamp; - - /** - * reordered pos from the last AVPacket that has been input into the decoder - * Code outside libavcodec should access this field using: - * av_frame_get_pkt_pos(frame) - * - encoding: unused - * - decoding: Read by user. - */ - int64_t pkt_pos; - - /** - * duration of the corresponding packet, expressed in - * AVStream->time_base units, 0 if unknown. - * Code outside libavcodec should access this field using: - * av_frame_get_pkt_duration(frame) - * - encoding: unused - * - decoding: Read by user. - */ - int64_t pkt_duration; - - /** - * metadata. - * Code outside libavcodec should access this field using: - * av_frame_get_metadata(frame) - * - encoding: Set by user. - * - decoding: Set by libavcodec. - */ - AVDictionary *metadata; - - /** - * decode error flags of the frame, set to a combination of - * FF_DECODE_ERROR_xxx flags if the decoder produced a frame, but there - * were errors during the decoding. - * Code outside libavcodec should access this field using: - * av_frame_get_decode_error_flags(frame) - * - encoding: unused - * - decoding: set by libavcodec, read by user. - */ - int decode_error_flags; -#define FF_DECODE_ERROR_INVALID_BITSTREAM 1 -#define FF_DECODE_ERROR_MISSING_REFERENCE 2 - - /** - * number of audio channels, only used for audio. - * Code outside libavcodec should access this field using: - * av_frame_get_channels(frame) - * - encoding: unused - * - decoding: Read by user. - */ - int channels; - - /** - * size of the corresponding packet containing the compressed - * frame. It must be accessed using av_frame_get_pkt_size() and - * av_frame_set_pkt_size(). - * It is set to a negative value if unknown. - * - encoding: unused - * - decoding: set by libavcodec, read by user. - */ - int pkt_size; - - /** - * YUV colorspace type. - * It must be accessed using av_frame_get_colorspace() and - * av_frame_set_colorspace(). - * - encoding: Set by user - * - decoding: Set by libavcodec - */ - enum AVColorSpace colorspace; - - /** - * MPEG vs JPEG YUV range. - * It must be accessed using av_frame_get_color_range() and - * av_frame_set_color_range(). - * - encoding: Set by user - * - decoding: Set by libavcodec - */ - enum AVColorRange color_range; - - - /** - * Not to be accessed directly from outside libavutil - */ - AVBufferRef *qp_table_buf; -} AVFrame; - -/** - * Accessors for some AVFrame fields. - * The position of these field in the structure is not part of the ABI, - * they should not be accessed directly outside libavcodec. - */ -int64_t av_frame_get_best_effort_timestamp(const AVFrame *frame); -void av_frame_set_best_effort_timestamp(AVFrame *frame, int64_t val); -int64_t av_frame_get_pkt_duration (const AVFrame *frame); -void av_frame_set_pkt_duration (AVFrame *frame, int64_t val); -int64_t av_frame_get_pkt_pos (const AVFrame *frame); -void av_frame_set_pkt_pos (AVFrame *frame, int64_t val); -int64_t av_frame_get_channel_layout (const AVFrame *frame); -void av_frame_set_channel_layout (AVFrame *frame, int64_t val); -int av_frame_get_channels (const AVFrame *frame); -void av_frame_set_channels (AVFrame *frame, int val); -int av_frame_get_sample_rate (const AVFrame *frame); -void av_frame_set_sample_rate (AVFrame *frame, int val); -AVDictionary *av_frame_get_metadata (const AVFrame *frame); -void av_frame_set_metadata (AVFrame *frame, AVDictionary *val); -int av_frame_get_decode_error_flags (const AVFrame *frame); -void av_frame_set_decode_error_flags (AVFrame *frame, int val); -int av_frame_get_pkt_size(const AVFrame *frame); -void av_frame_set_pkt_size(AVFrame *frame, int val); -AVDictionary **avpriv_frame_get_metadatap(AVFrame *frame); -int8_t *av_frame_get_qp_table(AVFrame *f, int *stride, int *type); -int av_frame_set_qp_table(AVFrame *f, AVBufferRef *buf, int stride, int type); -enum AVColorSpace av_frame_get_colorspace(const AVFrame *frame); -void av_frame_set_colorspace(AVFrame *frame, enum AVColorSpace val); -enum AVColorRange av_frame_get_color_range(const AVFrame *frame); -void av_frame_set_color_range(AVFrame *frame, enum AVColorRange val); - -/** - * Get the name of a colorspace. - * @return a static string identifying the colorspace; can be NULL. - */ -const char *av_get_colorspace_name(enum AVColorSpace val); - -/** - * Allocate an AVFrame and set its fields to default values. The resulting - * struct must be freed using av_frame_free(). - * - * @return An AVFrame filled with default values or NULL on failure. - * - * @note this only allocates the AVFrame itself, not the data buffers. Those - * must be allocated through other means, e.g. with av_frame_get_buffer() or - * manually. - */ -AVFrame *av_frame_alloc(void); - -/** - * Free the frame and any dynamically allocated objects in it, - * e.g. extended_data. If the frame is reference counted, it will be - * unreferenced first. - * - * @param frame frame to be freed. The pointer will be set to NULL. - */ -void av_frame_free(AVFrame **frame); - -/** - * Set up a new reference to the data described by the source frame. - * - * Copy frame properties from src to dst and create a new reference for each - * AVBufferRef from src. - * - * If src is not reference counted, new buffers are allocated and the data is - * copied. - * - * @return 0 on success, a negative AVERROR on error - */ -int av_frame_ref(AVFrame *dst, const AVFrame *src); - -/** - * Create a new frame that references the same data as src. - * - * This is a shortcut for av_frame_alloc()+av_frame_ref(). - * - * @return newly created AVFrame on success, NULL on error. - */ -AVFrame *av_frame_clone(const AVFrame *src); - -/** - * Unreference all the buffers referenced by frame and reset the frame fields. - */ -void av_frame_unref(AVFrame *frame); - -/** - * Move everythnig contained in src to dst and reset src. - */ -void av_frame_move_ref(AVFrame *dst, AVFrame *src); - -/** - * Allocate new buffer(s) for audio or video data. - * - * The following fields must be set on frame before calling this function: - * - format (pixel format for video, sample format for audio) - * - width and height for video - * - nb_samples and channel_layout for audio - * - * This function will fill AVFrame.data and AVFrame.buf arrays and, if - * necessary, allocate and fill AVFrame.extended_data and AVFrame.extended_buf. - * For planar formats, one buffer will be allocated for each plane. - * - * @param frame frame in which to store the new buffers. - * @param align required buffer size alignment - * - * @return 0 on success, a negative AVERROR on error. - */ -int av_frame_get_buffer(AVFrame *frame, int align); - -/** - * Check if the frame data is writable. - * - * @return A positive value if the frame data is writable (which is true if and - * only if each of the underlying buffers has only one reference, namely the one - * stored in this frame). Return 0 otherwise. - * - * If 1 is returned the answer is valid until av_buffer_ref() is called on any - * of the underlying AVBufferRefs (e.g. through av_frame_ref() or directly). - * - * @see av_frame_make_writable(), av_buffer_is_writable() - */ -int av_frame_is_writable(AVFrame *frame); - -/** - * Ensure that the frame data is writable, avoiding data copy if possible. - * - * Do nothing if the frame is writable, allocate new buffers and copy the data - * if it is not. - * - * @return 0 on success, a negative AVERROR on error. - * - * @see av_frame_is_writable(), av_buffer_is_writable(), - * av_buffer_make_writable() - */ -int av_frame_make_writable(AVFrame *frame); - -/** - * Copy the frame data from src to dst. - * - * This function does not allocate anything, dst must be already initialized and - * allocated with the same parameters as src. - * - * This function only copies the frame data (i.e. the contents of the data / - * extended data arrays), not any other properties. - * - * @return >= 0 on success, a negative AVERROR on error. - */ -int av_frame_copy(AVFrame *dst, const AVFrame *src); - -/** - * Copy only "metadata" fields from src to dst. - * - * Metadata for the purpose of this function are those fields that do not affect - * the data layout in the buffers. E.g. pts, sample rate (for audio) or sample - * aspect ratio (for video), but not width/height or channel layout. - * Side data is also copied. - */ -int av_frame_copy_props(AVFrame *dst, const AVFrame *src); - -/** - * Get the buffer reference a given data plane is stored in. - * - * @param plane index of the data plane of interest in frame->extended_data. - * - * @return the buffer reference that contains the plane or NULL if the input - * frame is not valid. - */ -AVBufferRef *av_frame_get_plane_buffer(AVFrame *frame, int plane); - -/** - * Add a new side data to a frame. - * - * @param frame a frame to which the side data should be added - * @param type type of the added side data - * @param size size of the side data - * - * @return newly added side data on success, NULL on error - */ -AVFrameSideData *av_frame_new_side_data(AVFrame *frame, - enum AVFrameSideDataType type, - int size); - -/** - * @return a pointer to the side data of a given type on success, NULL if there - * is no side data with such type in this frame. - */ -AVFrameSideData *av_frame_get_side_data(const AVFrame *frame, - enum AVFrameSideDataType type); - -/** - * If side data of the supplied type exists in the frame, free it and remove it - * from the frame. - */ -void av_frame_remove_side_data(AVFrame *frame, enum AVFrameSideDataType type); - -/** - * @} - */ - -#endif /* AVUTIL_FRAME_H */ diff --git a/dji_sdk_manifold_read_cam/include/libavutil/hmac.h b/dji_sdk_manifold_read_cam/include/libavutil/hmac.h deleted file mode 100644 index d36d4de..0000000 --- a/dji_sdk_manifold_read_cam/include/libavutil/hmac.h +++ /dev/null @@ -1,99 +0,0 @@ -/* - * Copyright (C) 2012 Martin Storsjo - * - * This file is part of FFmpeg. - * - * FFmpeg is free software; you can redistribute it and/or - * modify it under the terms of the GNU Lesser General Public - * License as published by the Free Software Foundation; either - * version 2.1 of the License, or (at your option) any later version. - * - * FFmpeg is distributed in the hope that it will be useful, - * but WITHOUT ANY WARRANTY; without even the implied warranty of - * MERCHANTABILITY or FITNESS FOR A PARTICULAR PURPOSE. See the GNU - * Lesser General Public License for more details. - * - * You should have received a copy of the GNU Lesser General Public - * License along with FFmpeg; if not, write to the Free Software - * Foundation, Inc., 51 Franklin Street, Fifth Floor, Boston, MA 02110-1301 USA - */ - -#ifndef AVUTIL_HMAC_H -#define AVUTIL_HMAC_H - -#include - -/** - * @defgroup lavu_hmac HMAC - * @ingroup lavu_crypto - * @{ - */ - -enum AVHMACType { - AV_HMAC_MD5, - AV_HMAC_SHA1, - AV_HMAC_SHA224 = 10, - AV_HMAC_SHA256, - AV_HMAC_SHA384, - AV_HMAC_SHA512, -}; - -typedef struct AVHMAC AVHMAC; - -/** - * Allocate an AVHMAC context. - * @param type The hash function used for the HMAC. - */ -AVHMAC *av_hmac_alloc(enum AVHMACType type); - -/** - * Free an AVHMAC context. - * @param ctx The context to free, may be NULL - */ -void av_hmac_free(AVHMAC *ctx); - -/** - * Initialize an AVHMAC context with an authentication key. - * @param ctx The HMAC context - * @param key The authentication key - * @param keylen The length of the key, in bytes - */ -void av_hmac_init(AVHMAC *ctx, const uint8_t *key, unsigned int keylen); - -/** - * Hash data with the HMAC. - * @param ctx The HMAC context - * @param data The data to hash - * @param len The length of the data, in bytes - */ -void av_hmac_update(AVHMAC *ctx, const uint8_t *data, unsigned int len); - -/** - * Finish hashing and output the HMAC digest. - * @param ctx The HMAC context - * @param out The output buffer to write the digest into - * @param outlen The length of the out buffer, in bytes - * @return The number of bytes written to out, or a negative error code. - */ -int av_hmac_final(AVHMAC *ctx, uint8_t *out, unsigned int outlen); - -/** - * Hash an array of data with a key. - * @param ctx The HMAC context - * @param data The data to hash - * @param len The length of the data, in bytes - * @param key The authentication key - * @param keylen The length of the key, in bytes - * @param out The output buffer to write the digest into - * @param outlen The length of the out buffer, in bytes - * @return The number of bytes written to out, or a negative error code. - */ -int av_hmac_calc(AVHMAC *ctx, const uint8_t *data, unsigned int len, - const uint8_t *key, unsigned int keylen, - uint8_t *out, unsigned int outlen); - -/** - * @} - */ - -#endif /* AVUTIL_HMAC_H */ diff --git a/dji_sdk_manifold_read_cam/include/libavutil/imgutils.h b/dji_sdk_manifold_read_cam/include/libavutil/imgutils.h deleted file mode 100644 index ab32d66..0000000 --- a/dji_sdk_manifold_read_cam/include/libavutil/imgutils.h +++ /dev/null @@ -1,200 +0,0 @@ -/* - * This file is part of FFmpeg. - * - * FFmpeg is free software; you can redistribute it and/or - * modify it under the terms of the GNU Lesser General Public - * License as published by the Free Software Foundation; either - * version 2.1 of the License, or (at your option) any later version. - * - * FFmpeg is distributed in the hope that it will be useful, - * but WITHOUT ANY WARRANTY; without even the implied warranty of - * MERCHANTABILITY or FITNESS FOR A PARTICULAR PURPOSE. See the GNU - * Lesser General Public License for more details. - * - * You should have received a copy of the GNU Lesser General Public - * License along with FFmpeg; if not, write to the Free Software - * Foundation, Inc., 51 Franklin Street, Fifth Floor, Boston, MA 02110-1301 USA - */ - -#ifndef AVUTIL_IMGUTILS_H -#define AVUTIL_IMGUTILS_H - -/** - * @file - * misc image utilities - * - * @addtogroup lavu_picture - * @{ - */ - -#include "avutil.h" -#include "pixdesc.h" - -/** - * Compute the max pixel step for each plane of an image with a - * format described by pixdesc. - * - * The pixel step is the distance in bytes between the first byte of - * the group of bytes which describe a pixel component and the first - * byte of the successive group in the same plane for the same - * component. - * - * @param max_pixsteps an array which is filled with the max pixel step - * for each plane. Since a plane may contain different pixel - * components, the computed max_pixsteps[plane] is relative to the - * component in the plane with the max pixel step. - * @param max_pixstep_comps an array which is filled with the component - * for each plane which has the max pixel step. May be NULL. - */ -void av_image_fill_max_pixsteps(int max_pixsteps[4], int max_pixstep_comps[4], - const AVPixFmtDescriptor *pixdesc); - -/** - * Compute the size of an image line with format pix_fmt and width - * width for the plane plane. - * - * @return the computed size in bytes - */ -int av_image_get_linesize(enum AVPixelFormat pix_fmt, int width, int plane); - -/** - * Fill plane linesizes for an image with pixel format pix_fmt and - * width width. - * - * @param linesizes array to be filled with the linesize for each plane - * @return >= 0 in case of success, a negative error code otherwise - */ -int av_image_fill_linesizes(int linesizes[4], enum AVPixelFormat pix_fmt, int width); - -/** - * Fill plane data pointers for an image with pixel format pix_fmt and - * height height. - * - * @param data pointers array to be filled with the pointer for each image plane - * @param ptr the pointer to a buffer which will contain the image - * @param linesizes the array containing the linesize for each - * plane, should be filled by av_image_fill_linesizes() - * @return the size in bytes required for the image buffer, a negative - * error code in case of failure - */ -int av_image_fill_pointers(uint8_t *data[4], enum AVPixelFormat pix_fmt, int height, - uint8_t *ptr, const int linesizes[4]); - -/** - * Allocate an image with size w and h and pixel format pix_fmt, and - * fill pointers and linesizes accordingly. - * The allocated image buffer has to be freed by using - * av_freep(&pointers[0]). - * - * @param align the value to use for buffer size alignment - * @return the size in bytes required for the image buffer, a negative - * error code in case of failure - */ -int av_image_alloc(uint8_t *pointers[4], int linesizes[4], - int w, int h, enum AVPixelFormat pix_fmt, int align); - -/** - * Copy image plane from src to dst. - * That is, copy "height" number of lines of "bytewidth" bytes each. - * The first byte of each successive line is separated by *_linesize - * bytes. - * - * bytewidth must be contained by both absolute values of dst_linesize - * and src_linesize, otherwise the function behavior is undefined. - * - * @param dst_linesize linesize for the image plane in dst - * @param src_linesize linesize for the image plane in src - */ -void av_image_copy_plane(uint8_t *dst, int dst_linesize, - const uint8_t *src, int src_linesize, - int bytewidth, int height); - -/** - * Copy image in src_data to dst_data. - * - * @param dst_linesizes linesizes for the image in dst_data - * @param src_linesizes linesizes for the image in src_data - */ -void av_image_copy(uint8_t *dst_data[4], int dst_linesizes[4], - const uint8_t *src_data[4], const int src_linesizes[4], - enum AVPixelFormat pix_fmt, int width, int height); - -/** - * Setup the data pointers and linesizes based on the specified image - * parameters and the provided array. - * - * The fields of the given image are filled in by using the src - * address which points to the image data buffer. Depending on the - * specified pixel format, one or multiple image data pointers and - * line sizes will be set. If a planar format is specified, several - * pointers will be set pointing to the different picture planes and - * the line sizes of the different planes will be stored in the - * lines_sizes array. Call with src == NULL to get the required - * size for the src buffer. - * - * To allocate the buffer and fill in the dst_data and dst_linesize in - * one call, use av_image_alloc(). - * - * @param dst_data data pointers to be filled in - * @param dst_linesizes linesizes for the image in dst_data to be filled in - * @param src buffer which will contain or contains the actual image data, can be NULL - * @param pix_fmt the pixel format of the image - * @param width the width of the image in pixels - * @param height the height of the image in pixels - * @param align the value used in src for linesize alignment - * @return the size in bytes required for src, a negative error code - * in case of failure - */ -int av_image_fill_arrays(uint8_t *dst_data[4], int dst_linesize[4], - const uint8_t *src, - enum AVPixelFormat pix_fmt, int width, int height, int align); - -/** - * Return the size in bytes of the amount of data required to store an - * image with the given parameters. - * - * @param[in] align the assumed linesize alignment - */ -int av_image_get_buffer_size(enum AVPixelFormat pix_fmt, int width, int height, int align); - -/** - * Copy image data from an image into a buffer. - * - * av_image_get_buffer_size() can be used to compute the required size - * for the buffer to fill. - * - * @param dst a buffer into which picture data will be copied - * @param dst_size the size in bytes of dst - * @param src_data pointers containing the source image data - * @param src_linesizes linesizes for the image in src_data - * @param pix_fmt the pixel format of the source image - * @param width the width of the source image in pixels - * @param height the height of the source image in pixels - * @param align the assumed linesize alignment for dst - * @return the number of bytes written to dst, or a negative value - * (error code) on error - */ -int av_image_copy_to_buffer(uint8_t *dst, int dst_size, - const uint8_t * const src_data[4], const int src_linesize[4], - enum AVPixelFormat pix_fmt, int width, int height, int align); - -/** - * Check if the given dimension of an image is valid, meaning that all - * bytes of the image can be addressed with a signed int. - * - * @param w the width of the picture - * @param h the height of the picture - * @param log_offset the offset to sum to the log level for logging with log_ctx - * @param log_ctx the parent logging context, it may be NULL - * @return >= 0 if valid, a negative error code otherwise - */ -int av_image_check_size(unsigned int w, unsigned int h, int log_offset, void *log_ctx); - -int avpriv_set_systematic_pal2(uint32_t pal[256], enum AVPixelFormat pix_fmt); - -/** - * @} - */ - - -#endif /* AVUTIL_IMGUTILS_H */ diff --git a/dji_sdk_manifold_read_cam/include/libavutil/intfloat.h b/dji_sdk_manifold_read_cam/include/libavutil/intfloat.h deleted file mode 100644 index fe3d7ec..0000000 --- a/dji_sdk_manifold_read_cam/include/libavutil/intfloat.h +++ /dev/null @@ -1,77 +0,0 @@ -/* - * Copyright (c) 2011 Mans Rullgard - * - * This file is part of FFmpeg. - * - * FFmpeg is free software; you can redistribute it and/or - * modify it under the terms of the GNU Lesser General Public - * License as published by the Free Software Foundation; either - * version 2.1 of the License, or (at your option) any later version. - * - * FFmpeg is distributed in the hope that it will be useful, - * but WITHOUT ANY WARRANTY; without even the implied warranty of - * MERCHANTABILITY or FITNESS FOR A PARTICULAR PURPOSE. See the GNU - * Lesser General Public License for more details. - * - * You should have received a copy of the GNU Lesser General Public - * License along with FFmpeg; if not, write to the Free Software - * Foundation, Inc., 51 Franklin Street, Fifth Floor, Boston, MA 02110-1301 USA - */ - -#ifndef AVUTIL_INTFLOAT_H -#define AVUTIL_INTFLOAT_H - -#include -#include "attributes.h" - -union av_intfloat32 { - uint32_t i; - float f; -}; - -union av_intfloat64 { - uint64_t i; - double f; -}; - -/** - * Reinterpret a 32-bit integer as a float. - */ -static av_always_inline float av_int2float(uint32_t i) -{ - union av_intfloat32 v; - v.i = i; - return v.f; -} - -/** - * Reinterpret a float as a 32-bit integer. - */ -static av_always_inline uint32_t av_float2int(float f) -{ - union av_intfloat32 v; - v.f = f; - return v.i; -} - -/** - * Reinterpret a 64-bit integer as a double. - */ -static av_always_inline double av_int2double(uint64_t i) -{ - union av_intfloat64 v; - v.i = i; - return v.f; -} - -/** - * Reinterpret a double as a 64-bit integer. - */ -static av_always_inline uint64_t av_double2int(double f) -{ - union av_intfloat64 v; - v.f = f; - return v.i; -} - -#endif /* AVUTIL_INTFLOAT_H */ diff --git a/dji_sdk_manifold_read_cam/include/libavutil/intfloat_readwrite.h b/dji_sdk_manifold_read_cam/include/libavutil/intfloat_readwrite.h deleted file mode 100644 index 1d79e3e..0000000 --- a/dji_sdk_manifold_read_cam/include/libavutil/intfloat_readwrite.h +++ /dev/null @@ -1,44 +0,0 @@ -/* - * copyright (c) 2005 Michael Niedermayer - * - * This file is part of FFmpeg. - * - * FFmpeg is free software; you can redistribute it and/or - * modify it under the terms of the GNU Lesser General Public - * License as published by the Free Software Foundation; either - * version 2.1 of the License, or (at your option) any later version. - * - * FFmpeg is distributed in the hope that it will be useful, - * but WITHOUT ANY WARRANTY; without even the implied warranty of - * MERCHANTABILITY or FITNESS FOR A PARTICULAR PURPOSE. See the GNU - * Lesser General Public License for more details. - * - * You should have received a copy of the GNU Lesser General Public - * License along with FFmpeg; if not, write to the Free Software - * Foundation, Inc., 51 Franklin Street, Fifth Floor, Boston, MA 02110-1301 USA - */ - -#ifndef AVUTIL_INTFLOAT_READWRITE_H -#define AVUTIL_INTFLOAT_READWRITE_H - -#include - -#include "attributes.h" -#include "version.h" - -#if FF_API_INTFLOAT -/* IEEE 80 bits extended float */ -typedef struct AVExtFloat { - uint8_t exponent[2]; - uint8_t mantissa[8]; -} AVExtFloat; - -attribute_deprecated double av_int2dbl(int64_t v) av_const; -attribute_deprecated float av_int2flt(int32_t v) av_const; -attribute_deprecated double av_ext2dbl(const AVExtFloat ext) av_const; -attribute_deprecated int64_t av_dbl2int(double d) av_const; -attribute_deprecated int32_t av_flt2int(float d) av_const; -attribute_deprecated AVExtFloat av_dbl2ext(double d) av_const; -#endif /* FF_API_INTFLOAT */ - -#endif /* AVUTIL_INTFLOAT_READWRITE_H */ diff --git a/dji_sdk_manifold_read_cam/include/libavutil/intreadwrite.h b/dji_sdk_manifold_read_cam/include/libavutil/intreadwrite.h deleted file mode 100644 index 7ee6977..0000000 --- a/dji_sdk_manifold_read_cam/include/libavutil/intreadwrite.h +++ /dev/null @@ -1,621 +0,0 @@ -/* - * This file is part of FFmpeg. - * - * FFmpeg is free software; you can redistribute it and/or - * modify it under the terms of the GNU Lesser General Public - * License as published by the Free Software Foundation; either - * version 2.1 of the License, or (at your option) any later version. - * - * FFmpeg is distributed in the hope that it will be useful, - * but WITHOUT ANY WARRANTY; without even the implied warranty of - * MERCHANTABILITY or FITNESS FOR A PARTICULAR PURPOSE. See the GNU - * Lesser General Public License for more details. - * - * You should have received a copy of the GNU Lesser General Public - * License along with FFmpeg; if not, write to the Free Software - * Foundation, Inc., 51 Franklin Street, Fifth Floor, Boston, MA 02110-1301 USA - */ - -#ifndef AVUTIL_INTREADWRITE_H -#define AVUTIL_INTREADWRITE_H - -#include -#include "libavutil/avconfig.h" -#include "attributes.h" -#include "bswap.h" - -typedef union { - uint64_t u64; - uint32_t u32[2]; - uint16_t u16[4]; - uint8_t u8 [8]; - double f64; - float f32[2]; -} av_alias av_alias64; - -typedef union { - uint32_t u32; - uint16_t u16[2]; - uint8_t u8 [4]; - float f32; -} av_alias av_alias32; - -typedef union { - uint16_t u16; - uint8_t u8 [2]; -} av_alias av_alias16; - -/* - * Arch-specific headers can provide any combination of - * AV_[RW][BLN](16|24|32|48|64) and AV_(COPY|SWAP|ZERO)(64|128) macros. - * Preprocessor symbols must be defined, even if these are implemented - * as inline functions. - */ - -#ifdef HAVE_AV_CONFIG_H - -#include "config.h" - -#if ARCH_ARM -# include "arm/intreadwrite.h" -#elif ARCH_AVR32 -# include "avr32/intreadwrite.h" -#elif ARCH_MIPS -# include "mips/intreadwrite.h" -#elif ARCH_PPC -# include "ppc/intreadwrite.h" -#elif ARCH_TOMI -# include "tomi/intreadwrite.h" -#elif ARCH_X86 -# include "x86/intreadwrite.h" -#endif - -#endif /* HAVE_AV_CONFIG_H */ - -/* - * Map AV_RNXX <-> AV_R[BL]XX for all variants provided by per-arch headers. - */ - -#if AV_HAVE_BIGENDIAN - -# if defined(AV_RN16) && !defined(AV_RB16) -# define AV_RB16(p) AV_RN16(p) -# elif !defined(AV_RN16) && defined(AV_RB16) -# define AV_RN16(p) AV_RB16(p) -# endif - -# if defined(AV_WN16) && !defined(AV_WB16) -# define AV_WB16(p, v) AV_WN16(p, v) -# elif !defined(AV_WN16) && defined(AV_WB16) -# define AV_WN16(p, v) AV_WB16(p, v) -# endif - -# if defined(AV_RN24) && !defined(AV_RB24) -# define AV_RB24(p) AV_RN24(p) -# elif !defined(AV_RN24) && defined(AV_RB24) -# define AV_RN24(p) AV_RB24(p) -# endif - -# if defined(AV_WN24) && !defined(AV_WB24) -# define AV_WB24(p, v) AV_WN24(p, v) -# elif !defined(AV_WN24) && defined(AV_WB24) -# define AV_WN24(p, v) AV_WB24(p, v) -# endif - -# if defined(AV_RN32) && !defined(AV_RB32) -# define AV_RB32(p) AV_RN32(p) -# elif !defined(AV_RN32) && defined(AV_RB32) -# define AV_RN32(p) AV_RB32(p) -# endif - -# if defined(AV_WN32) && !defined(AV_WB32) -# define AV_WB32(p, v) AV_WN32(p, v) -# elif !defined(AV_WN32) && defined(AV_WB32) -# define AV_WN32(p, v) AV_WB32(p, v) -# endif - -# if defined(AV_RN48) && !defined(AV_RB48) -# define AV_RB48(p) AV_RN48(p) -# elif !defined(AV_RN48) && defined(AV_RB48) -# define AV_RN48(p) AV_RB48(p) -# endif - -# if defined(AV_WN48) && !defined(AV_WB48) -# define AV_WB48(p, v) AV_WN48(p, v) -# elif !defined(AV_WN48) && defined(AV_WB48) -# define AV_WN48(p, v) AV_WB48(p, v) -# endif - -# if defined(AV_RN64) && !defined(AV_RB64) -# define AV_RB64(p) AV_RN64(p) -# elif !defined(AV_RN64) && defined(AV_RB64) -# define AV_RN64(p) AV_RB64(p) -# endif - -# if defined(AV_WN64) && !defined(AV_WB64) -# define AV_WB64(p, v) AV_WN64(p, v) -# elif !defined(AV_WN64) && defined(AV_WB64) -# define AV_WN64(p, v) AV_WB64(p, v) -# endif - -#else /* AV_HAVE_BIGENDIAN */ - -# if defined(AV_RN16) && !defined(AV_RL16) -# define AV_RL16(p) AV_RN16(p) -# elif !defined(AV_RN16) && defined(AV_RL16) -# define AV_RN16(p) AV_RL16(p) -# endif - -# if defined(AV_WN16) && !defined(AV_WL16) -# define AV_WL16(p, v) AV_WN16(p, v) -# elif !defined(AV_WN16) && defined(AV_WL16) -# define AV_WN16(p, v) AV_WL16(p, v) -# endif - -# if defined(AV_RN24) && !defined(AV_RL24) -# define AV_RL24(p) AV_RN24(p) -# elif !defined(AV_RN24) && defined(AV_RL24) -# define AV_RN24(p) AV_RL24(p) -# endif - -# if defined(AV_WN24) && !defined(AV_WL24) -# define AV_WL24(p, v) AV_WN24(p, v) -# elif !defined(AV_WN24) && defined(AV_WL24) -# define AV_WN24(p, v) AV_WL24(p, v) -# endif - -# if defined(AV_RN32) && !defined(AV_RL32) -# define AV_RL32(p) AV_RN32(p) -# elif !defined(AV_RN32) && defined(AV_RL32) -# define AV_RN32(p) AV_RL32(p) -# endif - -# if defined(AV_WN32) && !defined(AV_WL32) -# define AV_WL32(p, v) AV_WN32(p, v) -# elif !defined(AV_WN32) && defined(AV_WL32) -# define AV_WN32(p, v) AV_WL32(p, v) -# endif - -# if defined(AV_RN48) && !defined(AV_RL48) -# define AV_RL48(p) AV_RN48(p) -# elif !defined(AV_RN48) && defined(AV_RL48) -# define AV_RN48(p) AV_RL48(p) -# endif - -# if defined(AV_WN48) && !defined(AV_WL48) -# define AV_WL48(p, v) AV_WN48(p, v) -# elif !defined(AV_WN48) && defined(AV_WL48) -# define AV_WN48(p, v) AV_WL48(p, v) -# endif - -# if defined(AV_RN64) && !defined(AV_RL64) -# define AV_RL64(p) AV_RN64(p) -# elif !defined(AV_RN64) && defined(AV_RL64) -# define AV_RN64(p) AV_RL64(p) -# endif - -# if defined(AV_WN64) && !defined(AV_WL64) -# define AV_WL64(p, v) AV_WN64(p, v) -# elif !defined(AV_WN64) && defined(AV_WL64) -# define AV_WN64(p, v) AV_WL64(p, v) -# endif - -#endif /* !AV_HAVE_BIGENDIAN */ - -/* - * Define AV_[RW]N helper macros to simplify definitions not provided - * by per-arch headers. - */ - -#if defined(__GNUC__) && !defined(__TI_COMPILER_VERSION__) - -union unaligned_64 { uint64_t l; } __attribute__((packed)) av_alias; -union unaligned_32 { uint32_t l; } __attribute__((packed)) av_alias; -union unaligned_16 { uint16_t l; } __attribute__((packed)) av_alias; - -# define AV_RN(s, p) (((const union unaligned_##s *) (p))->l) -# define AV_WN(s, p, v) ((((union unaligned_##s *) (p))->l) = (v)) - -#elif defined(__DECC) - -# define AV_RN(s, p) (*((const __unaligned uint##s##_t*)(p))) -# define AV_WN(s, p, v) (*((__unaligned uint##s##_t*)(p)) = (v)) - -#elif AV_HAVE_FAST_UNALIGNED - -# define AV_RN(s, p) (((const av_alias##s*)(p))->u##s) -# define AV_WN(s, p, v) (((av_alias##s*)(p))->u##s = (v)) - -#else - -#ifndef AV_RB16 -# define AV_RB16(x) \ - ((((const uint8_t*)(x))[0] << 8) | \ - ((const uint8_t*)(x))[1]) -#endif -#ifndef AV_WB16 -# define AV_WB16(p, darg) do { \ - unsigned d = (darg); \ - ((uint8_t*)(p))[1] = (d); \ - ((uint8_t*)(p))[0] = (d)>>8; \ - } while(0) -#endif - -#ifndef AV_RL16 -# define AV_RL16(x) \ - ((((const uint8_t*)(x))[1] << 8) | \ - ((const uint8_t*)(x))[0]) -#endif -#ifndef AV_WL16 -# define AV_WL16(p, darg) do { \ - unsigned d = (darg); \ - ((uint8_t*)(p))[0] = (d); \ - ((uint8_t*)(p))[1] = (d)>>8; \ - } while(0) -#endif - -#ifndef AV_RB32 -# define AV_RB32(x) \ - (((uint32_t)((const uint8_t*)(x))[0] << 24) | \ - (((const uint8_t*)(x))[1] << 16) | \ - (((const uint8_t*)(x))[2] << 8) | \ - ((const uint8_t*)(x))[3]) -#endif -#ifndef AV_WB32 -# define AV_WB32(p, darg) do { \ - unsigned d = (darg); \ - ((uint8_t*)(p))[3] = (d); \ - ((uint8_t*)(p))[2] = (d)>>8; \ - ((uint8_t*)(p))[1] = (d)>>16; \ - ((uint8_t*)(p))[0] = (d)>>24; \ - } while(0) -#endif - -#ifndef AV_RL32 -# define AV_RL32(x) \ - (((uint32_t)((const uint8_t*)(x))[3] << 24) | \ - (((const uint8_t*)(x))[2] << 16) | \ - (((const uint8_t*)(x))[1] << 8) | \ - ((const uint8_t*)(x))[0]) -#endif -#ifndef AV_WL32 -# define AV_WL32(p, darg) do { \ - unsigned d = (darg); \ - ((uint8_t*)(p))[0] = (d); \ - ((uint8_t*)(p))[1] = (d)>>8; \ - ((uint8_t*)(p))[2] = (d)>>16; \ - ((uint8_t*)(p))[3] = (d)>>24; \ - } while(0) -#endif - -#ifndef AV_RB64 -# define AV_RB64(x) \ - (((uint64_t)((const uint8_t*)(x))[0] << 56) | \ - ((uint64_t)((const uint8_t*)(x))[1] << 48) | \ - ((uint64_t)((const uint8_t*)(x))[2] << 40) | \ - ((uint64_t)((const uint8_t*)(x))[3] << 32) | \ - ((uint64_t)((const uint8_t*)(x))[4] << 24) | \ - ((uint64_t)((const uint8_t*)(x))[5] << 16) | \ - ((uint64_t)((const uint8_t*)(x))[6] << 8) | \ - (uint64_t)((const uint8_t*)(x))[7]) -#endif -#ifndef AV_WB64 -# define AV_WB64(p, darg) do { \ - uint64_t d = (darg); \ - ((uint8_t*)(p))[7] = (d); \ - ((uint8_t*)(p))[6] = (d)>>8; \ - ((uint8_t*)(p))[5] = (d)>>16; \ - ((uint8_t*)(p))[4] = (d)>>24; \ - ((uint8_t*)(p))[3] = (d)>>32; \ - ((uint8_t*)(p))[2] = (d)>>40; \ - ((uint8_t*)(p))[1] = (d)>>48; \ - ((uint8_t*)(p))[0] = (d)>>56; \ - } while(0) -#endif - -#ifndef AV_RL64 -# define AV_RL64(x) \ - (((uint64_t)((const uint8_t*)(x))[7] << 56) | \ - ((uint64_t)((const uint8_t*)(x))[6] << 48) | \ - ((uint64_t)((const uint8_t*)(x))[5] << 40) | \ - ((uint64_t)((const uint8_t*)(x))[4] << 32) | \ - ((uint64_t)((const uint8_t*)(x))[3] << 24) | \ - ((uint64_t)((const uint8_t*)(x))[2] << 16) | \ - ((uint64_t)((const uint8_t*)(x))[1] << 8) | \ - (uint64_t)((const uint8_t*)(x))[0]) -#endif -#ifndef AV_WL64 -# define AV_WL64(p, darg) do { \ - uint64_t d = (darg); \ - ((uint8_t*)(p))[0] = (d); \ - ((uint8_t*)(p))[1] = (d)>>8; \ - ((uint8_t*)(p))[2] = (d)>>16; \ - ((uint8_t*)(p))[3] = (d)>>24; \ - ((uint8_t*)(p))[4] = (d)>>32; \ - ((uint8_t*)(p))[5] = (d)>>40; \ - ((uint8_t*)(p))[6] = (d)>>48; \ - ((uint8_t*)(p))[7] = (d)>>56; \ - } while(0) -#endif - -#if AV_HAVE_BIGENDIAN -# define AV_RN(s, p) AV_RB##s(p) -# define AV_WN(s, p, v) AV_WB##s(p, v) -#else -# define AV_RN(s, p) AV_RL##s(p) -# define AV_WN(s, p, v) AV_WL##s(p, v) -#endif - -#endif /* HAVE_FAST_UNALIGNED */ - -#ifndef AV_RN16 -# define AV_RN16(p) AV_RN(16, p) -#endif - -#ifndef AV_RN32 -# define AV_RN32(p) AV_RN(32, p) -#endif - -#ifndef AV_RN64 -# define AV_RN64(p) AV_RN(64, p) -#endif - -#ifndef AV_WN16 -# define AV_WN16(p, v) AV_WN(16, p, v) -#endif - -#ifndef AV_WN32 -# define AV_WN32(p, v) AV_WN(32, p, v) -#endif - -#ifndef AV_WN64 -# define AV_WN64(p, v) AV_WN(64, p, v) -#endif - -#if AV_HAVE_BIGENDIAN -# define AV_RB(s, p) AV_RN##s(p) -# define AV_WB(s, p, v) AV_WN##s(p, v) -# define AV_RL(s, p) av_bswap##s(AV_RN##s(p)) -# define AV_WL(s, p, v) AV_WN##s(p, av_bswap##s(v)) -#else -# define AV_RB(s, p) av_bswap##s(AV_RN##s(p)) -# define AV_WB(s, p, v) AV_WN##s(p, av_bswap##s(v)) -# define AV_RL(s, p) AV_RN##s(p) -# define AV_WL(s, p, v) AV_WN##s(p, v) -#endif - -#define AV_RB8(x) (((const uint8_t*)(x))[0]) -#define AV_WB8(p, d) do { ((uint8_t*)(p))[0] = (d); } while(0) - -#define AV_RL8(x) AV_RB8(x) -#define AV_WL8(p, d) AV_WB8(p, d) - -#ifndef AV_RB16 -# define AV_RB16(p) AV_RB(16, p) -#endif -#ifndef AV_WB16 -# define AV_WB16(p, v) AV_WB(16, p, v) -#endif - -#ifndef AV_RL16 -# define AV_RL16(p) AV_RL(16, p) -#endif -#ifndef AV_WL16 -# define AV_WL16(p, v) AV_WL(16, p, v) -#endif - -#ifndef AV_RB32 -# define AV_RB32(p) AV_RB(32, p) -#endif -#ifndef AV_WB32 -# define AV_WB32(p, v) AV_WB(32, p, v) -#endif - -#ifndef AV_RL32 -# define AV_RL32(p) AV_RL(32, p) -#endif -#ifndef AV_WL32 -# define AV_WL32(p, v) AV_WL(32, p, v) -#endif - -#ifndef AV_RB64 -# define AV_RB64(p) AV_RB(64, p) -#endif -#ifndef AV_WB64 -# define AV_WB64(p, v) AV_WB(64, p, v) -#endif - -#ifndef AV_RL64 -# define AV_RL64(p) AV_RL(64, p) -#endif -#ifndef AV_WL64 -# define AV_WL64(p, v) AV_WL(64, p, v) -#endif - -#ifndef AV_RB24 -# define AV_RB24(x) \ - ((((const uint8_t*)(x))[0] << 16) | \ - (((const uint8_t*)(x))[1] << 8) | \ - ((const uint8_t*)(x))[2]) -#endif -#ifndef AV_WB24 -# define AV_WB24(p, d) do { \ - ((uint8_t*)(p))[2] = (d); \ - ((uint8_t*)(p))[1] = (d)>>8; \ - ((uint8_t*)(p))[0] = (d)>>16; \ - } while(0) -#endif - -#ifndef AV_RL24 -# define AV_RL24(x) \ - ((((const uint8_t*)(x))[2] << 16) | \ - (((const uint8_t*)(x))[1] << 8) | \ - ((const uint8_t*)(x))[0]) -#endif -#ifndef AV_WL24 -# define AV_WL24(p, d) do { \ - ((uint8_t*)(p))[0] = (d); \ - ((uint8_t*)(p))[1] = (d)>>8; \ - ((uint8_t*)(p))[2] = (d)>>16; \ - } while(0) -#endif - -#ifndef AV_RB48 -# define AV_RB48(x) \ - (((uint64_t)((const uint8_t*)(x))[0] << 40) | \ - ((uint64_t)((const uint8_t*)(x))[1] << 32) | \ - ((uint64_t)((const uint8_t*)(x))[2] << 24) | \ - ((uint64_t)((const uint8_t*)(x))[3] << 16) | \ - ((uint64_t)((const uint8_t*)(x))[4] << 8) | \ - (uint64_t)((const uint8_t*)(x))[5]) -#endif -#ifndef AV_WB48 -# define AV_WB48(p, darg) do { \ - uint64_t d = (darg); \ - ((uint8_t*)(p))[5] = (d); \ - ((uint8_t*)(p))[4] = (d)>>8; \ - ((uint8_t*)(p))[3] = (d)>>16; \ - ((uint8_t*)(p))[2] = (d)>>24; \ - ((uint8_t*)(p))[1] = (d)>>32; \ - ((uint8_t*)(p))[0] = (d)>>40; \ - } while(0) -#endif - -#ifndef AV_RL48 -# define AV_RL48(x) \ - (((uint64_t)((const uint8_t*)(x))[5] << 40) | \ - ((uint64_t)((const uint8_t*)(x))[4] << 32) | \ - ((uint64_t)((const uint8_t*)(x))[3] << 24) | \ - ((uint64_t)((const uint8_t*)(x))[2] << 16) | \ - ((uint64_t)((const uint8_t*)(x))[1] << 8) | \ - (uint64_t)((const uint8_t*)(x))[0]) -#endif -#ifndef AV_WL48 -# define AV_WL48(p, darg) do { \ - uint64_t d = (darg); \ - ((uint8_t*)(p))[0] = (d); \ - ((uint8_t*)(p))[1] = (d)>>8; \ - ((uint8_t*)(p))[2] = (d)>>16; \ - ((uint8_t*)(p))[3] = (d)>>24; \ - ((uint8_t*)(p))[4] = (d)>>32; \ - ((uint8_t*)(p))[5] = (d)>>40; \ - } while(0) -#endif - -/* - * The AV_[RW]NA macros access naturally aligned data - * in a type-safe way. - */ - -#define AV_RNA(s, p) (((const av_alias##s*)(p))->u##s) -#define AV_WNA(s, p, v) (((av_alias##s*)(p))->u##s = (v)) - -#ifndef AV_RN16A -# define AV_RN16A(p) AV_RNA(16, p) -#endif - -#ifndef AV_RN32A -# define AV_RN32A(p) AV_RNA(32, p) -#endif - -#ifndef AV_RN64A -# define AV_RN64A(p) AV_RNA(64, p) -#endif - -#ifndef AV_WN16A -# define AV_WN16A(p, v) AV_WNA(16, p, v) -#endif - -#ifndef AV_WN32A -# define AV_WN32A(p, v) AV_WNA(32, p, v) -#endif - -#ifndef AV_WN64A -# define AV_WN64A(p, v) AV_WNA(64, p, v) -#endif - -/* - * The AV_COPYxxU macros are suitable for copying data to/from unaligned - * memory locations. - */ - -#define AV_COPYU(n, d, s) AV_WN##n(d, AV_RN##n(s)); - -#ifndef AV_COPY16U -# define AV_COPY16U(d, s) AV_COPYU(16, d, s) -#endif - -#ifndef AV_COPY32U -# define AV_COPY32U(d, s) AV_COPYU(32, d, s) -#endif - -#ifndef AV_COPY64U -# define AV_COPY64U(d, s) AV_COPYU(64, d, s) -#endif - -#ifndef AV_COPY128U -# define AV_COPY128U(d, s) \ - do { \ - AV_COPY64U(d, s); \ - AV_COPY64U((char *)(d) + 8, (const char *)(s) + 8); \ - } while(0) -#endif - -/* Parameters for AV_COPY*, AV_SWAP*, AV_ZERO* must be - * naturally aligned. They may be implemented using MMX, - * so emms_c() must be called before using any float code - * afterwards. - */ - -#define AV_COPY(n, d, s) \ - (((av_alias##n*)(d))->u##n = ((const av_alias##n*)(s))->u##n) - -#ifndef AV_COPY16 -# define AV_COPY16(d, s) AV_COPY(16, d, s) -#endif - -#ifndef AV_COPY32 -# define AV_COPY32(d, s) AV_COPY(32, d, s) -#endif - -#ifndef AV_COPY64 -# define AV_COPY64(d, s) AV_COPY(64, d, s) -#endif - -#ifndef AV_COPY128 -# define AV_COPY128(d, s) \ - do { \ - AV_COPY64(d, s); \ - AV_COPY64((char*)(d)+8, (char*)(s)+8); \ - } while(0) -#endif - -#define AV_SWAP(n, a, b) FFSWAP(av_alias##n, *(av_alias##n*)(a), *(av_alias##n*)(b)) - -#ifndef AV_SWAP64 -# define AV_SWAP64(a, b) AV_SWAP(64, a, b) -#endif - -#define AV_ZERO(n, d) (((av_alias##n*)(d))->u##n = 0) - -#ifndef AV_ZERO16 -# define AV_ZERO16(d) AV_ZERO(16, d) -#endif - -#ifndef AV_ZERO32 -# define AV_ZERO32(d) AV_ZERO(32, d) -#endif - -#ifndef AV_ZERO64 -# define AV_ZERO64(d) AV_ZERO(64, d) -#endif - -#ifndef AV_ZERO128 -# define AV_ZERO128(d) \ - do { \ - AV_ZERO64(d); \ - AV_ZERO64((char*)(d)+8); \ - } while(0) -#endif - -#endif /* AVUTIL_INTREADWRITE_H */ diff --git a/dji_sdk_manifold_read_cam/include/libavutil/lfg.h b/dji_sdk_manifold_read_cam/include/libavutil/lfg.h deleted file mode 100644 index ec90562..0000000 --- a/dji_sdk_manifold_read_cam/include/libavutil/lfg.h +++ /dev/null @@ -1,62 +0,0 @@ -/* - * Lagged Fibonacci PRNG - * Copyright (c) 2008 Michael Niedermayer - * - * This file is part of FFmpeg. - * - * FFmpeg is free software; you can redistribute it and/or - * modify it under the terms of the GNU Lesser General Public - * License as published by the Free Software Foundation; either - * version 2.1 of the License, or (at your option) any later version. - * - * FFmpeg is distributed in the hope that it will be useful, - * but WITHOUT ANY WARRANTY; without even the implied warranty of - * MERCHANTABILITY or FITNESS FOR A PARTICULAR PURPOSE. See the GNU - * Lesser General Public License for more details. - * - * You should have received a copy of the GNU Lesser General Public - * License along with FFmpeg; if not, write to the Free Software - * Foundation, Inc., 51 Franklin Street, Fifth Floor, Boston, MA 02110-1301 USA - */ - -#ifndef AVUTIL_LFG_H -#define AVUTIL_LFG_H - -typedef struct AVLFG { - unsigned int state[64]; - int index; -} AVLFG; - -void av_lfg_init(AVLFG *c, unsigned int seed); - -/** - * Get the next random unsigned 32-bit number using an ALFG. - * - * Please also consider a simple LCG like state= state*1664525+1013904223, - * it may be good enough and faster for your specific use case. - */ -static inline unsigned int av_lfg_get(AVLFG *c){ - c->state[c->index & 63] = c->state[(c->index-24) & 63] + c->state[(c->index-55) & 63]; - return c->state[c->index++ & 63]; -} - -/** - * Get the next random unsigned 32-bit number using a MLFG. - * - * Please also consider av_lfg_get() above, it is faster. - */ -static inline unsigned int av_mlfg_get(AVLFG *c){ - unsigned int a= c->state[(c->index-55) & 63]; - unsigned int b= c->state[(c->index-24) & 63]; - return c->state[c->index++ & 63] = 2*a*b+a+b; -} - -/** - * Get the next two numbers generated by a Box-Muller Gaussian - * generator using the random numbers issued by lfg. - * - * @param out array where the two generated numbers are placed - */ -void av_bmg_get(AVLFG *lfg, double out[2]); - -#endif /* AVUTIL_LFG_H */ diff --git a/dji_sdk_manifold_read_cam/include/libavutil/log.h b/dji_sdk_manifold_read_cam/include/libavutil/log.h deleted file mode 100644 index a6a07e0..0000000 --- a/dji_sdk_manifold_read_cam/include/libavutil/log.h +++ /dev/null @@ -1,340 +0,0 @@ -/* - * copyright (c) 2006 Michael Niedermayer - * - * This file is part of FFmpeg. - * - * FFmpeg is free software; you can redistribute it and/or - * modify it under the terms of the GNU Lesser General Public - * License as published by the Free Software Foundation; either - * version 2.1 of the License, or (at your option) any later version. - * - * FFmpeg is distributed in the hope that it will be useful, - * but WITHOUT ANY WARRANTY; without even the implied warranty of - * MERCHANTABILITY or FITNESS FOR A PARTICULAR PURPOSE. See the GNU - * Lesser General Public License for more details. - * - * You should have received a copy of the GNU Lesser General Public - * License along with FFmpeg; if not, write to the Free Software - * Foundation, Inc., 51 Franklin Street, Fifth Floor, Boston, MA 02110-1301 USA - */ - -#ifndef AVUTIL_LOG_H -#define AVUTIL_LOG_H - -#include -#include "avutil.h" -#include "attributes.h" - -typedef enum { - AV_CLASS_CATEGORY_NA = 0, - AV_CLASS_CATEGORY_INPUT, - AV_CLASS_CATEGORY_OUTPUT, - AV_CLASS_CATEGORY_MUXER, - AV_CLASS_CATEGORY_DEMUXER, - AV_CLASS_CATEGORY_ENCODER, - AV_CLASS_CATEGORY_DECODER, - AV_CLASS_CATEGORY_FILTER, - AV_CLASS_CATEGORY_BITSTREAM_FILTER, - AV_CLASS_CATEGORY_SWSCALER, - AV_CLASS_CATEGORY_SWRESAMPLER, - AV_CLASS_CATEGORY_DEVICE_VIDEO_OUTPUT = 40, - AV_CLASS_CATEGORY_DEVICE_VIDEO_INPUT, - AV_CLASS_CATEGORY_DEVICE_AUDIO_OUTPUT, - AV_CLASS_CATEGORY_DEVICE_AUDIO_INPUT, - AV_CLASS_CATEGORY_DEVICE_OUTPUT, - AV_CLASS_CATEGORY_DEVICE_INPUT, - AV_CLASS_CATEGORY_NB, ///< not part of ABI/API -}AVClassCategory; - -struct AVOptionRanges; - -/** - * Describe the class of an AVClass context structure. That is an - * arbitrary struct of which the first field is a pointer to an - * AVClass struct (e.g. AVCodecContext, AVFormatContext etc.). - */ -typedef struct AVClass { - /** - * The name of the class; usually it is the same name as the - * context structure type to which the AVClass is associated. - */ - const char* class_name; - - /** - * A pointer to a function which returns the name of a context - * instance ctx associated with the class. - */ - const char* (*item_name)(void* ctx); - - /** - * a pointer to the first option specified in the class if any or NULL - * - * @see av_set_default_options() - */ - const struct AVOption *option; - - /** - * LIBAVUTIL_VERSION with which this structure was created. - * This is used to allow fields to be added without requiring major - * version bumps everywhere. - */ - - int version; - - /** - * Offset in the structure where log_level_offset is stored. - * 0 means there is no such variable - */ - int log_level_offset_offset; - - /** - * Offset in the structure where a pointer to the parent context for - * logging is stored. For example a decoder could pass its AVCodecContext - * to eval as such a parent context, which an av_log() implementation - * could then leverage to display the parent context. - * The offset can be NULL. - */ - int parent_log_context_offset; - - /** - * Return next AVOptions-enabled child or NULL - */ - void* (*child_next)(void *obj, void *prev); - - /** - * Return an AVClass corresponding to the next potential - * AVOptions-enabled child. - * - * The difference between child_next and this is that - * child_next iterates over _already existing_ objects, while - * child_class_next iterates over _all possible_ children. - */ - const struct AVClass* (*child_class_next)(const struct AVClass *prev); - - /** - * Category used for visualization (like color) - * This is only set if the category is equal for all objects using this class. - * available since version (51 << 16 | 56 << 8 | 100) - */ - AVClassCategory category; - - /** - * Callback to return the category. - * available since version (51 << 16 | 59 << 8 | 100) - */ - AVClassCategory (*get_category)(void* ctx); - - /** - * Callback to return the supported/allowed ranges. - * available since version (52.12) - */ - int (*query_ranges)(struct AVOptionRanges **, void *obj, const char *key, int flags); -} AVClass; - -/** - * @addtogroup lavu_log - * - * @{ - * - * @defgroup lavu_log_constants Logging Constants - * - * @{ - */ - -/** - * Print no output. - */ -#define AV_LOG_QUIET -8 - -/** - * Something went really wrong and we will crash now. - */ -#define AV_LOG_PANIC 0 - -/** - * Something went wrong and recovery is not possible. - * For example, no header was found for a format which depends - * on headers or an illegal combination of parameters is used. - */ -#define AV_LOG_FATAL 8 - -/** - * Something went wrong and cannot losslessly be recovered. - * However, not all future data is affected. - */ -#define AV_LOG_ERROR 16 - -/** - * Something somehow does not look correct. This may or may not - * lead to problems. An example would be the use of '-vstrict -2'. - */ -#define AV_LOG_WARNING 24 - -/** - * Standard information. - */ -#define AV_LOG_INFO 32 - -/** - * Detailed information. - */ -#define AV_LOG_VERBOSE 40 - -/** - * Stuff which is only useful for libav* developers. - */ -#define AV_LOG_DEBUG 48 - -#define AV_LOG_MAX_OFFSET (AV_LOG_DEBUG - AV_LOG_QUIET) - -/** - * @} - */ - -/** - * Sets additional colors for extended debugging sessions. - * @code - av_log(ctx, AV_LOG_DEBUG|AV_LOG_C(134), "Message in purple\n"); - @endcode - * Requires 256color terminal support. Uses outside debugging is not - * recommended. - */ -#define AV_LOG_C(x) (x << 8) - -/** - * Send the specified message to the log if the level is less than or equal - * to the current av_log_level. By default, all logging messages are sent to - * stderr. This behavior can be altered by setting a different logging callback - * function. - * @see av_log_set_callback - * - * @param avcl A pointer to an arbitrary struct of which the first field is a - * pointer to an AVClass struct. - * @param level The importance level of the message expressed using a @ref - * lavu_log_constants "Logging Constant". - * @param fmt The format string (printf-compatible) that specifies how - * subsequent arguments are converted to output. - */ -void av_log(void *avcl, int level, const char *fmt, ...) av_printf_format(3, 4); - - -/** - * Send the specified message to the log if the level is less than or equal - * to the current av_log_level. By default, all logging messages are sent to - * stderr. This behavior can be altered by setting a different logging callback - * function. - * @see av_log_set_callback - * - * @param avcl A pointer to an arbitrary struct of which the first field is a - * pointer to an AVClass struct. - * @param level The importance level of the message expressed using a @ref - * lavu_log_constants "Logging Constant". - * @param fmt The format string (printf-compatible) that specifies how - * subsequent arguments are converted to output. - * @param vl The arguments referenced by the format string. - */ -void av_vlog(void *avcl, int level, const char *fmt, va_list vl); - -/** - * Get the current log level - * - * @see lavu_log_constants - * - * @return Current log level - */ -int av_log_get_level(void); - -/** - * Set the log level - * - * @see lavu_log_constants - * - * @param level Logging level - */ -void av_log_set_level(int level); - -/** - * Set the logging callback - * - * @note The callback must be thread safe, even if the application does not use - * threads itself as some codecs are multithreaded. - * - * @see av_log_default_callback - * - * @param callback A logging function with a compatible signature. - */ -void av_log_set_callback(void (*callback)(void*, int, const char*, va_list)); - -/** - * Default logging callback - * - * It prints the message to stderr, optionally colorizing it. - * - * @param avcl A pointer to an arbitrary struct of which the first field is a - * pointer to an AVClass struct. - * @param level The importance level of the message expressed using a @ref - * lavu_log_constants "Logging Constant". - * @param fmt The format string (printf-compatible) that specifies how - * subsequent arguments are converted to output. - * @param vl The arguments referenced by the format string. - */ -void av_log_default_callback(void *avcl, int level, const char *fmt, - va_list vl); - -/** - * Return the context name - * - * @param ctx The AVClass context - * - * @return The AVClass class_name - */ -const char* av_default_item_name(void* ctx); -AVClassCategory av_default_get_category(void *ptr); - -/** - * Format a line of log the same way as the default callback. - * @param line buffer to receive the formated line - * @param line_size size of the buffer - * @param print_prefix used to store whether the prefix must be printed; - * must point to a persistent integer initially set to 1 - */ -void av_log_format_line(void *ptr, int level, const char *fmt, va_list vl, - char *line, int line_size, int *print_prefix); - -/** - * av_dlog macros - * Useful to print debug messages that shouldn't get compiled in normally. - */ - -#ifdef DEBUG -# define av_dlog(pctx, ...) av_log(pctx, AV_LOG_DEBUG, __VA_ARGS__) -#else -# define av_dlog(pctx, ...) do { if (0) av_log(pctx, AV_LOG_DEBUG, __VA_ARGS__); } while (0) -#endif - -/** - * Skip repeated messages, this requires the user app to use av_log() instead of - * (f)printf as the 2 would otherwise interfere and lead to - * "Last message repeated x times" messages below (f)printf messages with some - * bad luck. - * Also to receive the last, "last repeated" line if any, the user app must - * call av_log(NULL, AV_LOG_QUIET, "%s", ""); at the end - */ -#define AV_LOG_SKIP_REPEATED 1 - -/** - * Include the log severity in messages originating from codecs. - * - * Results in messages such as: - * [rawvideo @ 0xDEADBEEF] [error] encode did not produce valid pts - */ -#define AV_LOG_PRINT_LEVEL 2 - -void av_log_set_flags(int arg); -int av_log_get_flags(void); - -/** - * @} - */ - -#endif /* AVUTIL_LOG_H */ diff --git a/dji_sdk_manifold_read_cam/include/libavutil/lzo.h b/dji_sdk_manifold_read_cam/include/libavutil/lzo.h deleted file mode 100644 index c034039..0000000 --- a/dji_sdk_manifold_read_cam/include/libavutil/lzo.h +++ /dev/null @@ -1,66 +0,0 @@ -/* - * LZO 1x decompression - * copyright (c) 2006 Reimar Doeffinger - * - * This file is part of FFmpeg. - * - * FFmpeg is free software; you can redistribute it and/or - * modify it under the terms of the GNU Lesser General Public - * License as published by the Free Software Foundation; either - * version 2.1 of the License, or (at your option) any later version. - * - * FFmpeg is distributed in the hope that it will be useful, - * but WITHOUT ANY WARRANTY; without even the implied warranty of - * MERCHANTABILITY or FITNESS FOR A PARTICULAR PURPOSE. See the GNU - * Lesser General Public License for more details. - * - * You should have received a copy of the GNU Lesser General Public - * License along with FFmpeg; if not, write to the Free Software - * Foundation, Inc., 51 Franklin Street, Fifth Floor, Boston, MA 02110-1301 USA - */ - -#ifndef AVUTIL_LZO_H -#define AVUTIL_LZO_H - -/** - * @defgroup lavu_lzo LZO - * @ingroup lavu_crypto - * - * @{ - */ - -#include - -/** @name Error flags returned by av_lzo1x_decode - * @{ */ -/// end of the input buffer reached before decoding finished -#define AV_LZO_INPUT_DEPLETED 1 -/// decoded data did not fit into output buffer -#define AV_LZO_OUTPUT_FULL 2 -/// a reference to previously decoded data was wrong -#define AV_LZO_INVALID_BACKPTR 4 -/// a non-specific error in the compressed bitstream -#define AV_LZO_ERROR 8 -/** @} */ - -#define AV_LZO_INPUT_PADDING 8 -#define AV_LZO_OUTPUT_PADDING 12 - -/** - * @brief Decodes LZO 1x compressed data. - * @param out output buffer - * @param outlen size of output buffer, number of bytes left are returned here - * @param in input buffer - * @param inlen size of input buffer, number of bytes left are returned here - * @return 0 on success, otherwise a combination of the error flags above - * - * Make sure all buffers are appropriately padded, in must provide - * AV_LZO_INPUT_PADDING, out must provide AV_LZO_OUTPUT_PADDING additional bytes. - */ -int av_lzo1x_decode(void *out, int *outlen, const void *in, int *inlen); - -/** - * @} - */ - -#endif /* AVUTIL_LZO_H */ diff --git a/dji_sdk_manifold_read_cam/include/libavutil/macros.h b/dji_sdk_manifold_read_cam/include/libavutil/macros.h deleted file mode 100644 index 4465323..0000000 --- a/dji_sdk_manifold_read_cam/include/libavutil/macros.h +++ /dev/null @@ -1,48 +0,0 @@ -/* - * This file is part of FFmpeg. - * - * FFmpeg is free software; you can redistribute it and/or - * modify it under the terms of the GNU Lesser General Public - * License as published by the Free Software Foundation; either - * version 2.1 of the License, or (at your option) any later version. - * - * FFmpeg is distributed in the hope that it will be useful, - * but WITHOUT ANY WARRANTY; without even the implied warranty of - * MERCHANTABILITY or FITNESS FOR A PARTICULAR PURPOSE. See the GNU - * Lesser General Public License for more details. - * - * You should have received a copy of the GNU Lesser General Public - * License along with FFmpeg; if not, write to the Free Software - * Foundation, Inc., 51 Franklin Street, Fifth Floor, Boston, MA 02110-1301 USA - */ - -/** - * @file - * @ingroup lavu - * Utility Preprocessor macros - */ - -#ifndef AVUTIL_MACROS_H -#define AVUTIL_MACROS_H - -/** - * @addtogroup preproc_misc Preprocessor String Macros - * - * String manipulation macros - * - * @{ - */ - -#define AV_STRINGIFY(s) AV_TOSTRING(s) -#define AV_TOSTRING(s) #s - -#define AV_GLUE(a, b) a ## b -#define AV_JOIN(a, b) AV_GLUE(a, b) - -/** - * @} - */ - -#define AV_PRAGMA(s) _Pragma(#s) - -#endif /* AVUTIL_MACROS_H */ diff --git a/dji_sdk_manifold_read_cam/include/libavutil/mathematics.h b/dji_sdk_manifold_read_cam/include/libavutil/mathematics.h deleted file mode 100644 index 88739e8..0000000 --- a/dji_sdk_manifold_read_cam/include/libavutil/mathematics.h +++ /dev/null @@ -1,164 +0,0 @@ -/* - * copyright (c) 2005-2012 Michael Niedermayer - * - * This file is part of FFmpeg. - * - * FFmpeg is free software; you can redistribute it and/or - * modify it under the terms of the GNU Lesser General Public - * License as published by the Free Software Foundation; either - * version 2.1 of the License, or (at your option) any later version. - * - * FFmpeg is distributed in the hope that it will be useful, - * but WITHOUT ANY WARRANTY; without even the implied warranty of - * MERCHANTABILITY or FITNESS FOR A PARTICULAR PURPOSE. See the GNU - * Lesser General Public License for more details. - * - * You should have received a copy of the GNU Lesser General Public - * License along with FFmpeg; if not, write to the Free Software - * Foundation, Inc., 51 Franklin Street, Fifth Floor, Boston, MA 02110-1301 USA - */ - -#ifndef AVUTIL_MATHEMATICS_H -#define AVUTIL_MATHEMATICS_H - -#include -#include -#include "attributes.h" -#include "rational.h" -#include "intfloat.h" - -#ifndef M_E -#define M_E 2.7182818284590452354 /* e */ -#endif -#ifndef M_LN2 -#define M_LN2 0.69314718055994530942 /* log_e 2 */ -#endif -#ifndef M_LN10 -#define M_LN10 2.30258509299404568402 /* log_e 10 */ -#endif -#ifndef M_LOG2_10 -#define M_LOG2_10 3.32192809488736234787 /* log_2 10 */ -#endif -#ifndef M_PHI -#define M_PHI 1.61803398874989484820 /* phi / golden ratio */ -#endif -#ifndef M_PI -#define M_PI 3.14159265358979323846 /* pi */ -#endif -#ifndef M_PI_2 -#define M_PI_2 1.57079632679489661923 /* pi/2 */ -#endif -#ifndef M_SQRT1_2 -#define M_SQRT1_2 0.70710678118654752440 /* 1/sqrt(2) */ -#endif -#ifndef M_SQRT2 -#define M_SQRT2 1.41421356237309504880 /* sqrt(2) */ -#endif -#ifndef NAN -#define NAN av_int2float(0x7fc00000) -#endif -#ifndef INFINITY -#define INFINITY av_int2float(0x7f800000) -#endif - -/** - * @addtogroup lavu_math - * @{ - */ - - -enum AVRounding { - AV_ROUND_ZERO = 0, ///< Round toward zero. - AV_ROUND_INF = 1, ///< Round away from zero. - AV_ROUND_DOWN = 2, ///< Round toward -infinity. - AV_ROUND_UP = 3, ///< Round toward +infinity. - AV_ROUND_NEAR_INF = 5, ///< Round to nearest and halfway cases away from zero. - AV_ROUND_PASS_MINMAX = 8192, ///< Flag to pass INT64_MIN/MAX through instead of rescaling, this avoids special cases for AV_NOPTS_VALUE -}; - -/** - * Return the greatest common divisor of a and b. - * If both a and b are 0 or either or both are <0 then behavior is - * undefined. - */ -int64_t av_const av_gcd(int64_t a, int64_t b); - -/** - * Rescale a 64-bit integer with rounding to nearest. - * A simple a*b/c isn't possible as it can overflow. - */ -int64_t av_rescale(int64_t a, int64_t b, int64_t c) av_const; - -/** - * Rescale a 64-bit integer with specified rounding. - * A simple a*b/c isn't possible as it can overflow. - * - * @return rescaled value a, or if AV_ROUND_PASS_MINMAX is set and a is - * INT64_MIN or INT64_MAX then a is passed through unchanged. - */ -int64_t av_rescale_rnd(int64_t a, int64_t b, int64_t c, enum AVRounding) av_const; - -/** - * Rescale a 64-bit integer by 2 rational numbers. - */ -int64_t av_rescale_q(int64_t a, AVRational bq, AVRational cq) av_const; - -/** - * Rescale a 64-bit integer by 2 rational numbers with specified rounding. - * - * @return rescaled value a, or if AV_ROUND_PASS_MINMAX is set and a is - * INT64_MIN or INT64_MAX then a is passed through unchanged. - */ -int64_t av_rescale_q_rnd(int64_t a, AVRational bq, AVRational cq, - enum AVRounding) av_const; - -/** - * Compare 2 timestamps each in its own timebases. - * The result of the function is undefined if one of the timestamps - * is outside the int64_t range when represented in the others timebase. - * @return -1 if ts_a is before ts_b, 1 if ts_a is after ts_b or 0 if they represent the same position - */ -int av_compare_ts(int64_t ts_a, AVRational tb_a, int64_t ts_b, AVRational tb_b); - -/** - * Compare 2 integers modulo mod. - * That is we compare integers a and b for which only the least - * significant log2(mod) bits are known. - * - * @param mod must be a power of 2 - * @return a negative value if a is smaller than b - * a positive value if a is greater than b - * 0 if a equals b - */ -int64_t av_compare_mod(uint64_t a, uint64_t b, uint64_t mod); - -/** - * Rescale a timestamp while preserving known durations. - * - * @param in_ts Input timestamp - * @param in_tb Input timebase - * @param fs_tb Duration and *last timebase - * @param duration duration till the next call - * @param out_tb Output timebase - */ -int64_t av_rescale_delta(AVRational in_tb, int64_t in_ts, AVRational fs_tb, int duration, int64_t *last, AVRational out_tb); - -/** - * Add a value to a timestamp. - * - * This function gurantees that when the same value is repeatly added that - * no accumulation of rounding errors occurs. - * - * @param ts Input timestamp - * @param ts_tb Input timestamp timebase - * @param inc value to add to ts - * @param inc_tb inc timebase - */ -int64_t av_add_stable(AVRational ts_tb, int64_t ts, AVRational inc_tb, int64_t inc); - - - /** - * @} - */ - -#endif /* AVUTIL_MATHEMATICS_H */ diff --git a/dji_sdk_manifold_read_cam/include/libavutil/md5.h b/dji_sdk_manifold_read_cam/include/libavutil/md5.h deleted file mode 100644 index 79702c8..0000000 --- a/dji_sdk_manifold_read_cam/include/libavutil/md5.h +++ /dev/null @@ -1,81 +0,0 @@ -/* - * copyright (c) 2006 Michael Niedermayer - * - * This file is part of FFmpeg. - * - * FFmpeg is free software; you can redistribute it and/or - * modify it under the terms of the GNU Lesser General Public - * License as published by the Free Software Foundation; either - * version 2.1 of the License, or (at your option) any later version. - * - * FFmpeg is distributed in the hope that it will be useful, - * but WITHOUT ANY WARRANTY; without even the implied warranty of - * MERCHANTABILITY or FITNESS FOR A PARTICULAR PURPOSE. See the GNU - * Lesser General Public License for more details. - * - * You should have received a copy of the GNU Lesser General Public - * License along with FFmpeg; if not, write to the Free Software - * Foundation, Inc., 51 Franklin Street, Fifth Floor, Boston, MA 02110-1301 USA - */ - -#ifndef AVUTIL_MD5_H -#define AVUTIL_MD5_H - -#include - -#include "attributes.h" -#include "version.h" - -/** - * @defgroup lavu_md5 MD5 - * @ingroup lavu_crypto - * @{ - */ - -extern const int av_md5_size; - -struct AVMD5; - -/** - * Allocate an AVMD5 context. - */ -struct AVMD5 *av_md5_alloc(void); - -/** - * Initialize MD5 hashing. - * - * @param ctx pointer to the function context (of size av_md5_size) - */ -void av_md5_init(struct AVMD5 *ctx); - -/** - * Update hash value. - * - * @param ctx hash function context - * @param src input data to update hash with - * @param len input data length - */ -void av_md5_update(struct AVMD5 *ctx, const uint8_t *src, int len); - -/** - * Finish hashing and output digest value. - * - * @param ctx hash function context - * @param dst buffer where output digest value is stored - */ -void av_md5_final(struct AVMD5 *ctx, uint8_t *dst); - -/** - * Hash an array of data. - * - * @param dst The output buffer to write the digest into - * @param src The data to hash - * @param len The length of the data, in bytes - */ -void av_md5_sum(uint8_t *dst, const uint8_t *src, const int len); - -/** - * @} - */ - -#endif /* AVUTIL_MD5_H */ diff --git a/dji_sdk_manifold_read_cam/include/libavutil/mem.h b/dji_sdk_manifold_read_cam/include/libavutil/mem.h deleted file mode 100644 index 801c53f..0000000 --- a/dji_sdk_manifold_read_cam/include/libavutil/mem.h +++ /dev/null @@ -1,378 +0,0 @@ -/* - * copyright (c) 2006 Michael Niedermayer - * - * This file is part of FFmpeg. - * - * FFmpeg is free software; you can redistribute it and/or - * modify it under the terms of the GNU Lesser General Public - * License as published by the Free Software Foundation; either - * version 2.1 of the License, or (at your option) any later version. - * - * FFmpeg is distributed in the hope that it will be useful, - * but WITHOUT ANY WARRANTY; without even the implied warranty of - * MERCHANTABILITY or FITNESS FOR A PARTICULAR PURPOSE. See the GNU - * Lesser General Public License for more details. - * - * You should have received a copy of the GNU Lesser General Public - * License along with FFmpeg; if not, write to the Free Software - * Foundation, Inc., 51 Franklin Street, Fifth Floor, Boston, MA 02110-1301 USA - */ - -/** - * @file - * memory handling functions - */ - -#ifndef AVUTIL_MEM_H -#define AVUTIL_MEM_H - -#include -#include - -#include "attributes.h" -#include "error.h" -#include "avutil.h" - -/** - * @addtogroup lavu_mem - * @{ - */ - - -#if defined(__INTEL_COMPILER) && __INTEL_COMPILER < 1110 || defined(__SUNPRO_C) - #define DECLARE_ALIGNED(n,t,v) t __attribute__ ((aligned (n))) v - #define DECLARE_ASM_CONST(n,t,v) const t __attribute__ ((aligned (n))) v -#elif defined(__TI_COMPILER_VERSION__) - #define DECLARE_ALIGNED(n,t,v) \ - AV_PRAGMA(DATA_ALIGN(v,n)) \ - t __attribute__((aligned(n))) v - #define DECLARE_ASM_CONST(n,t,v) \ - AV_PRAGMA(DATA_ALIGN(v,n)) \ - static const t __attribute__((aligned(n))) v -#elif defined(__GNUC__) - #define DECLARE_ALIGNED(n,t,v) t __attribute__ ((aligned (n))) v - #define DECLARE_ASM_CONST(n,t,v) static const t av_used __attribute__ ((aligned (n))) v -#elif defined(_MSC_VER) - #define DECLARE_ALIGNED(n,t,v) __declspec(align(n)) t v - #define DECLARE_ASM_CONST(n,t,v) __declspec(align(n)) static const t v -#else - #define DECLARE_ALIGNED(n,t,v) t v - #define DECLARE_ASM_CONST(n,t,v) static const t v -#endif - -#if AV_GCC_VERSION_AT_LEAST(3,1) - #define av_malloc_attrib __attribute__((__malloc__)) -#else - #define av_malloc_attrib -#endif - -#if AV_GCC_VERSION_AT_LEAST(4,3) - #define av_alloc_size(...) __attribute__((alloc_size(__VA_ARGS__))) -#else - #define av_alloc_size(...) -#endif - -/** - * Allocate a block of size bytes with alignment suitable for all - * memory accesses (including vectors if available on the CPU). - * @param size Size in bytes for the memory block to be allocated. - * @return Pointer to the allocated block, NULL if the block cannot - * be allocated. - * @see av_mallocz() - */ -void *av_malloc(size_t size) av_malloc_attrib av_alloc_size(1); - -/** - * Allocate a block of size * nmemb bytes with av_malloc(). - * @param nmemb Number of elements - * @param size Size of the single element - * @return Pointer to the allocated block, NULL if the block cannot - * be allocated. - * @see av_malloc() - */ -av_alloc_size(1, 2) static inline void *av_malloc_array(size_t nmemb, size_t size) -{ - if (!size || nmemb >= INT_MAX / size) - return NULL; - return av_malloc(nmemb * size); -} - -/** - * Allocate or reallocate a block of memory. - * If ptr is NULL and size > 0, allocate a new block. If - * size is zero, free the memory block pointed to by ptr. - * @param ptr Pointer to a memory block already allocated with - * av_realloc() or NULL. - * @param size Size in bytes of the memory block to be allocated or - * reallocated. - * @return Pointer to a newly-reallocated block or NULL if the block - * cannot be reallocated or the function is used to free the memory block. - * @warning Pointers originating from the av_malloc() family of functions must - * not be passed to av_realloc(). The former can be implemented using - * memalign() (or other functions), and there is no guarantee that - * pointers from such functions can be passed to realloc() at all. - * The situation is undefined according to POSIX and may crash with - * some libc implementations. - * @see av_fast_realloc() - */ -void *av_realloc(void *ptr, size_t size) av_alloc_size(2); - -/** - * Allocate or reallocate a block of memory. - * This function does the same thing as av_realloc, except: - * - It takes two arguments and checks the result of the multiplication for - * integer overflow. - * - It frees the input block in case of failure, thus avoiding the memory - * leak with the classic "buf = realloc(buf); if (!buf) return -1;". - */ -void *av_realloc_f(void *ptr, size_t nelem, size_t elsize); - -/** - * Allocate or reallocate a block of memory. - * If *ptr is NULL and size > 0, allocate a new block. If - * size is zero, free the memory block pointed to by ptr. - * @param ptr Pointer to a pointer to a memory block already allocated - * with av_realloc(), or pointer to a pointer to NULL. - * The pointer is updated on success, or freed on failure. - * @param size Size in bytes for the memory block to be allocated or - * reallocated - * @return Zero on success, an AVERROR error code on failure. - * @warning Pointers originating from the av_malloc() family of functions must - * not be passed to av_reallocp(). The former can be implemented using - * memalign() (or other functions), and there is no guarantee that - * pointers from such functions can be passed to realloc() at all. - * The situation is undefined according to POSIX and may crash with - * some libc implementations. - */ -int av_reallocp(void *ptr, size_t size); - -/** - * Allocate or reallocate an array. - * If ptr is NULL and nmemb > 0, allocate a new block. If - * nmemb is zero, free the memory block pointed to by ptr. - * @param ptr Pointer to a memory block already allocated with - * av_realloc() or NULL. - * @param nmemb Number of elements - * @param size Size of the single element - * @return Pointer to a newly-reallocated block or NULL if the block - * cannot be reallocated or the function is used to free the memory block. - * @warning Pointers originating from the av_malloc() family of functions must - * not be passed to av_realloc(). The former can be implemented using - * memalign() (or other functions), and there is no guarantee that - * pointers from such functions can be passed to realloc() at all. - * The situation is undefined according to POSIX and may crash with - * some libc implementations. - */ -av_alloc_size(2, 3) void *av_realloc_array(void *ptr, size_t nmemb, size_t size); - -/** - * Allocate or reallocate an array through a pointer to a pointer. - * If *ptr is NULL and nmemb > 0, allocate a new block. If - * nmemb is zero, free the memory block pointed to by ptr. - * @param ptr Pointer to a pointer to a memory block already allocated - * with av_realloc(), or pointer to a pointer to NULL. - * The pointer is updated on success, or freed on failure. - * @param nmemb Number of elements - * @param size Size of the single element - * @return Zero on success, an AVERROR error code on failure. - * @warning Pointers originating from the av_malloc() family of functions must - * not be passed to av_realloc(). The former can be implemented using - * memalign() (or other functions), and there is no guarantee that - * pointers from such functions can be passed to realloc() at all. - * The situation is undefined according to POSIX and may crash with - * some libc implementations. - */ -av_alloc_size(2, 3) int av_reallocp_array(void *ptr, size_t nmemb, size_t size); - -/** - * Free a memory block which has been allocated with av_malloc(z)() or - * av_realloc(). - * @param ptr Pointer to the memory block which should be freed. - * @note ptr = NULL is explicitly allowed. - * @note It is recommended that you use av_freep() instead. - * @see av_freep() - */ -void av_free(void *ptr); - -/** - * Allocate a block of size bytes with alignment suitable for all - * memory accesses (including vectors if available on the CPU) and - * zero all the bytes of the block. - * @param size Size in bytes for the memory block to be allocated. - * @return Pointer to the allocated block, NULL if it cannot be allocated. - * @see av_malloc() - */ -void *av_mallocz(size_t size) av_malloc_attrib av_alloc_size(1); - -/** - * Allocate a block of nmemb * size bytes with alignment suitable for all - * memory accesses (including vectors if available on the CPU) and - * zero all the bytes of the block. - * The allocation will fail if nmemb * size is greater than or equal - * to INT_MAX. - * @param nmemb - * @param size - * @return Pointer to the allocated block, NULL if it cannot be allocated. - */ -void *av_calloc(size_t nmemb, size_t size) av_malloc_attrib; - -/** - * Allocate a block of size * nmemb bytes with av_mallocz(). - * @param nmemb Number of elements - * @param size Size of the single element - * @return Pointer to the allocated block, NULL if the block cannot - * be allocated. - * @see av_mallocz() - * @see av_malloc_array() - */ -av_alloc_size(1, 2) static inline void *av_mallocz_array(size_t nmemb, size_t size) -{ - if (!size || nmemb >= INT_MAX / size) - return NULL; - return av_mallocz(nmemb * size); -} - -/** - * Duplicate the string s. - * @param s string to be duplicated - * @return Pointer to a newly-allocated string containing a - * copy of s or NULL if the string cannot be allocated. - */ -char *av_strdup(const char *s) av_malloc_attrib; - -/** - * Duplicate the buffer p. - * @param p buffer to be duplicated - * @return Pointer to a newly allocated buffer containing a - * copy of p or NULL if the buffer cannot be allocated. - */ -void *av_memdup(const void *p, size_t size); - -/** - * Free a memory block which has been allocated with av_malloc(z)() or - * av_realloc() and set the pointer pointing to it to NULL. - * @param ptr Pointer to the pointer to the memory block which should - * be freed. - * @see av_free() - */ -void av_freep(void *ptr); - -/** - * Add an element to a dynamic array. - * - * The array to grow is supposed to be an array of pointers to - * structures, and the element to add must be a pointer to an already - * allocated structure. - * - * The array is reallocated when its size reaches powers of 2. - * Therefore, the amortized cost of adding an element is constant. - * - * In case of success, the pointer to the array is updated in order to - * point to the new grown array, and the number pointed to by nb_ptr - * is incremented. - * In case of failure, the array is freed, *tab_ptr is set to NULL and - * *nb_ptr is set to 0. - * - * @param tab_ptr pointer to the array to grow - * @param nb_ptr pointer to the number of elements in the array - * @param elem element to add - * @see av_dynarray_add_nofree(), av_dynarray2_add() - */ -void av_dynarray_add(void *tab_ptr, int *nb_ptr, void *elem); - -/** - * Add an element to a dynamic array. - * - * Function has the same functionality as av_dynarray_add(), - * but it doesn't free memory on fails. It returns error code - * instead and leave current buffer untouched. - * - * @param tab_ptr pointer to the array to grow - * @param nb_ptr pointer to the number of elements in the array - * @param elem element to add - * @return >=0 on success, negative otherwise. - * @see av_dynarray_add(), av_dynarray2_add() - */ -int av_dynarray_add_nofree(void *tab_ptr, int *nb_ptr, void *elem); - -/** - * Add an element of size elem_size to a dynamic array. - * - * The array is reallocated when its number of elements reaches powers of 2. - * Therefore, the amortized cost of adding an element is constant. - * - * In case of success, the pointer to the array is updated in order to - * point to the new grown array, and the number pointed to by nb_ptr - * is incremented. - * In case of failure, the array is freed, *tab_ptr is set to NULL and - * *nb_ptr is set to 0. - * - * @param tab_ptr pointer to the array to grow - * @param nb_ptr pointer to the number of elements in the array - * @param elem_size size in bytes of the elements in the array - * @param elem_data pointer to the data of the element to add. If NULL, the space of - * the new added element is not filled. - * @return pointer to the data of the element to copy in the new allocated space. - * If NULL, the new allocated space is left uninitialized." - * @see av_dynarray_add(), av_dynarray_add_nofree() - */ -void *av_dynarray2_add(void **tab_ptr, int *nb_ptr, size_t elem_size, - const uint8_t *elem_data); - -/** - * Multiply two size_t values checking for overflow. - * @return 0 if success, AVERROR(EINVAL) if overflow. - */ -static inline int av_size_mult(size_t a, size_t b, size_t *r) -{ - size_t t = a * b; - /* Hack inspired from glibc: only try the division if nelem and elsize - * are both greater than sqrt(SIZE_MAX). */ - if ((a | b) >= ((size_t)1 << (sizeof(size_t) * 4)) && a && t / a != b) - return AVERROR(EINVAL); - *r = t; - return 0; -} - -/** - * Set the maximum size that may me allocated in one block. - */ -void av_max_alloc(size_t max); - -/** - * deliberately overlapping memcpy implementation - * @param dst destination buffer - * @param back how many bytes back we start (the initial size of the overlapping window), must be > 0 - * @param cnt number of bytes to copy, must be >= 0 - * - * cnt > back is valid, this will copy the bytes we just copied, - * thus creating a repeating pattern with a period length of back. - */ -void av_memcpy_backptr(uint8_t *dst, int back, int cnt); - -/** - * Reallocate the given block if it is not large enough, otherwise do nothing. - * - * @see av_realloc - */ -void *av_fast_realloc(void *ptr, unsigned int *size, size_t min_size); - -/** - * Allocate a buffer, reusing the given one if large enough. - * - * Contrary to av_fast_realloc the current buffer contents might not be - * preserved and on error the old buffer is freed, thus no special - * handling to avoid memleaks is necessary. - * - * @param ptr pointer to pointer to already allocated buffer, overwritten with pointer to new buffer - * @param size size of the buffer *ptr points to - * @param min_size minimum size of *ptr buffer after returning, *ptr will be NULL and - * *size 0 if an error occurred. - */ -void av_fast_malloc(void *ptr, unsigned int *size, size_t min_size); - -/** - * @} - */ - -#endif /* AVUTIL_MEM_H */ diff --git a/dji_sdk_manifold_read_cam/include/libavutil/murmur3.h b/dji_sdk_manifold_read_cam/include/libavutil/murmur3.h deleted file mode 100644 index f29ed97..0000000 --- a/dji_sdk_manifold_read_cam/include/libavutil/murmur3.h +++ /dev/null @@ -1,32 +0,0 @@ -/* - * Copyright (C) 2013 Reimar Döffinger - * - * This file is part of FFmpeg. - * - * FFmpeg is free software; you can redistribute it and/or - * modify it under the terms of the GNU Lesser General Public - * License as published by the Free Software Foundation; either - * version 2.1 of the License, or (at your option) any later version. - * - * FFmpeg is distributed in the hope that it will be useful, - * but WITHOUT ANY WARRANTY; without even the implied warranty of - * MERCHANTABILITY or FITNESS FOR A PARTICULAR PURPOSE. See the GNU - * Lesser General Public License for more details. - * - * You should have received a copy of the GNU Lesser General Public - * License along with FFmpeg; if not, write to the Free Software - * Foundation, Inc., 51 Franklin Street, Fifth Floor, Boston, MA 02110-1301 USA - */ - -#ifndef AVUTIL_MURMUR3_H -#define AVUTIL_MURMUR3_H - -#include - -struct AVMurMur3 *av_murmur3_alloc(void); -void av_murmur3_init_seeded(struct AVMurMur3 *c, uint64_t seed); -void av_murmur3_init(struct AVMurMur3 *c); -void av_murmur3_update(struct AVMurMur3 *c, const uint8_t *src, int len); -void av_murmur3_final(struct AVMurMur3 *c, uint8_t dst[16]); - -#endif /* AVUTIL_MURMUR3_H */ diff --git a/dji_sdk_manifold_read_cam/include/libavutil/old_pix_fmts.h b/dji_sdk_manifold_read_cam/include/libavutil/old_pix_fmts.h deleted file mode 100644 index cd1ed7c..0000000 --- a/dji_sdk_manifold_read_cam/include/libavutil/old_pix_fmts.h +++ /dev/null @@ -1,177 +0,0 @@ -/* - * copyright (c) 2006-2012 Michael Niedermayer - * - * This file is part of FFmpeg. - * - * FFmpeg is free software; you can redistribute it and/or - * modify it under the terms of the GNU Lesser General Public - * License as published by the Free Software Foundation; either - * version 2.1 of the License, or (at your option) any later version. - * - * FFmpeg is distributed in the hope that it will be useful, - * but WITHOUT ANY WARRANTY; without even the implied warranty of - * MERCHANTABILITY or FITNESS FOR A PARTICULAR PURPOSE. See the GNU - * Lesser General Public License for more details. - * - * You should have received a copy of the GNU Lesser General Public - * License along with FFmpeg; if not, write to the Free Software - * Foundation, Inc., 51 Franklin Street, Fifth Floor, Boston, MA 02110-1301 USA - */ - -#ifndef AVUTIL_OLD_PIX_FMTS_H -#define AVUTIL_OLD_PIX_FMTS_H - -/* - * This header exists to prevent new pixel formats from being accidentally added - * to the deprecated list. - * Do not include it directly. It will be removed on next major bump - * - * Do not add new items to this list. Use the AVPixelFormat enum instead. - */ - PIX_FMT_NONE = AV_PIX_FMT_NONE, - PIX_FMT_YUV420P, ///< planar YUV 4:2:0, 12bpp, (1 Cr & Cb sample per 2x2 Y samples) - PIX_FMT_YUYV422, ///< packed YUV 4:2:2, 16bpp, Y0 Cb Y1 Cr - PIX_FMT_RGB24, ///< packed RGB 8:8:8, 24bpp, RGBRGB... - PIX_FMT_BGR24, ///< packed RGB 8:8:8, 24bpp, BGRBGR... - PIX_FMT_YUV422P, ///< planar YUV 4:2:2, 16bpp, (1 Cr & Cb sample per 2x1 Y samples) - PIX_FMT_YUV444P, ///< planar YUV 4:4:4, 24bpp, (1 Cr & Cb sample per 1x1 Y samples) - PIX_FMT_YUV410P, ///< planar YUV 4:1:0, 9bpp, (1 Cr & Cb sample per 4x4 Y samples) - PIX_FMT_YUV411P, ///< planar YUV 4:1:1, 12bpp, (1 Cr & Cb sample per 4x1 Y samples) - PIX_FMT_GRAY8, ///< Y , 8bpp - PIX_FMT_MONOWHITE, ///< Y , 1bpp, 0 is white, 1 is black, in each byte pixels are ordered from the msb to the lsb - PIX_FMT_MONOBLACK, ///< Y , 1bpp, 0 is black, 1 is white, in each byte pixels are ordered from the msb to the lsb - PIX_FMT_PAL8, ///< 8 bit with PIX_FMT_RGB32 palette - PIX_FMT_YUVJ420P, ///< planar YUV 4:2:0, 12bpp, full scale (JPEG), deprecated in favor of PIX_FMT_YUV420P and setting color_range - PIX_FMT_YUVJ422P, ///< planar YUV 4:2:2, 16bpp, full scale (JPEG), deprecated in favor of PIX_FMT_YUV422P and setting color_range - PIX_FMT_YUVJ444P, ///< planar YUV 4:4:4, 24bpp, full scale (JPEG), deprecated in favor of PIX_FMT_YUV444P and setting color_range -#if FF_API_XVMC - PIX_FMT_XVMC_MPEG2_MC,///< XVideo Motion Acceleration via common packet passing - PIX_FMT_XVMC_MPEG2_IDCT, -#endif /* FF_API_XVMC */ - PIX_FMT_UYVY422, ///< packed YUV 4:2:2, 16bpp, Cb Y0 Cr Y1 - PIX_FMT_UYYVYY411, ///< packed YUV 4:1:1, 12bpp, Cb Y0 Y1 Cr Y2 Y3 - PIX_FMT_BGR8, ///< packed RGB 3:3:2, 8bpp, (msb)2B 3G 3R(lsb) - PIX_FMT_BGR4, ///< packed RGB 1:2:1 bitstream, 4bpp, (msb)1B 2G 1R(lsb), a byte contains two pixels, the first pixel in the byte is the one composed by the 4 msb bits - PIX_FMT_BGR4_BYTE, ///< packed RGB 1:2:1, 8bpp, (msb)1B 2G 1R(lsb) - PIX_FMT_RGB8, ///< packed RGB 3:3:2, 8bpp, (msb)2R 3G 3B(lsb) - PIX_FMT_RGB4, ///< packed RGB 1:2:1 bitstream, 4bpp, (msb)1R 2G 1B(lsb), a byte contains two pixels, the first pixel in the byte is the one composed by the 4 msb bits - PIX_FMT_RGB4_BYTE, ///< packed RGB 1:2:1, 8bpp, (msb)1R 2G 1B(lsb) - PIX_FMT_NV12, ///< planar YUV 4:2:0, 12bpp, 1 plane for Y and 1 plane for the UV components, which are interleaved (first byte U and the following byte V) - PIX_FMT_NV21, ///< as above, but U and V bytes are swapped - - PIX_FMT_ARGB, ///< packed ARGB 8:8:8:8, 32bpp, ARGBARGB... - PIX_FMT_RGBA, ///< packed RGBA 8:8:8:8, 32bpp, RGBARGBA... - PIX_FMT_ABGR, ///< packed ABGR 8:8:8:8, 32bpp, ABGRABGR... - PIX_FMT_BGRA, ///< packed BGRA 8:8:8:8, 32bpp, BGRABGRA... - - PIX_FMT_GRAY16BE, ///< Y , 16bpp, big-endian - PIX_FMT_GRAY16LE, ///< Y , 16bpp, little-endian - PIX_FMT_YUV440P, ///< planar YUV 4:4:0 (1 Cr & Cb sample per 1x2 Y samples) - PIX_FMT_YUVJ440P, ///< planar YUV 4:4:0 full scale (JPEG), deprecated in favor of PIX_FMT_YUV440P and setting color_range - PIX_FMT_YUVA420P, ///< planar YUV 4:2:0, 20bpp, (1 Cr & Cb sample per 2x2 Y & A samples) -#if FF_API_VDPAU - PIX_FMT_VDPAU_H264,///< H.264 HW decoding with VDPAU, data[0] contains a vdpau_render_state struct which contains the bitstream of the slices as well as various fields extracted from headers - PIX_FMT_VDPAU_MPEG1,///< MPEG-1 HW decoding with VDPAU, data[0] contains a vdpau_render_state struct which contains the bitstream of the slices as well as various fields extracted from headers - PIX_FMT_VDPAU_MPEG2,///< MPEG-2 HW decoding with VDPAU, data[0] contains a vdpau_render_state struct which contains the bitstream of the slices as well as various fields extracted from headers - PIX_FMT_VDPAU_WMV3,///< WMV3 HW decoding with VDPAU, data[0] contains a vdpau_render_state struct which contains the bitstream of the slices as well as various fields extracted from headers - PIX_FMT_VDPAU_VC1, ///< VC-1 HW decoding with VDPAU, data[0] contains a vdpau_render_state struct which contains the bitstream of the slices as well as various fields extracted from headers -#endif - PIX_FMT_RGB48BE, ///< packed RGB 16:16:16, 48bpp, 16R, 16G, 16B, the 2-byte value for each R/G/B component is stored as big-endian - PIX_FMT_RGB48LE, ///< packed RGB 16:16:16, 48bpp, 16R, 16G, 16B, the 2-byte value for each R/G/B component is stored as little-endian - - PIX_FMT_RGB565BE, ///< packed RGB 5:6:5, 16bpp, (msb) 5R 6G 5B(lsb), big-endian - PIX_FMT_RGB565LE, ///< packed RGB 5:6:5, 16bpp, (msb) 5R 6G 5B(lsb), little-endian - PIX_FMT_RGB555BE, ///< packed RGB 5:5:5, 16bpp, (msb)1A 5R 5G 5B(lsb), big-endian, most significant bit to 0 - PIX_FMT_RGB555LE, ///< packed RGB 5:5:5, 16bpp, (msb)1A 5R 5G 5B(lsb), little-endian, most significant bit to 0 - - PIX_FMT_BGR565BE, ///< packed BGR 5:6:5, 16bpp, (msb) 5B 6G 5R(lsb), big-endian - PIX_FMT_BGR565LE, ///< packed BGR 5:6:5, 16bpp, (msb) 5B 6G 5R(lsb), little-endian - PIX_FMT_BGR555BE, ///< packed BGR 5:5:5, 16bpp, (msb)1A 5B 5G 5R(lsb), big-endian, most significant bit to 1 - PIX_FMT_BGR555LE, ///< packed BGR 5:5:5, 16bpp, (msb)1A 5B 5G 5R(lsb), little-endian, most significant bit to 1 - - PIX_FMT_VAAPI_MOCO, ///< HW acceleration through VA API at motion compensation entry-point, Picture.data[3] contains a vaapi_render_state struct which contains macroblocks as well as various fields extracted from headers - PIX_FMT_VAAPI_IDCT, ///< HW acceleration through VA API at IDCT entry-point, Picture.data[3] contains a vaapi_render_state struct which contains fields extracted from headers - PIX_FMT_VAAPI_VLD, ///< HW decoding through VA API, Picture.data[3] contains a vaapi_render_state struct which contains the bitstream of the slices as well as various fields extracted from headers - - PIX_FMT_YUV420P16LE, ///< planar YUV 4:2:0, 24bpp, (1 Cr & Cb sample per 2x2 Y samples), little-endian - PIX_FMT_YUV420P16BE, ///< planar YUV 4:2:0, 24bpp, (1 Cr & Cb sample per 2x2 Y samples), big-endian - PIX_FMT_YUV422P16LE, ///< planar YUV 4:2:2, 32bpp, (1 Cr & Cb sample per 2x1 Y samples), little-endian - PIX_FMT_YUV422P16BE, ///< planar YUV 4:2:2, 32bpp, (1 Cr & Cb sample per 2x1 Y samples), big-endian - PIX_FMT_YUV444P16LE, ///< planar YUV 4:4:4, 48bpp, (1 Cr & Cb sample per 1x1 Y samples), little-endian - PIX_FMT_YUV444P16BE, ///< planar YUV 4:4:4, 48bpp, (1 Cr & Cb sample per 1x1 Y samples), big-endian -#if FF_API_VDPAU - PIX_FMT_VDPAU_MPEG4, ///< MPEG4 HW decoding with VDPAU, data[0] contains a vdpau_render_state struct which contains the bitstream of the slices as well as various fields extracted from headers -#endif - PIX_FMT_DXVA2_VLD, ///< HW decoding through DXVA2, Picture.data[3] contains a LPDIRECT3DSURFACE9 pointer - - PIX_FMT_RGB444LE, ///< packed RGB 4:4:4, 16bpp, (msb)4A 4R 4G 4B(lsb), little-endian, most significant bits to 0 - PIX_FMT_RGB444BE, ///< packed RGB 4:4:4, 16bpp, (msb)4A 4R 4G 4B(lsb), big-endian, most significant bits to 0 - PIX_FMT_BGR444LE, ///< packed BGR 4:4:4, 16bpp, (msb)4A 4B 4G 4R(lsb), little-endian, most significant bits to 1 - PIX_FMT_BGR444BE, ///< packed BGR 4:4:4, 16bpp, (msb)4A 4B 4G 4R(lsb), big-endian, most significant bits to 1 - PIX_FMT_GRAY8A, ///< 8bit gray, 8bit alpha - PIX_FMT_BGR48BE, ///< packed RGB 16:16:16, 48bpp, 16B, 16G, 16R, the 2-byte value for each R/G/B component is stored as big-endian - PIX_FMT_BGR48LE, ///< packed RGB 16:16:16, 48bpp, 16B, 16G, 16R, the 2-byte value for each R/G/B component is stored as little-endian - - //the following 10 formats have the disadvantage of needing 1 format for each bit depth, thus - //If you want to support multiple bit depths, then using PIX_FMT_YUV420P16* with the bpp stored separately - //is better - PIX_FMT_YUV420P9BE, ///< planar YUV 4:2:0, 13.5bpp, (1 Cr & Cb sample per 2x2 Y samples), big-endian - PIX_FMT_YUV420P9LE, ///< planar YUV 4:2:0, 13.5bpp, (1 Cr & Cb sample per 2x2 Y samples), little-endian - PIX_FMT_YUV420P10BE,///< planar YUV 4:2:0, 15bpp, (1 Cr & Cb sample per 2x2 Y samples), big-endian - PIX_FMT_YUV420P10LE,///< planar YUV 4:2:0, 15bpp, (1 Cr & Cb sample per 2x2 Y samples), little-endian - PIX_FMT_YUV422P10BE,///< planar YUV 4:2:2, 20bpp, (1 Cr & Cb sample per 2x1 Y samples), big-endian - PIX_FMT_YUV422P10LE,///< planar YUV 4:2:2, 20bpp, (1 Cr & Cb sample per 2x1 Y samples), little-endian - PIX_FMT_YUV444P9BE, ///< planar YUV 4:4:4, 27bpp, (1 Cr & Cb sample per 1x1 Y samples), big-endian - PIX_FMT_YUV444P9LE, ///< planar YUV 4:4:4, 27bpp, (1 Cr & Cb sample per 1x1 Y samples), little-endian - PIX_FMT_YUV444P10BE,///< planar YUV 4:4:4, 30bpp, (1 Cr & Cb sample per 1x1 Y samples), big-endian - PIX_FMT_YUV444P10LE,///< planar YUV 4:4:4, 30bpp, (1 Cr & Cb sample per 1x1 Y samples), little-endian - PIX_FMT_YUV422P9BE, ///< planar YUV 4:2:2, 18bpp, (1 Cr & Cb sample per 2x1 Y samples), big-endian - PIX_FMT_YUV422P9LE, ///< planar YUV 4:2:2, 18bpp, (1 Cr & Cb sample per 2x1 Y samples), little-endian - PIX_FMT_VDA_VLD, ///< hardware decoding through VDA - -#ifdef AV_PIX_FMT_ABI_GIT_MASTER - PIX_FMT_RGBA64BE, ///< packed RGBA 16:16:16:16, 64bpp, 16R, 16G, 16B, 16A, the 2-byte value for each R/G/B/A component is stored as big-endian - PIX_FMT_RGBA64LE, ///< packed RGBA 16:16:16:16, 64bpp, 16R, 16G, 16B, 16A, the 2-byte value for each R/G/B/A component is stored as little-endian - PIX_FMT_BGRA64BE, ///< packed RGBA 16:16:16:16, 64bpp, 16B, 16G, 16R, 16A, the 2-byte value for each R/G/B/A component is stored as big-endian - PIX_FMT_BGRA64LE, ///< packed RGBA 16:16:16:16, 64bpp, 16B, 16G, 16R, 16A, the 2-byte value for each R/G/B/A component is stored as little-endian -#endif - PIX_FMT_GBRP, ///< planar GBR 4:4:4 24bpp - PIX_FMT_GBRP9BE, ///< planar GBR 4:4:4 27bpp, big endian - PIX_FMT_GBRP9LE, ///< planar GBR 4:4:4 27bpp, little endian - PIX_FMT_GBRP10BE, ///< planar GBR 4:4:4 30bpp, big endian - PIX_FMT_GBRP10LE, ///< planar GBR 4:4:4 30bpp, little endian - PIX_FMT_GBRP16BE, ///< planar GBR 4:4:4 48bpp, big endian - PIX_FMT_GBRP16LE, ///< planar GBR 4:4:4 48bpp, little endian - -#ifndef AV_PIX_FMT_ABI_GIT_MASTER - PIX_FMT_RGBA64BE=0x123, ///< packed RGBA 16:16:16:16, 64bpp, 16R, 16G, 16B, 16A, the 2-byte value for each R/G/B/A component is stored as big-endian - PIX_FMT_RGBA64LE, ///< packed RGBA 16:16:16:16, 64bpp, 16R, 16G, 16B, 16A, the 2-byte value for each R/G/B/A component is stored as little-endian - PIX_FMT_BGRA64BE, ///< packed RGBA 16:16:16:16, 64bpp, 16B, 16G, 16R, 16A, the 2-byte value for each R/G/B/A component is stored as big-endian - PIX_FMT_BGRA64LE, ///< packed RGBA 16:16:16:16, 64bpp, 16B, 16G, 16R, 16A, the 2-byte value for each R/G/B/A component is stored as little-endian -#endif - PIX_FMT_0RGB=0x123+4, ///< packed RGB 8:8:8, 32bpp, 0RGB0RGB... - PIX_FMT_RGB0, ///< packed RGB 8:8:8, 32bpp, RGB0RGB0... - PIX_FMT_0BGR, ///< packed BGR 8:8:8, 32bpp, 0BGR0BGR... - PIX_FMT_BGR0, ///< packed BGR 8:8:8, 32bpp, BGR0BGR0... - PIX_FMT_YUVA444P, ///< planar YUV 4:4:4 32bpp, (1 Cr & Cb sample per 1x1 Y & A samples) - PIX_FMT_YUVA422P, ///< planar YUV 4:2:2 24bpp, (1 Cr & Cb sample per 2x1 Y & A samples) - - PIX_FMT_YUV420P12BE, ///< planar YUV 4:2:0,18bpp, (1 Cr & Cb sample per 2x2 Y samples), big-endian - PIX_FMT_YUV420P12LE, ///< planar YUV 4:2:0,18bpp, (1 Cr & Cb sample per 2x2 Y samples), little-endian - PIX_FMT_YUV420P14BE, ///< planar YUV 4:2:0,21bpp, (1 Cr & Cb sample per 2x2 Y samples), big-endian - PIX_FMT_YUV420P14LE, ///< planar YUV 4:2:0,21bpp, (1 Cr & Cb sample per 2x2 Y samples), little-endian - PIX_FMT_YUV422P12BE, ///< planar YUV 4:2:2,24bpp, (1 Cr & Cb sample per 2x1 Y samples), big-endian - PIX_FMT_YUV422P12LE, ///< planar YUV 4:2:2,24bpp, (1 Cr & Cb sample per 2x1 Y samples), little-endian - PIX_FMT_YUV422P14BE, ///< planar YUV 4:2:2,28bpp, (1 Cr & Cb sample per 2x1 Y samples), big-endian - PIX_FMT_YUV422P14LE, ///< planar YUV 4:2:2,28bpp, (1 Cr & Cb sample per 2x1 Y samples), little-endian - PIX_FMT_YUV444P12BE, ///< planar YUV 4:4:4,36bpp, (1 Cr & Cb sample per 1x1 Y samples), big-endian - PIX_FMT_YUV444P12LE, ///< planar YUV 4:4:4,36bpp, (1 Cr & Cb sample per 1x1 Y samples), little-endian - PIX_FMT_YUV444P14BE, ///< planar YUV 4:4:4,42bpp, (1 Cr & Cb sample per 1x1 Y samples), big-endian - PIX_FMT_YUV444P14LE, ///< planar YUV 4:4:4,42bpp, (1 Cr & Cb sample per 1x1 Y samples), little-endian - PIX_FMT_GBRP12BE, ///< planar GBR 4:4:4 36bpp, big endian - PIX_FMT_GBRP12LE, ///< planar GBR 4:4:4 36bpp, little endian - PIX_FMT_GBRP14BE, ///< planar GBR 4:4:4 42bpp, big endian - PIX_FMT_GBRP14LE, ///< planar GBR 4:4:4 42bpp, little endian - - PIX_FMT_NB, ///< number of pixel formats, DO NOT USE THIS if you want to link with shared libav* because the number of formats might differ between versions -#endif /* AVUTIL_OLD_PIX_FMTS_H */ diff --git a/dji_sdk_manifold_read_cam/include/libavutil/opt.h b/dji_sdk_manifold_read_cam/include/libavutil/opt.h deleted file mode 100644 index 1e1dd69..0000000 --- a/dji_sdk_manifold_read_cam/include/libavutil/opt.h +++ /dev/null @@ -1,845 +0,0 @@ -/* - * AVOptions - * copyright (c) 2005 Michael Niedermayer - * - * This file is part of FFmpeg. - * - * FFmpeg is free software; you can redistribute it and/or - * modify it under the terms of the GNU Lesser General Public - * License as published by the Free Software Foundation; either - * version 2.1 of the License, or (at your option) any later version. - * - * FFmpeg is distributed in the hope that it will be useful, - * but WITHOUT ANY WARRANTY; without even the implied warranty of - * MERCHANTABILITY or FITNESS FOR A PARTICULAR PURPOSE. See the GNU - * Lesser General Public License for more details. - * - * You should have received a copy of the GNU Lesser General Public - * License along with FFmpeg; if not, write to the Free Software - * Foundation, Inc., 51 Franklin Street, Fifth Floor, Boston, MA 02110-1301 USA - */ - -#ifndef AVUTIL_OPT_H -#define AVUTIL_OPT_H - -/** - * @file - * AVOptions - */ - -#include "rational.h" -#include "avutil.h" -#include "dict.h" -#include "log.h" -#include "pixfmt.h" -#include "samplefmt.h" - -/** - * @defgroup avoptions AVOptions - * @ingroup lavu_data - * @{ - * AVOptions provide a generic system to declare options on arbitrary structs - * ("objects"). An option can have a help text, a type and a range of possible - * values. Options may then be enumerated, read and written to. - * - * @section avoptions_implement Implementing AVOptions - * This section describes how to add AVOptions capabilities to a struct. - * - * All AVOptions-related information is stored in an AVClass. Therefore - * the first member of the struct should be a pointer to an AVClass describing it. - * The option field of the AVClass must be set to a NULL-terminated static array - * of AVOptions. Each AVOption must have a non-empty name, a type, a default - * value and for number-type AVOptions also a range of allowed values. It must - * also declare an offset in bytes from the start of the struct, where the field - * associated with this AVOption is located. Other fields in the AVOption struct - * should also be set when applicable, but are not required. - * - * The following example illustrates an AVOptions-enabled struct: - * @code - * typedef struct test_struct { - * AVClass *class; - * int int_opt; - * char *str_opt; - * uint8_t *bin_opt; - * int bin_len; - * } test_struct; - * - * static const AVOption test_options[] = { - * { "test_int", "This is a test option of int type.", offsetof(test_struct, int_opt), - * AV_OPT_TYPE_INT, { .i64 = -1 }, INT_MIN, INT_MAX }, - * { "test_str", "This is a test option of string type.", offsetof(test_struct, str_opt), - * AV_OPT_TYPE_STRING }, - * { "test_bin", "This is a test option of binary type.", offsetof(test_struct, bin_opt), - * AV_OPT_TYPE_BINARY }, - * { NULL }, - * }; - * - * static const AVClass test_class = { - * .class_name = "test class", - * .item_name = av_default_item_name, - * .option = test_options, - * .version = LIBAVUTIL_VERSION_INT, - * }; - * @endcode - * - * Next, when allocating your struct, you must ensure that the AVClass pointer - * is set to the correct value. Then, av_opt_set_defaults() can be called to - * initialize defaults. After that the struct is ready to be used with the - * AVOptions API. - * - * When cleaning up, you may use the av_opt_free() function to automatically - * free all the allocated string and binary options. - * - * Continuing with the above example: - * - * @code - * test_struct *alloc_test_struct(void) - * { - * test_struct *ret = av_malloc(sizeof(*ret)); - * ret->class = &test_class; - * av_opt_set_defaults(ret); - * return ret; - * } - * void free_test_struct(test_struct **foo) - * { - * av_opt_free(*foo); - * av_freep(foo); - * } - * @endcode - * - * @subsection avoptions_implement_nesting Nesting - * It may happen that an AVOptions-enabled struct contains another - * AVOptions-enabled struct as a member (e.g. AVCodecContext in - * libavcodec exports generic options, while its priv_data field exports - * codec-specific options). In such a case, it is possible to set up the - * parent struct to export a child's options. To do that, simply - * implement AVClass.child_next() and AVClass.child_class_next() in the - * parent struct's AVClass. - * Assuming that the test_struct from above now also contains a - * child_struct field: - * - * @code - * typedef struct child_struct { - * AVClass *class; - * int flags_opt; - * } child_struct; - * static const AVOption child_opts[] = { - * { "test_flags", "This is a test option of flags type.", - * offsetof(child_struct, flags_opt), AV_OPT_TYPE_FLAGS, { .i64 = 0 }, INT_MIN, INT_MAX }, - * { NULL }, - * }; - * static const AVClass child_class = { - * .class_name = "child class", - * .item_name = av_default_item_name, - * .option = child_opts, - * .version = LIBAVUTIL_VERSION_INT, - * }; - * - * void *child_next(void *obj, void *prev) - * { - * test_struct *t = obj; - * if (!prev && t->child_struct) - * return t->child_struct; - * return NULL - * } - * const AVClass child_class_next(const AVClass *prev) - * { - * return prev ? NULL : &child_class; - * } - * @endcode - * Putting child_next() and child_class_next() as defined above into - * test_class will now make child_struct's options accessible through - * test_struct (again, proper setup as described above needs to be done on - * child_struct right after it is created). - * - * From the above example it might not be clear why both child_next() - * and child_class_next() are needed. The distinction is that child_next() - * iterates over actually existing objects, while child_class_next() - * iterates over all possible child classes. E.g. if an AVCodecContext - * was initialized to use a codec which has private options, then its - * child_next() will return AVCodecContext.priv_data and finish - * iterating. OTOH child_class_next() on AVCodecContext.av_class will - * iterate over all available codecs with private options. - * - * @subsection avoptions_implement_named_constants Named constants - * It is possible to create named constants for options. Simply set the unit - * field of the option the constants should apply to a string and - * create the constants themselves as options of type AV_OPT_TYPE_CONST - * with their unit field set to the same string. - * Their default_val field should contain the value of the named - * constant. - * For example, to add some named constants for the test_flags option - * above, put the following into the child_opts array: - * @code - * { "test_flags", "This is a test option of flags type.", - * offsetof(child_struct, flags_opt), AV_OPT_TYPE_FLAGS, { .i64 = 0 }, INT_MIN, INT_MAX, "test_unit" }, - * { "flag1", "This is a flag with value 16", 0, AV_OPT_TYPE_CONST, { .i64 = 16 }, 0, 0, "test_unit" }, - * @endcode - * - * @section avoptions_use Using AVOptions - * This section deals with accessing options in an AVOptions-enabled struct. - * Such structs in FFmpeg are e.g. AVCodecContext in libavcodec or - * AVFormatContext in libavformat. - * - * @subsection avoptions_use_examine Examining AVOptions - * The basic functions for examining options are av_opt_next(), which iterates - * over all options defined for one object, and av_opt_find(), which searches - * for an option with the given name. - * - * The situation is more complicated with nesting. An AVOptions-enabled struct - * may have AVOptions-enabled children. Passing the AV_OPT_SEARCH_CHILDREN flag - * to av_opt_find() will make the function search children recursively. - * - * For enumerating there are basically two cases. The first is when you want to - * get all options that may potentially exist on the struct and its children - * (e.g. when constructing documentation). In that case you should call - * av_opt_child_class_next() recursively on the parent struct's AVClass. The - * second case is when you have an already initialized struct with all its - * children and you want to get all options that can be actually written or read - * from it. In that case you should call av_opt_child_next() recursively (and - * av_opt_next() on each result). - * - * @subsection avoptions_use_get_set Reading and writing AVOptions - * When setting options, you often have a string read directly from the - * user. In such a case, simply passing it to av_opt_set() is enough. For - * non-string type options, av_opt_set() will parse the string according to the - * option type. - * - * Similarly av_opt_get() will read any option type and convert it to a string - * which will be returned. Do not forget that the string is allocated, so you - * have to free it with av_free(). - * - * In some cases it may be more convenient to put all options into an - * AVDictionary and call av_opt_set_dict() on it. A specific case of this - * are the format/codec open functions in lavf/lavc which take a dictionary - * filled with option as a parameter. This allows to set some options - * that cannot be set otherwise, since e.g. the input file format is not known - * before the file is actually opened. - */ - -enum AVOptionType{ - AV_OPT_TYPE_FLAGS, - AV_OPT_TYPE_INT, - AV_OPT_TYPE_INT64, - AV_OPT_TYPE_DOUBLE, - AV_OPT_TYPE_FLOAT, - AV_OPT_TYPE_STRING, - AV_OPT_TYPE_RATIONAL, - AV_OPT_TYPE_BINARY, ///< offset must point to a pointer immediately followed by an int for the length - AV_OPT_TYPE_CONST = 128, - AV_OPT_TYPE_IMAGE_SIZE = MKBETAG('S','I','Z','E'), ///< offset must point to two consecutive integers - AV_OPT_TYPE_PIXEL_FMT = MKBETAG('P','F','M','T'), - AV_OPT_TYPE_SAMPLE_FMT = MKBETAG('S','F','M','T'), - AV_OPT_TYPE_VIDEO_RATE = MKBETAG('V','R','A','T'), ///< offset must point to AVRational - AV_OPT_TYPE_DURATION = MKBETAG('D','U','R',' '), - AV_OPT_TYPE_COLOR = MKBETAG('C','O','L','R'), - AV_OPT_TYPE_CHANNEL_LAYOUT = MKBETAG('C','H','L','A'), -#if FF_API_OLD_AVOPTIONS - FF_OPT_TYPE_FLAGS = 0, - FF_OPT_TYPE_INT, - FF_OPT_TYPE_INT64, - FF_OPT_TYPE_DOUBLE, - FF_OPT_TYPE_FLOAT, - FF_OPT_TYPE_STRING, - FF_OPT_TYPE_RATIONAL, - FF_OPT_TYPE_BINARY, ///< offset must point to a pointer immediately followed by an int for the length - FF_OPT_TYPE_CONST=128, -#endif -}; - -/** - * AVOption - */ -typedef struct AVOption { - const char *name; - - /** - * short English help text - * @todo What about other languages? - */ - const char *help; - - /** - * The offset relative to the context structure where the option - * value is stored. It should be 0 for named constants. - */ - int offset; - enum AVOptionType type; - - /** - * the default value for scalar options - */ - union { - int64_t i64; - double dbl; - const char *str; - /* TODO those are unused now */ - AVRational q; - } default_val; - double min; ///< minimum valid value for the option - double max; ///< maximum valid value for the option - - int flags; -#define AV_OPT_FLAG_ENCODING_PARAM 1 ///< a generic parameter which can be set by the user for muxing or encoding -#define AV_OPT_FLAG_DECODING_PARAM 2 ///< a generic parameter which can be set by the user for demuxing or decoding -#if FF_API_OPT_TYPE_METADATA -#define AV_OPT_FLAG_METADATA 4 ///< some data extracted or inserted into the file like title, comment, ... -#endif -#define AV_OPT_FLAG_AUDIO_PARAM 8 -#define AV_OPT_FLAG_VIDEO_PARAM 16 -#define AV_OPT_FLAG_SUBTITLE_PARAM 32 -/** - * The option is inteded for exporting values to the caller. - */ -#define AV_OPT_FLAG_EXPORT 64 -/** - * The option may not be set through the AVOptions API, only read. - * This flag only makes sense when AV_OPT_FLAG_EXPORT is also set. - */ -#define AV_OPT_FLAG_READONLY 128 -#define AV_OPT_FLAG_FILTERING_PARAM (1<<16) ///< a generic parameter which can be set by the user for filtering -//FIXME think about enc-audio, ... style flags - - /** - * The logical unit to which the option belongs. Non-constant - * options and corresponding named constants share the same - * unit. May be NULL. - */ - const char *unit; -} AVOption; - -/** - * A single allowed range of values, or a single allowed value. - */ -typedef struct AVOptionRange { - const char *str; - /** - * Value range. - * For string ranges this represents the min/max length. - * For dimensions this represents the min/max pixel count or width/height in multi-component case. - */ - double value_min, value_max; - /** - * Value's component range. - * For string this represents the unicode range for chars, 0-127 limits to ASCII. - */ - double component_min, component_max; - /** - * Range flag. - * If set to 1 the struct encodes a range, if set to 0 a single value. - */ - int is_range; -} AVOptionRange; - -/** - * List of AVOptionRange structs. - */ -typedef struct AVOptionRanges { - /** - * Array of option ranges. - * - * Most of option types use just one component. - * Following describes multi-component option types: - * - * AV_OPT_TYPE_IMAGE_SIZE: - * component index 0: range of pixel count (width * height). - * component index 1: range of width. - * component index 2: range of height. - * - * @note To obtain multi-component version of this structure, user must - * provide AV_OPT_MULTI_COMPONENT_RANGE to av_opt_query_ranges or - * av_opt_query_ranges_default function. - * - * Multi-component range can be read as in following example: - * - * @code - * int range_index, component_index; - * AVOptionRanges *ranges; - * AVOptionRange *range[3]; //may require more than 3 in the future. - * av_opt_query_ranges(&ranges, obj, key, AV_OPT_MULTI_COMPONENT_RANGE); - * for (range_index = 0; range_index < ranges->nb_ranges; range_index++) { - * for (component_index = 0; component_index < ranges->nb_components; component_index++) - * range[component_index] = ranges->range[ranges->nb_ranges * component_index + range_index]; - * //do something with range here. - * } - * av_opt_freep_ranges(&ranges); - * @endcode - */ - AVOptionRange **range; - /** - * Number of ranges per component. - */ - int nb_ranges; - /** - * Number of componentes. - */ - int nb_components; -} AVOptionRanges; - - -#if FF_API_FIND_OPT -/** - * Look for an option in obj. Look only for the options which - * have the flags set as specified in mask and flags (that is, - * for which it is the case that (opt->flags & mask) == flags). - * - * @param[in] obj a pointer to a struct whose first element is a - * pointer to an AVClass - * @param[in] name the name of the option to look for - * @param[in] unit the unit of the option to look for, or any if NULL - * @return a pointer to the option found, or NULL if no option - * has been found - * - * @deprecated use av_opt_find. - */ -attribute_deprecated -const AVOption *av_find_opt(void *obj, const char *name, const char *unit, int mask, int flags); -#endif - -#if FF_API_OLD_AVOPTIONS -/** - * Set the field of obj with the given name to value. - * - * @param[in] obj A struct whose first element is a pointer to an - * AVClass. - * @param[in] name the name of the field to set - * @param[in] val The value to set. If the field is not of a string - * type, then the given string is parsed. - * SI postfixes and some named scalars are supported. - * If the field is of a numeric type, it has to be a numeric or named - * scalar. Behavior with more than one scalar and +- infix operators - * is undefined. - * If the field is of a flags type, it has to be a sequence of numeric - * scalars or named flags separated by '+' or '-'. Prefixing a flag - * with '+' causes it to be set without affecting the other flags; - * similarly, '-' unsets a flag. - * @param[out] o_out if non-NULL put here a pointer to the AVOption - * found - * @param alloc this parameter is currently ignored - * @return 0 if the value has been set, or an AVERROR code in case of - * error: - * AVERROR_OPTION_NOT_FOUND if no matching option exists - * AVERROR(ERANGE) if the value is out of range - * AVERROR(EINVAL) if the value is not valid - * @deprecated use av_opt_set() - */ -attribute_deprecated -int av_set_string3(void *obj, const char *name, const char *val, int alloc, const AVOption **o_out); - -attribute_deprecated const AVOption *av_set_double(void *obj, const char *name, double n); -attribute_deprecated const AVOption *av_set_q(void *obj, const char *name, AVRational n); -attribute_deprecated const AVOption *av_set_int(void *obj, const char *name, int64_t n); - -double av_get_double(void *obj, const char *name, const AVOption **o_out); -AVRational av_get_q(void *obj, const char *name, const AVOption **o_out); -int64_t av_get_int(void *obj, const char *name, const AVOption **o_out); -attribute_deprecated const char *av_get_string(void *obj, const char *name, const AVOption **o_out, char *buf, int buf_len); -attribute_deprecated const AVOption *av_next_option(void *obj, const AVOption *last); -#endif - -/** - * Show the obj options. - * - * @param req_flags requested flags for the options to show. Show only the - * options for which it is opt->flags & req_flags. - * @param rej_flags rejected flags for the options to show. Show only the - * options for which it is !(opt->flags & req_flags). - * @param av_log_obj log context to use for showing the options - */ -int av_opt_show2(void *obj, void *av_log_obj, int req_flags, int rej_flags); - -/** - * Set the values of all AVOption fields to their default values. - * - * @param s an AVOption-enabled struct (its first member must be a pointer to AVClass) - */ -void av_opt_set_defaults(void *s); - -#if FF_API_OLD_AVOPTIONS -attribute_deprecated -void av_opt_set_defaults2(void *s, int mask, int flags); -#endif - -/** - * Parse the key/value pairs list in opts. For each key/value pair - * found, stores the value in the field in ctx that is named like the - * key. ctx must be an AVClass context, storing is done using - * AVOptions. - * - * @param opts options string to parse, may be NULL - * @param key_val_sep a 0-terminated list of characters used to - * separate key from value - * @param pairs_sep a 0-terminated list of characters used to separate - * two pairs from each other - * @return the number of successfully set key/value pairs, or a negative - * value corresponding to an AVERROR code in case of error: - * AVERROR(EINVAL) if opts cannot be parsed, - * the error code issued by av_set_string3() if a key/value pair - * cannot be set - */ -int av_set_options_string(void *ctx, const char *opts, - const char *key_val_sep, const char *pairs_sep); - -/** - * Parse the key-value pairs list in opts. For each key=value pair found, - * set the value of the corresponding option in ctx. - * - * @param ctx the AVClass object to set options on - * @param opts the options string, key-value pairs separated by a - * delimiter - * @param shorthand a NULL-terminated array of options names for shorthand - * notation: if the first field in opts has no key part, - * the key is taken from the first element of shorthand; - * then again for the second, etc., until either opts is - * finished, shorthand is finished or a named option is - * found; after that, all options must be named - * @param key_val_sep a 0-terminated list of characters used to separate - * key from value, for example '=' - * @param pairs_sep a 0-terminated list of characters used to separate - * two pairs from each other, for example ':' or ',' - * @return the number of successfully set key=value pairs, or a negative - * value corresponding to an AVERROR code in case of error: - * AVERROR(EINVAL) if opts cannot be parsed, - * the error code issued by av_set_string3() if a key/value pair - * cannot be set - * - * Options names must use only the following characters: a-z A-Z 0-9 - . / _ - * Separators must use characters distinct from option names and from each - * other. - */ -int av_opt_set_from_string(void *ctx, const char *opts, - const char *const *shorthand, - const char *key_val_sep, const char *pairs_sep); -/** - * Free all string and binary options in obj. - */ -void av_opt_free(void *obj); - -/** - * Check whether a particular flag is set in a flags field. - * - * @param field_name the name of the flag field option - * @param flag_name the name of the flag to check - * @return non-zero if the flag is set, zero if the flag isn't set, - * isn't of the right type, or the flags field doesn't exist. - */ -int av_opt_flag_is_set(void *obj, const char *field_name, const char *flag_name); - -/** - * Set all the options from a given dictionary on an object. - * - * @param obj a struct whose first element is a pointer to AVClass - * @param options options to process. This dictionary will be freed and replaced - * by a new one containing all options not found in obj. - * Of course this new dictionary needs to be freed by caller - * with av_dict_free(). - * - * @return 0 on success, a negative AVERROR if some option was found in obj, - * but could not be set. - * - * @see av_dict_copy() - */ -int av_opt_set_dict(void *obj, struct AVDictionary **options); - - -/** - * Set all the options from a given dictionary on an object. - * - * @param obj a struct whose first element is a pointer to AVClass - * @param options options to process. This dictionary will be freed and replaced - * by a new one containing all options not found in obj. - * Of course this new dictionary needs to be freed by caller - * with av_dict_free(). - * @param search_flags A combination of AV_OPT_SEARCH_*. - * - * @return 0 on success, a negative AVERROR if some option was found in obj, - * but could not be set. - * - * @see av_dict_copy() - */ -int av_opt_set_dict2(void *obj, struct AVDictionary **options, int search_flags); - -/** - * Extract a key-value pair from the beginning of a string. - * - * @param ropts pointer to the options string, will be updated to - * point to the rest of the string (one of the pairs_sep - * or the final NUL) - * @param key_val_sep a 0-terminated list of characters used to separate - * key from value, for example '=' - * @param pairs_sep a 0-terminated list of characters used to separate - * two pairs from each other, for example ':' or ',' - * @param flags flags; see the AV_OPT_FLAG_* values below - * @param rkey parsed key; must be freed using av_free() - * @param rval parsed value; must be freed using av_free() - * - * @return >=0 for success, or a negative value corresponding to an - * AVERROR code in case of error; in particular: - * AVERROR(EINVAL) if no key is present - * - */ -int av_opt_get_key_value(const char **ropts, - const char *key_val_sep, const char *pairs_sep, - unsigned flags, - char **rkey, char **rval); - -enum { - - /** - * Accept to parse a value without a key; the key will then be returned - * as NULL. - */ - AV_OPT_FLAG_IMPLICIT_KEY = 1, -}; - -/** - * @defgroup opt_eval_funcs Evaluating option strings - * @{ - * This group of functions can be used to evaluate option strings - * and get numbers out of them. They do the same thing as av_opt_set(), - * except the result is written into the caller-supplied pointer. - * - * @param obj a struct whose first element is a pointer to AVClass. - * @param o an option for which the string is to be evaluated. - * @param val string to be evaluated. - * @param *_out value of the string will be written here. - * - * @return 0 on success, a negative number on failure. - */ -int av_opt_eval_flags (void *obj, const AVOption *o, const char *val, int *flags_out); -int av_opt_eval_int (void *obj, const AVOption *o, const char *val, int *int_out); -int av_opt_eval_int64 (void *obj, const AVOption *o, const char *val, int64_t *int64_out); -int av_opt_eval_float (void *obj, const AVOption *o, const char *val, float *float_out); -int av_opt_eval_double(void *obj, const AVOption *o, const char *val, double *double_out); -int av_opt_eval_q (void *obj, const AVOption *o, const char *val, AVRational *q_out); -/** - * @} - */ - -#define AV_OPT_SEARCH_CHILDREN 0x0001 /**< Search in possible children of the - given object first. */ -/** - * The obj passed to av_opt_find() is fake -- only a double pointer to AVClass - * instead of a required pointer to a struct containing AVClass. This is - * useful for searching for options without needing to allocate the corresponding - * object. - */ -#define AV_OPT_SEARCH_FAKE_OBJ 0x0002 - -/** - * Allows av_opt_query_ranges and av_opt_query_ranges_default to return more than - * one component for certain option types. - * @see AVOptionRanges for details. - */ -#define AV_OPT_MULTI_COMPONENT_RANGE 0x1000 - -/** - * Look for an option in an object. Consider only options which - * have all the specified flags set. - * - * @param[in] obj A pointer to a struct whose first element is a - * pointer to an AVClass. - * Alternatively a double pointer to an AVClass, if - * AV_OPT_SEARCH_FAKE_OBJ search flag is set. - * @param[in] name The name of the option to look for. - * @param[in] unit When searching for named constants, name of the unit - * it belongs to. - * @param opt_flags Find only options with all the specified flags set (AV_OPT_FLAG). - * @param search_flags A combination of AV_OPT_SEARCH_*. - * - * @return A pointer to the option found, or NULL if no option - * was found. - * - * @note Options found with AV_OPT_SEARCH_CHILDREN flag may not be settable - * directly with av_set_string3(). Use special calls which take an options - * AVDictionary (e.g. avformat_open_input()) to set options found with this - * flag. - */ -const AVOption *av_opt_find(void *obj, const char *name, const char *unit, - int opt_flags, int search_flags); - -/** - * Look for an option in an object. Consider only options which - * have all the specified flags set. - * - * @param[in] obj A pointer to a struct whose first element is a - * pointer to an AVClass. - * Alternatively a double pointer to an AVClass, if - * AV_OPT_SEARCH_FAKE_OBJ search flag is set. - * @param[in] name The name of the option to look for. - * @param[in] unit When searching for named constants, name of the unit - * it belongs to. - * @param opt_flags Find only options with all the specified flags set (AV_OPT_FLAG). - * @param search_flags A combination of AV_OPT_SEARCH_*. - * @param[out] target_obj if non-NULL, an object to which the option belongs will be - * written here. It may be different from obj if AV_OPT_SEARCH_CHILDREN is present - * in search_flags. This parameter is ignored if search_flags contain - * AV_OPT_SEARCH_FAKE_OBJ. - * - * @return A pointer to the option found, or NULL if no option - * was found. - */ -const AVOption *av_opt_find2(void *obj, const char *name, const char *unit, - int opt_flags, int search_flags, void **target_obj); - -/** - * Iterate over all AVOptions belonging to obj. - * - * @param obj an AVOptions-enabled struct or a double pointer to an - * AVClass describing it. - * @param prev result of the previous call to av_opt_next() on this object - * or NULL - * @return next AVOption or NULL - */ -const AVOption *av_opt_next(void *obj, const AVOption *prev); - -/** - * Iterate over AVOptions-enabled children of obj. - * - * @param prev result of a previous call to this function or NULL - * @return next AVOptions-enabled child or NULL - */ -void *av_opt_child_next(void *obj, void *prev); - -/** - * Iterate over potential AVOptions-enabled children of parent. - * - * @param prev result of a previous call to this function or NULL - * @return AVClass corresponding to next potential child or NULL - */ -const AVClass *av_opt_child_class_next(const AVClass *parent, const AVClass *prev); - -/** - * @defgroup opt_set_funcs Option setting functions - * @{ - * Those functions set the field of obj with the given name to value. - * - * @param[in] obj A struct whose first element is a pointer to an AVClass. - * @param[in] name the name of the field to set - * @param[in] val The value to set. In case of av_opt_set() if the field is not - * of a string type, then the given string is parsed. - * SI postfixes and some named scalars are supported. - * If the field is of a numeric type, it has to be a numeric or named - * scalar. Behavior with more than one scalar and +- infix operators - * is undefined. - * If the field is of a flags type, it has to be a sequence of numeric - * scalars or named flags separated by '+' or '-'. Prefixing a flag - * with '+' causes it to be set without affecting the other flags; - * similarly, '-' unsets a flag. - * @param search_flags flags passed to av_opt_find2. I.e. if AV_OPT_SEARCH_CHILDREN - * is passed here, then the option may be set on a child of obj. - * - * @return 0 if the value has been set, or an AVERROR code in case of - * error: - * AVERROR_OPTION_NOT_FOUND if no matching option exists - * AVERROR(ERANGE) if the value is out of range - * AVERROR(EINVAL) if the value is not valid - */ -int av_opt_set (void *obj, const char *name, const char *val, int search_flags); -int av_opt_set_int (void *obj, const char *name, int64_t val, int search_flags); -int av_opt_set_double(void *obj, const char *name, double val, int search_flags); -int av_opt_set_q (void *obj, const char *name, AVRational val, int search_flags); -int av_opt_set_bin (void *obj, const char *name, const uint8_t *val, int size, int search_flags); -int av_opt_set_image_size(void *obj, const char *name, int w, int h, int search_flags); -int av_opt_set_pixel_fmt (void *obj, const char *name, enum AVPixelFormat fmt, int search_flags); -int av_opt_set_sample_fmt(void *obj, const char *name, enum AVSampleFormat fmt, int search_flags); -int av_opt_set_video_rate(void *obj, const char *name, AVRational val, int search_flags); -int av_opt_set_channel_layout(void *obj, const char *name, int64_t ch_layout, int search_flags); - -/** - * Set a binary option to an integer list. - * - * @param obj AVClass object to set options on - * @param name name of the binary option - * @param val pointer to an integer list (must have the correct type with - * regard to the contents of the list) - * @param term list terminator (usually 0 or -1) - * @param flags search flags - */ -#define av_opt_set_int_list(obj, name, val, term, flags) \ - (av_int_list_length(val, term) > INT_MAX / sizeof(*(val)) ? \ - AVERROR(EINVAL) : \ - av_opt_set_bin(obj, name, (const uint8_t *)(val), \ - av_int_list_length(val, term) * sizeof(*(val)), flags)) -/** - * @} - */ - -/** - * @defgroup opt_get_funcs Option getting functions - * @{ - * Those functions get a value of the option with the given name from an object. - * - * @param[in] obj a struct whose first element is a pointer to an AVClass. - * @param[in] name name of the option to get. - * @param[in] search_flags flags passed to av_opt_find2. I.e. if AV_OPT_SEARCH_CHILDREN - * is passed here, then the option may be found in a child of obj. - * @param[out] out_val value of the option will be written here - * @return >=0 on success, a negative error code otherwise - */ -/** - * @note the returned string will be av_malloc()ed and must be av_free()ed by the caller - */ -int av_opt_get (void *obj, const char *name, int search_flags, uint8_t **out_val); -int av_opt_get_int (void *obj, const char *name, int search_flags, int64_t *out_val); -int av_opt_get_double(void *obj, const char *name, int search_flags, double *out_val); -int av_opt_get_q (void *obj, const char *name, int search_flags, AVRational *out_val); -int av_opt_get_image_size(void *obj, const char *name, int search_flags, int *w_out, int *h_out); -int av_opt_get_pixel_fmt (void *obj, const char *name, int search_flags, enum AVPixelFormat *out_fmt); -int av_opt_get_sample_fmt(void *obj, const char *name, int search_flags, enum AVSampleFormat *out_fmt); -int av_opt_get_video_rate(void *obj, const char *name, int search_flags, AVRational *out_val); -int av_opt_get_channel_layout(void *obj, const char *name, int search_flags, int64_t *ch_layout); -/** - * @} - */ -/** - * Gets a pointer to the requested field in a struct. - * This function allows accessing a struct even when its fields are moved or - * renamed since the application making the access has been compiled, - * - * @returns a pointer to the field, it can be cast to the correct type and read - * or written to. - */ -void *av_opt_ptr(const AVClass *avclass, void *obj, const char *name); - -/** - * Free an AVOptionRanges struct and set it to NULL. - */ -void av_opt_freep_ranges(AVOptionRanges **ranges); - -/** - * Get a list of allowed ranges for the given option. - * - * The returned list may depend on other fields in obj like for example profile. - * - * @param flags is a bitmask of flags, undefined flags should not be set and should be ignored - * AV_OPT_SEARCH_FAKE_OBJ indicates that the obj is a double pointer to a AVClass instead of a full instance - * AV_OPT_MULTI_COMPONENT_RANGE indicates that function may return more than one component, @see AVOptionRanges - * - * The result must be freed with av_opt_freep_ranges. - * - * @return number of compontents returned on success, a negative errro code otherwise - */ -int av_opt_query_ranges(AVOptionRanges **, void *obj, const char *key, int flags); - -/** - * Get a default list of allowed ranges for the given option. - * - * This list is constructed without using the AVClass.query_ranges() callback - * and can be used as fallback from within the callback. - * - * @param flags is a bitmask of flags, undefined flags should not be set and should be ignored - * AV_OPT_SEARCH_FAKE_OBJ indicates that the obj is a double pointer to a AVClass instead of a full instance - * AV_OPT_MULTI_COMPONENT_RANGE indicates that function may return more than one component, @see AVOptionRanges - * - * The result must be freed with av_opt_free_ranges. - * - * @return number of compontents returned on success, a negative errro code otherwise - */ -int av_opt_query_ranges_default(AVOptionRanges **, void *obj, const char *key, int flags); - -/** - * @} - */ - -#endif /* AVUTIL_OPT_H */ diff --git a/dji_sdk_manifold_read_cam/include/libavutil/parseutils.h b/dji_sdk_manifold_read_cam/include/libavutil/parseutils.h deleted file mode 100644 index c80f0de..0000000 --- a/dji_sdk_manifold_read_cam/include/libavutil/parseutils.h +++ /dev/null @@ -1,187 +0,0 @@ -/* - * This file is part of FFmpeg. - * - * FFmpeg is free software; you can redistribute it and/or - * modify it under the terms of the GNU Lesser General Public - * License as published by the Free Software Foundation; either - * version 2.1 of the License, or (at your option) any later version. - * - * FFmpeg is distributed in the hope that it will be useful, - * but WITHOUT ANY WARRANTY; without even the implied warranty of - * MERCHANTABILITY or FITNESS FOR A PARTICULAR PURPOSE. See the GNU - * Lesser General Public License for more details. - * - * You should have received a copy of the GNU Lesser General Public - * License along with FFmpeg; if not, write to the Free Software - * Foundation, Inc., 51 Franklin Street, Fifth Floor, Boston, MA 02110-1301 USA - */ - -#ifndef AVUTIL_PARSEUTILS_H -#define AVUTIL_PARSEUTILS_H - -#include - -#include "rational.h" - -/** - * @file - * misc parsing utilities - */ - -/** - * Parse str and store the parsed ratio in q. - * - * Note that a ratio with infinite (1/0) or negative value is - * considered valid, so you should check on the returned value if you - * want to exclude those values. - * - * The undefined value can be expressed using the "0:0" string. - * - * @param[in,out] q pointer to the AVRational which will contain the ratio - * @param[in] str the string to parse: it has to be a string in the format - * num:den, a float number or an expression - * @param[in] max the maximum allowed numerator and denominator - * @param[in] log_offset log level offset which is applied to the log - * level of log_ctx - * @param[in] log_ctx parent logging context - * @return >= 0 on success, a negative error code otherwise - */ -int av_parse_ratio(AVRational *q, const char *str, int max, - int log_offset, void *log_ctx); - -#define av_parse_ratio_quiet(rate, str, max) \ - av_parse_ratio(rate, str, max, AV_LOG_MAX_OFFSET, NULL) - -/** - * Parse str and put in width_ptr and height_ptr the detected values. - * - * @param[in,out] width_ptr pointer to the variable which will contain the detected - * width value - * @param[in,out] height_ptr pointer to the variable which will contain the detected - * height value - * @param[in] str the string to parse: it has to be a string in the format - * width x height or a valid video size abbreviation. - * @return >= 0 on success, a negative error code otherwise - */ -int av_parse_video_size(int *width_ptr, int *height_ptr, const char *str); - -/** - * Parse str and store the detected values in *rate. - * - * @param[in,out] rate pointer to the AVRational which will contain the detected - * frame rate - * @param[in] str the string to parse: it has to be a string in the format - * rate_num / rate_den, a float number or a valid video rate abbreviation - * @return >= 0 on success, a negative error code otherwise - */ -int av_parse_video_rate(AVRational *rate, const char *str); - -/** - * Put the RGBA values that correspond to color_string in rgba_color. - * - * @param color_string a string specifying a color. It can be the name of - * a color (case insensitive match) or a [0x|#]RRGGBB[AA] sequence, - * possibly followed by "@" and a string representing the alpha - * component. - * The alpha component may be a string composed by "0x" followed by an - * hexadecimal number or a decimal number between 0.0 and 1.0, which - * represents the opacity value (0x00/0.0 means completely transparent, - * 0xff/1.0 completely opaque). - * If the alpha component is not specified then 0xff is assumed. - * The string "random" will result in a random color. - * @param slen length of the initial part of color_string containing the - * color. It can be set to -1 if color_string is a null terminated string - * containing nothing else than the color. - * @return >= 0 in case of success, a negative value in case of - * failure (for example if color_string cannot be parsed). - */ -int av_parse_color(uint8_t *rgba_color, const char *color_string, int slen, - void *log_ctx); - -/** - * Get the name of a color from the internal table of hard-coded named - * colors. - * - * This function is meant to enumerate the color names recognized by - * av_parse_color(). - * - * @param color_idx index of the requested color, starting from 0 - * @param rgbp if not NULL, will point to a 3-elements array with the color value in RGB - * @return the color name string or NULL if color_idx is not in the array - */ -const char *av_get_known_color_name(int color_idx, const uint8_t **rgb); - -/** - * Parse timestr and return in *time a corresponding number of - * microseconds. - * - * @param timeval puts here the number of microseconds corresponding - * to the string in timestr. If the string represents a duration, it - * is the number of microseconds contained in the time interval. If - * the string is a date, is the number of microseconds since 1st of - * January, 1970 up to the time of the parsed date. If timestr cannot - * be successfully parsed, set *time to INT64_MIN. - - * @param timestr a string representing a date or a duration. - * - If a date the syntax is: - * @code - * [{YYYY-MM-DD|YYYYMMDD}[T|t| ]]{{HH:MM:SS[.m...]]]}|{HHMMSS[.m...]]]}}[Z] - * now - * @endcode - * If the value is "now" it takes the current time. - * Time is local time unless Z is appended, in which case it is - * interpreted as UTC. - * If the year-month-day part is not specified it takes the current - * year-month-day. - * - If a duration the syntax is: - * @code - * [-][HH:]MM:SS[.m...] - * [-]S+[.m...] - * @endcode - * @param duration flag which tells how to interpret timestr, if not - * zero timestr is interpreted as a duration, otherwise as a date - * @return >= 0 in case of success, a negative value corresponding to an - * AVERROR code otherwise - */ -int av_parse_time(int64_t *timeval, const char *timestr, int duration); - -/** - * Parse the input string p according to the format string fmt and - * store its results in the structure dt. - * This implementation supports only a subset of the formats supported - * by the standard strptime(). - * - * In particular it actually supports the parameters: - * - %H: the hour as a decimal number, using a 24-hour clock, in the - * range '00' through '23' - * - %J: hours as a decimal number, in the range '0' through INT_MAX - * - %M: the minute as a decimal number, using a 24-hour clock, in the - * range '00' through '59' - * - %S: the second as a decimal number, using a 24-hour clock, in the - * range '00' through '59' - * - %Y: the year as a decimal number, using the Gregorian calendar - * - %m: the month as a decimal number, in the range '1' through '12' - * - %d: the day of the month as a decimal number, in the range '1' - * through '31' - * - %%: a literal '%' - * - * @return a pointer to the first character not processed in this - * function call, or NULL in case the function fails to match all of - * the fmt string and therefore an error occurred - */ -char *av_small_strptime(const char *p, const char *fmt, struct tm *dt); - -/** - * Attempt to find a specific tag in a URL. - * - * syntax: '?tag1=val1&tag2=val2...'. Little URL decoding is done. - * Return 1 if found. - */ -int av_find_info_tag(char *arg, int arg_size, const char *tag1, const char *info); - -/** - * Convert the decomposed UTC time in tm to a time_t value. - */ -time_t av_timegm(struct tm *tm); - -#endif /* AVUTIL_PARSEUTILS_H */ diff --git a/dji_sdk_manifold_read_cam/include/libavutil/pixdesc.h b/dji_sdk_manifold_read_cam/include/libavutil/pixdesc.h deleted file mode 100644 index 1d2ead6..0000000 --- a/dji_sdk_manifold_read_cam/include/libavutil/pixdesc.h +++ /dev/null @@ -1,339 +0,0 @@ -/* - * pixel format descriptor - * Copyright (c) 2009 Michael Niedermayer - * - * This file is part of FFmpeg. - * - * FFmpeg is free software; you can redistribute it and/or - * modify it under the terms of the GNU Lesser General Public - * License as published by the Free Software Foundation; either - * version 2.1 of the License, or (at your option) any later version. - * - * FFmpeg is distributed in the hope that it will be useful, - * but WITHOUT ANY WARRANTY; without even the implied warranty of - * MERCHANTABILITY or FITNESS FOR A PARTICULAR PURPOSE. See the GNU - * Lesser General Public License for more details. - * - * You should have received a copy of the GNU Lesser General Public - * License along with FFmpeg; if not, write to the Free Software - * Foundation, Inc., 51 Franklin Street, Fifth Floor, Boston, MA 02110-1301 USA - */ - -#ifndef AVUTIL_PIXDESC_H -#define AVUTIL_PIXDESC_H - -#include - -#include "attributes.h" -#include "pixfmt.h" - -typedef struct AVComponentDescriptor{ - uint16_t plane :2; ///< which of the 4 planes contains the component - - /** - * Number of elements between 2 horizontally consecutive pixels minus 1. - * Elements are bits for bitstream formats, bytes otherwise. - */ - uint16_t step_minus1 :3; - - /** - * Number of elements before the component of the first pixel plus 1. - * Elements are bits for bitstream formats, bytes otherwise. - */ - uint16_t offset_plus1 :3; - uint16_t shift :3; ///< number of least significant bits that must be shifted away to get the value - uint16_t depth_minus1 :4; ///< number of bits in the component minus 1 -}AVComponentDescriptor; - -/** - * Descriptor that unambiguously describes how the bits of a pixel are - * stored in the up to 4 data planes of an image. It also stores the - * subsampling factors and number of components. - * - * @note This is separate of the colorspace (RGB, YCbCr, YPbPr, JPEG-style YUV - * and all the YUV variants) AVPixFmtDescriptor just stores how values - * are stored not what these values represent. - */ -typedef struct AVPixFmtDescriptor{ - const char *name; - uint8_t nb_components; ///< The number of components each pixel has, (1-4) - - /** - * Amount to shift the luma width right to find the chroma width. - * For YV12 this is 1 for example. - * chroma_width = -((-luma_width) >> log2_chroma_w) - * The note above is needed to ensure rounding up. - * This value only refers to the chroma components. - */ - uint8_t log2_chroma_w; ///< chroma_width = -((-luma_width )>>log2_chroma_w) - - /** - * Amount to shift the luma height right to find the chroma height. - * For YV12 this is 1 for example. - * chroma_height= -((-luma_height) >> log2_chroma_h) - * The note above is needed to ensure rounding up. - * This value only refers to the chroma components. - */ - uint8_t log2_chroma_h; - uint8_t flags; - - /** - * Parameters that describe how pixels are packed. - * If the format has 2 or 4 components, then alpha is last. - * If the format has 1 or 2 components, then luma is 0. - * If the format has 3 or 4 components, - * if the RGB flag is set then 0 is red, 1 is green and 2 is blue; - * otherwise 0 is luma, 1 is chroma-U and 2 is chroma-V. - */ - AVComponentDescriptor comp[4]; -}AVPixFmtDescriptor; - -/** - * Pixel format is big-endian. - */ -#define AV_PIX_FMT_FLAG_BE (1 << 0) -/** - * Pixel format has a palette in data[1], values are indexes in this palette. - */ -#define AV_PIX_FMT_FLAG_PAL (1 << 1) -/** - * All values of a component are bit-wise packed end to end. - */ -#define AV_PIX_FMT_FLAG_BITSTREAM (1 << 2) -/** - * Pixel format is an HW accelerated format. - */ -#define AV_PIX_FMT_FLAG_HWACCEL (1 << 3) -/** - * At least one pixel component is not in the first data plane. - */ -#define AV_PIX_FMT_FLAG_PLANAR (1 << 4) -/** - * The pixel format contains RGB-like data (as opposed to YUV/grayscale). - */ -#define AV_PIX_FMT_FLAG_RGB (1 << 5) -/** - * The pixel format is "pseudo-paletted". This means that FFmpeg treats it as - * paletted internally, but the palette is generated by the decoder and is not - * stored in the file. - */ -#define AV_PIX_FMT_FLAG_PSEUDOPAL (1 << 6) -/** - * The pixel format has an alpha channel. - */ -#define AV_PIX_FMT_FLAG_ALPHA (1 << 7) - -#if FF_API_PIX_FMT -/** - * @deprecated use the AV_PIX_FMT_FLAG_* flags - */ -#define PIX_FMT_BE AV_PIX_FMT_FLAG_BE -#define PIX_FMT_PAL AV_PIX_FMT_FLAG_PAL -#define PIX_FMT_BITSTREAM AV_PIX_FMT_FLAG_BITSTREAM -#define PIX_FMT_HWACCEL AV_PIX_FMT_FLAG_HWACCEL -#define PIX_FMT_PLANAR AV_PIX_FMT_FLAG_PLANAR -#define PIX_FMT_RGB AV_PIX_FMT_FLAG_RGB -#define PIX_FMT_PSEUDOPAL AV_PIX_FMT_FLAG_PSEUDOPAL -#define PIX_FMT_ALPHA AV_PIX_FMT_FLAG_ALPHA -#endif - -#if FF_API_PIX_FMT_DESC -/** - * The array of all the pixel format descriptors. - */ -extern attribute_deprecated const AVPixFmtDescriptor av_pix_fmt_descriptors[]; -#endif - -/** - * Read a line from an image, and write the values of the - * pixel format component c to dst. - * - * @param data the array containing the pointers to the planes of the image - * @param linesize the array containing the linesizes of the image - * @param desc the pixel format descriptor for the image - * @param x the horizontal coordinate of the first pixel to read - * @param y the vertical coordinate of the first pixel to read - * @param w the width of the line to read, that is the number of - * values to write to dst - * @param read_pal_component if not zero and the format is a paletted - * format writes the values corresponding to the palette - * component c in data[1] to dst, rather than the palette indexes in - * data[0]. The behavior is undefined if the format is not paletted. - */ -void av_read_image_line(uint16_t *dst, const uint8_t *data[4], const int linesize[4], - const AVPixFmtDescriptor *desc, int x, int y, int c, int w, int read_pal_component); - -/** - * Write the values from src to the pixel format component c of an - * image line. - * - * @param src array containing the values to write - * @param data the array containing the pointers to the planes of the - * image to write into. It is supposed to be zeroed. - * @param linesize the array containing the linesizes of the image - * @param desc the pixel format descriptor for the image - * @param x the horizontal coordinate of the first pixel to write - * @param y the vertical coordinate of the first pixel to write - * @param w the width of the line to write, that is the number of - * values to write to the image line - */ -void av_write_image_line(const uint16_t *src, uint8_t *data[4], const int linesize[4], - const AVPixFmtDescriptor *desc, int x, int y, int c, int w); - -/** - * Return the pixel format corresponding to name. - * - * If there is no pixel format with name name, then looks for a - * pixel format with the name corresponding to the native endian - * format of name. - * For example in a little-endian system, first looks for "gray16", - * then for "gray16le". - * - * Finally if no pixel format has been found, returns AV_PIX_FMT_NONE. - */ -enum AVPixelFormat av_get_pix_fmt(const char *name); - -/** - * Return the short name for a pixel format, NULL in case pix_fmt is - * unknown. - * - * @see av_get_pix_fmt(), av_get_pix_fmt_string() - */ -const char *av_get_pix_fmt_name(enum AVPixelFormat pix_fmt); - -/** - * Print in buf the string corresponding to the pixel format with - * number pix_fmt, or a header if pix_fmt is negative. - * - * @param buf the buffer where to write the string - * @param buf_size the size of buf - * @param pix_fmt the number of the pixel format to print the - * corresponding info string, or a negative value to print the - * corresponding header. - */ -char *av_get_pix_fmt_string (char *buf, int buf_size, enum AVPixelFormat pix_fmt); - -/** - * Return the number of bits per pixel used by the pixel format - * described by pixdesc. Note that this is not the same as the number - * of bits per sample. - * - * The returned number of bits refers to the number of bits actually - * used for storing the pixel information, that is padding bits are - * not counted. - */ -int av_get_bits_per_pixel(const AVPixFmtDescriptor *pixdesc); - -/** - * Return the number of bits per pixel for the pixel format - * described by pixdesc, including any padding or unused bits. - */ -int av_get_padded_bits_per_pixel(const AVPixFmtDescriptor *pixdesc); - -/** - * @return a pixel format descriptor for provided pixel format or NULL if - * this pixel format is unknown. - */ -const AVPixFmtDescriptor *av_pix_fmt_desc_get(enum AVPixelFormat pix_fmt); - -/** - * Iterate over all pixel format descriptors known to libavutil. - * - * @param prev previous descriptor. NULL to get the first descriptor. - * - * @return next descriptor or NULL after the last descriptor - */ -const AVPixFmtDescriptor *av_pix_fmt_desc_next(const AVPixFmtDescriptor *prev); - -/** - * @return an AVPixelFormat id described by desc, or AV_PIX_FMT_NONE if desc - * is not a valid pointer to a pixel format descriptor. - */ -enum AVPixelFormat av_pix_fmt_desc_get_id(const AVPixFmtDescriptor *desc); - -/** - * Utility function to access log2_chroma_w log2_chroma_h from - * the pixel format AVPixFmtDescriptor. - * - * See av_get_chroma_sub_sample() for a function that asserts a - * valid pixel format instead of returning an error code. - * Its recommanded that you use avcodec_get_chroma_sub_sample unless - * you do check the return code! - * - * @param[in] pix_fmt the pixel format - * @param[out] h_shift store log2_chroma_w - * @param[out] v_shift store log2_chroma_h - * - * @return 0 on success, AVERROR(ENOSYS) on invalid or unknown pixel format - */ -int av_pix_fmt_get_chroma_sub_sample(enum AVPixelFormat pix_fmt, - int *h_shift, int *v_shift); - -/** - * @return number of planes in pix_fmt, a negative AVERROR if pix_fmt is not a - * valid pixel format. - */ -int av_pix_fmt_count_planes(enum AVPixelFormat pix_fmt); - -void ff_check_pixfmt_descriptors(void); - -/** - * Utility function to swap the endianness of a pixel format. - * - * @param[in] pix_fmt the pixel format - * - * @return pixel format with swapped endianness if it exists, - * otherwise AV_PIX_FMT_NONE - */ -enum AVPixelFormat av_pix_fmt_swap_endianness(enum AVPixelFormat pix_fmt); - -#define FF_LOSS_RESOLUTION 0x0001 /**< loss due to resolution change */ -#define FF_LOSS_DEPTH 0x0002 /**< loss due to color depth change */ -#define FF_LOSS_COLORSPACE 0x0004 /**< loss due to color space conversion */ -#define FF_LOSS_ALPHA 0x0008 /**< loss of alpha bits */ -#define FF_LOSS_COLORQUANT 0x0010 /**< loss due to color quantization */ -#define FF_LOSS_CHROMA 0x0020 /**< loss of chroma (e.g. RGB to gray conversion) */ - -/** - * Compute what kind of losses will occur when converting from one specific - * pixel format to another. - * When converting from one pixel format to another, information loss may occur. - * For example, when converting from RGB24 to GRAY, the color information will - * be lost. Similarly, other losses occur when converting from some formats to - * other formats. These losses can involve loss of chroma, but also loss of - * resolution, loss of color depth, loss due to the color space conversion, loss - * of the alpha bits or loss due to color quantization. - * av_get_fix_fmt_loss() informs you about the various types of losses - * which will occur when converting from one pixel format to another. - * - * @param[in] dst_pix_fmt destination pixel format - * @param[in] src_pix_fmt source pixel format - * @param[in] has_alpha Whether the source pixel format alpha channel is used. - * @return Combination of flags informing you what kind of losses will occur - * (maximum loss for an invalid dst_pix_fmt). - */ -int av_get_pix_fmt_loss(enum AVPixelFormat dst_pix_fmt, - enum AVPixelFormat src_pix_fmt, - int has_alpha); - -/** - * Compute what kind of losses will occur when converting from one specific - * pixel format to another. - * When converting from one pixel format to another, information loss may occur. - * For example, when converting from RGB24 to GRAY, the color information will - * be lost. Similarly, other losses occur when converting from some formats to - * other formats. These losses can involve loss of chroma, but also loss of - * resolution, loss of color depth, loss due to the color space conversion, loss - * of the alpha bits or loss due to color quantization. - * av_get_fix_fmt_loss() informs you about the various types of losses - * which will occur when converting from one pixel format to another. - * - * @param[in] dst_pix_fmt destination pixel format - * @param[in] src_pix_fmt source pixel format - * @param[in] has_alpha Whether the source pixel format alpha channel is used. - * @return Combination of flags informing you what kind of losses will occur - * (maximum loss for an invalid dst_pix_fmt). - */ -enum AVPixelFormat av_find_best_pix_fmt_of_2(enum AVPixelFormat dst_pix_fmt1, enum AVPixelFormat dst_pix_fmt2, - enum AVPixelFormat src_pix_fmt, int has_alpha, int *loss_ptr); -#endif /* AVUTIL_PIXDESC_H */ diff --git a/dji_sdk_manifold_read_cam/include/libavutil/pixfmt.h b/dji_sdk_manifold_read_cam/include/libavutil/pixfmt.h deleted file mode 100644 index 57155cb..0000000 --- a/dji_sdk_manifold_read_cam/include/libavutil/pixfmt.h +++ /dev/null @@ -1,421 +0,0 @@ -/* - * copyright (c) 2006 Michael Niedermayer - * - * This file is part of FFmpeg. - * - * FFmpeg is free software; you can redistribute it and/or - * modify it under the terms of the GNU Lesser General Public - * License as published by the Free Software Foundation; either - * version 2.1 of the License, or (at your option) any later version. - * - * FFmpeg is distributed in the hope that it will be useful, - * but WITHOUT ANY WARRANTY; without even the implied warranty of - * MERCHANTABILITY or FITNESS FOR A PARTICULAR PURPOSE. See the GNU - * Lesser General Public License for more details. - * - * You should have received a copy of the GNU Lesser General Public - * License along with FFmpeg; if not, write to the Free Software - * Foundation, Inc., 51 Franklin Street, Fifth Floor, Boston, MA 02110-1301 USA - */ - -#ifndef AVUTIL_PIXFMT_H -#define AVUTIL_PIXFMT_H - -/** - * @file - * pixel format definitions - * - */ - -#include "libavutil/avconfig.h" -#include "version.h" - -#define AVPALETTE_SIZE 1024 -#define AVPALETTE_COUNT 256 - -/** - * Pixel format. - * - * @note - * AV_PIX_FMT_RGB32 is handled in an endian-specific manner. An RGBA - * color is put together as: - * (A << 24) | (R << 16) | (G << 8) | B - * This is stored as BGRA on little-endian CPU architectures and ARGB on - * big-endian CPUs. - * - * @par - * When the pixel format is palettized RGB (AV_PIX_FMT_PAL8), the palettized - * image data is stored in AVFrame.data[0]. The palette is transported in - * AVFrame.data[1], is 1024 bytes long (256 4-byte entries) and is - * formatted the same as in AV_PIX_FMT_RGB32 described above (i.e., it is - * also endian-specific). Note also that the individual RGB palette - * components stored in AVFrame.data[1] should be in the range 0..255. - * This is important as many custom PAL8 video codecs that were designed - * to run on the IBM VGA graphics adapter use 6-bit palette components. - * - * @par - * For all the 8bit per pixel formats, an RGB32 palette is in data[1] like - * for pal8. This palette is filled in automatically by the function - * allocating the picture. - * - * @note - * Make sure that all newly added big-endian formats have (pix_fmt & 1) == 1 - * and that all newly added little-endian formats have (pix_fmt & 1) == 0. - * This allows simpler detection of big vs little-endian. - */ -enum AVPixelFormat { - AV_PIX_FMT_NONE = -1, - AV_PIX_FMT_YUV420P, ///< planar YUV 4:2:0, 12bpp, (1 Cr & Cb sample per 2x2 Y samples) - AV_PIX_FMT_YUYV422, ///< packed YUV 4:2:2, 16bpp, Y0 Cb Y1 Cr - AV_PIX_FMT_RGB24, ///< packed RGB 8:8:8, 24bpp, RGBRGB... - AV_PIX_FMT_BGR24, ///< packed RGB 8:8:8, 24bpp, BGRBGR... - AV_PIX_FMT_YUV422P, ///< planar YUV 4:2:2, 16bpp, (1 Cr & Cb sample per 2x1 Y samples) - AV_PIX_FMT_YUV444P, ///< planar YUV 4:4:4, 24bpp, (1 Cr & Cb sample per 1x1 Y samples) - AV_PIX_FMT_YUV410P, ///< planar YUV 4:1:0, 9bpp, (1 Cr & Cb sample per 4x4 Y samples) - AV_PIX_FMT_YUV411P, ///< planar YUV 4:1:1, 12bpp, (1 Cr & Cb sample per 4x1 Y samples) - AV_PIX_FMT_GRAY8, ///< Y , 8bpp - AV_PIX_FMT_MONOWHITE, ///< Y , 1bpp, 0 is white, 1 is black, in each byte pixels are ordered from the msb to the lsb - AV_PIX_FMT_MONOBLACK, ///< Y , 1bpp, 0 is black, 1 is white, in each byte pixels are ordered from the msb to the lsb - AV_PIX_FMT_PAL8, ///< 8 bit with PIX_FMT_RGB32 palette - AV_PIX_FMT_YUVJ420P, ///< planar YUV 4:2:0, 12bpp, full scale (JPEG), deprecated in favor of PIX_FMT_YUV420P and setting color_range - AV_PIX_FMT_YUVJ422P, ///< planar YUV 4:2:2, 16bpp, full scale (JPEG), deprecated in favor of PIX_FMT_YUV422P and setting color_range - AV_PIX_FMT_YUVJ444P, ///< planar YUV 4:4:4, 24bpp, full scale (JPEG), deprecated in favor of PIX_FMT_YUV444P and setting color_range -#if FF_API_XVMC - AV_PIX_FMT_XVMC_MPEG2_MC,///< XVideo Motion Acceleration via common packet passing - AV_PIX_FMT_XVMC_MPEG2_IDCT, -#define AV_PIX_FMT_XVMC AV_PIX_FMT_XVMC_MPEG2_IDCT -#endif /* FF_API_XVMC */ - AV_PIX_FMT_UYVY422, ///< packed YUV 4:2:2, 16bpp, Cb Y0 Cr Y1 - AV_PIX_FMT_UYYVYY411, ///< packed YUV 4:1:1, 12bpp, Cb Y0 Y1 Cr Y2 Y3 - AV_PIX_FMT_BGR8, ///< packed RGB 3:3:2, 8bpp, (msb)2B 3G 3R(lsb) - AV_PIX_FMT_BGR4, ///< packed RGB 1:2:1 bitstream, 4bpp, (msb)1B 2G 1R(lsb), a byte contains two pixels, the first pixel in the byte is the one composed by the 4 msb bits - AV_PIX_FMT_BGR4_BYTE, ///< packed RGB 1:2:1, 8bpp, (msb)1B 2G 1R(lsb) - AV_PIX_FMT_RGB8, ///< packed RGB 3:3:2, 8bpp, (msb)2R 3G 3B(lsb) - AV_PIX_FMT_RGB4, ///< packed RGB 1:2:1 bitstream, 4bpp, (msb)1R 2G 1B(lsb), a byte contains two pixels, the first pixel in the byte is the one composed by the 4 msb bits - AV_PIX_FMT_RGB4_BYTE, ///< packed RGB 1:2:1, 8bpp, (msb)1R 2G 1B(lsb) - AV_PIX_FMT_NV12, ///< planar YUV 4:2:0, 12bpp, 1 plane for Y and 1 plane for the UV components, which are interleaved (first byte U and the following byte V) - AV_PIX_FMT_NV21, ///< as above, but U and V bytes are swapped - - AV_PIX_FMT_ARGB, ///< packed ARGB 8:8:8:8, 32bpp, ARGBARGB... - AV_PIX_FMT_RGBA, ///< packed RGBA 8:8:8:8, 32bpp, RGBARGBA... - AV_PIX_FMT_ABGR, ///< packed ABGR 8:8:8:8, 32bpp, ABGRABGR... - AV_PIX_FMT_BGRA, ///< packed BGRA 8:8:8:8, 32bpp, BGRABGRA... - - AV_PIX_FMT_GRAY16BE, ///< Y , 16bpp, big-endian - AV_PIX_FMT_GRAY16LE, ///< Y , 16bpp, little-endian - AV_PIX_FMT_YUV440P, ///< planar YUV 4:4:0 (1 Cr & Cb sample per 1x2 Y samples) - AV_PIX_FMT_YUVJ440P, ///< planar YUV 4:4:0 full scale (JPEG), deprecated in favor of PIX_FMT_YUV440P and setting color_range - AV_PIX_FMT_YUVA420P, ///< planar YUV 4:2:0, 20bpp, (1 Cr & Cb sample per 2x2 Y & A samples) -#if FF_API_VDPAU - AV_PIX_FMT_VDPAU_H264,///< H.264 HW decoding with VDPAU, data[0] contains a vdpau_render_state struct which contains the bitstream of the slices as well as various fields extracted from headers - AV_PIX_FMT_VDPAU_MPEG1,///< MPEG-1 HW decoding with VDPAU, data[0] contains a vdpau_render_state struct which contains the bitstream of the slices as well as various fields extracted from headers - AV_PIX_FMT_VDPAU_MPEG2,///< MPEG-2 HW decoding with VDPAU, data[0] contains a vdpau_render_state struct which contains the bitstream of the slices as well as various fields extracted from headers - AV_PIX_FMT_VDPAU_WMV3,///< WMV3 HW decoding with VDPAU, data[0] contains a vdpau_render_state struct which contains the bitstream of the slices as well as various fields extracted from headers - AV_PIX_FMT_VDPAU_VC1, ///< VC-1 HW decoding with VDPAU, data[0] contains a vdpau_render_state struct which contains the bitstream of the slices as well as various fields extracted from headers -#endif - AV_PIX_FMT_RGB48BE, ///< packed RGB 16:16:16, 48bpp, 16R, 16G, 16B, the 2-byte value for each R/G/B component is stored as big-endian - AV_PIX_FMT_RGB48LE, ///< packed RGB 16:16:16, 48bpp, 16R, 16G, 16B, the 2-byte value for each R/G/B component is stored as little-endian - - AV_PIX_FMT_RGB565BE, ///< packed RGB 5:6:5, 16bpp, (msb) 5R 6G 5B(lsb), big-endian - AV_PIX_FMT_RGB565LE, ///< packed RGB 5:6:5, 16bpp, (msb) 5R 6G 5B(lsb), little-endian - AV_PIX_FMT_RGB555BE, ///< packed RGB 5:5:5, 16bpp, (msb)1A 5R 5G 5B(lsb), big-endian, most significant bit to 0 - AV_PIX_FMT_RGB555LE, ///< packed RGB 5:5:5, 16bpp, (msb)1A 5R 5G 5B(lsb), little-endian, most significant bit to 0 - - AV_PIX_FMT_BGR565BE, ///< packed BGR 5:6:5, 16bpp, (msb) 5B 6G 5R(lsb), big-endian - AV_PIX_FMT_BGR565LE, ///< packed BGR 5:6:5, 16bpp, (msb) 5B 6G 5R(lsb), little-endian - AV_PIX_FMT_BGR555BE, ///< packed BGR 5:5:5, 16bpp, (msb)1A 5B 5G 5R(lsb), big-endian, most significant bit to 1 - AV_PIX_FMT_BGR555LE, ///< packed BGR 5:5:5, 16bpp, (msb)1A 5B 5G 5R(lsb), little-endian, most significant bit to 1 - - AV_PIX_FMT_VAAPI_MOCO, ///< HW acceleration through VA API at motion compensation entry-point, Picture.data[3] contains a vaapi_render_state struct which contains macroblocks as well as various fields extracted from headers - AV_PIX_FMT_VAAPI_IDCT, ///< HW acceleration through VA API at IDCT entry-point, Picture.data[3] contains a vaapi_render_state struct which contains fields extracted from headers - AV_PIX_FMT_VAAPI_VLD, ///< HW decoding through VA API, Picture.data[3] contains a vaapi_render_state struct which contains the bitstream of the slices as well as various fields extracted from headers - - AV_PIX_FMT_YUV420P16LE, ///< planar YUV 4:2:0, 24bpp, (1 Cr & Cb sample per 2x2 Y samples), little-endian - AV_PIX_FMT_YUV420P16BE, ///< planar YUV 4:2:0, 24bpp, (1 Cr & Cb sample per 2x2 Y samples), big-endian - AV_PIX_FMT_YUV422P16LE, ///< planar YUV 4:2:2, 32bpp, (1 Cr & Cb sample per 2x1 Y samples), little-endian - AV_PIX_FMT_YUV422P16BE, ///< planar YUV 4:2:2, 32bpp, (1 Cr & Cb sample per 2x1 Y samples), big-endian - AV_PIX_FMT_YUV444P16LE, ///< planar YUV 4:4:4, 48bpp, (1 Cr & Cb sample per 1x1 Y samples), little-endian - AV_PIX_FMT_YUV444P16BE, ///< planar YUV 4:4:4, 48bpp, (1 Cr & Cb sample per 1x1 Y samples), big-endian -#if FF_API_VDPAU - AV_PIX_FMT_VDPAU_MPEG4, ///< MPEG4 HW decoding with VDPAU, data[0] contains a vdpau_render_state struct which contains the bitstream of the slices as well as various fields extracted from headers -#endif - AV_PIX_FMT_DXVA2_VLD, ///< HW decoding through DXVA2, Picture.data[3] contains a LPDIRECT3DSURFACE9 pointer - - AV_PIX_FMT_RGB444LE, ///< packed RGB 4:4:4, 16bpp, (msb)4A 4R 4G 4B(lsb), little-endian, most significant bits to 0 - AV_PIX_FMT_RGB444BE, ///< packed RGB 4:4:4, 16bpp, (msb)4A 4R 4G 4B(lsb), big-endian, most significant bits to 0 - AV_PIX_FMT_BGR444LE, ///< packed BGR 4:4:4, 16bpp, (msb)4A 4B 4G 4R(lsb), little-endian, most significant bits to 1 - AV_PIX_FMT_BGR444BE, ///< packed BGR 4:4:4, 16bpp, (msb)4A 4B 4G 4R(lsb), big-endian, most significant bits to 1 - AV_PIX_FMT_GRAY8A, ///< 8bit gray, 8bit alpha - AV_PIX_FMT_BGR48BE, ///< packed RGB 16:16:16, 48bpp, 16B, 16G, 16R, the 2-byte value for each R/G/B component is stored as big-endian - AV_PIX_FMT_BGR48LE, ///< packed RGB 16:16:16, 48bpp, 16B, 16G, 16R, the 2-byte value for each R/G/B component is stored as little-endian - - /** - * The following 12 formats have the disadvantage of needing 1 format for each bit depth. - * Notice that each 9/10 bits sample is stored in 16 bits with extra padding. - * If you want to support multiple bit depths, then using AV_PIX_FMT_YUV420P16* with the bpp stored separately is better. - */ - AV_PIX_FMT_YUV420P9BE, ///< planar YUV 4:2:0, 13.5bpp, (1 Cr & Cb sample per 2x2 Y samples), big-endian - AV_PIX_FMT_YUV420P9LE, ///< planar YUV 4:2:0, 13.5bpp, (1 Cr & Cb sample per 2x2 Y samples), little-endian - AV_PIX_FMT_YUV420P10BE,///< planar YUV 4:2:0, 15bpp, (1 Cr & Cb sample per 2x2 Y samples), big-endian - AV_PIX_FMT_YUV420P10LE,///< planar YUV 4:2:0, 15bpp, (1 Cr & Cb sample per 2x2 Y samples), little-endian - AV_PIX_FMT_YUV422P10BE,///< planar YUV 4:2:2, 20bpp, (1 Cr & Cb sample per 2x1 Y samples), big-endian - AV_PIX_FMT_YUV422P10LE,///< planar YUV 4:2:2, 20bpp, (1 Cr & Cb sample per 2x1 Y samples), little-endian - AV_PIX_FMT_YUV444P9BE, ///< planar YUV 4:4:4, 27bpp, (1 Cr & Cb sample per 1x1 Y samples), big-endian - AV_PIX_FMT_YUV444P9LE, ///< planar YUV 4:4:4, 27bpp, (1 Cr & Cb sample per 1x1 Y samples), little-endian - AV_PIX_FMT_YUV444P10BE,///< planar YUV 4:4:4, 30bpp, (1 Cr & Cb sample per 1x1 Y samples), big-endian - AV_PIX_FMT_YUV444P10LE,///< planar YUV 4:4:4, 30bpp, (1 Cr & Cb sample per 1x1 Y samples), little-endian - AV_PIX_FMT_YUV422P9BE, ///< planar YUV 4:2:2, 18bpp, (1 Cr & Cb sample per 2x1 Y samples), big-endian - AV_PIX_FMT_YUV422P9LE, ///< planar YUV 4:2:2, 18bpp, (1 Cr & Cb sample per 2x1 Y samples), little-endian - AV_PIX_FMT_VDA_VLD, ///< hardware decoding through VDA - -#ifdef AV_PIX_FMT_ABI_GIT_MASTER - AV_PIX_FMT_RGBA64BE, ///< packed RGBA 16:16:16:16, 64bpp, 16R, 16G, 16B, 16A, the 2-byte value for each R/G/B/A component is stored as big-endian - AV_PIX_FMT_RGBA64LE, ///< packed RGBA 16:16:16:16, 64bpp, 16R, 16G, 16B, 16A, the 2-byte value for each R/G/B/A component is stored as little-endian - AV_PIX_FMT_BGRA64BE, ///< packed RGBA 16:16:16:16, 64bpp, 16B, 16G, 16R, 16A, the 2-byte value for each R/G/B/A component is stored as big-endian - AV_PIX_FMT_BGRA64LE, ///< packed RGBA 16:16:16:16, 64bpp, 16B, 16G, 16R, 16A, the 2-byte value for each R/G/B/A component is stored as little-endian -#endif - AV_PIX_FMT_GBRP, ///< planar GBR 4:4:4 24bpp - AV_PIX_FMT_GBRP9BE, ///< planar GBR 4:4:4 27bpp, big-endian - AV_PIX_FMT_GBRP9LE, ///< planar GBR 4:4:4 27bpp, little-endian - AV_PIX_FMT_GBRP10BE, ///< planar GBR 4:4:4 30bpp, big-endian - AV_PIX_FMT_GBRP10LE, ///< planar GBR 4:4:4 30bpp, little-endian - AV_PIX_FMT_GBRP16BE, ///< planar GBR 4:4:4 48bpp, big-endian - AV_PIX_FMT_GBRP16LE, ///< planar GBR 4:4:4 48bpp, little-endian - - /** - * duplicated pixel formats for compatibility with libav. - * FFmpeg supports these formats since May 8 2012 and Jan 28 2012 (commits f9ca1ac7 and 143a5c55) - * Libav added them Oct 12 2012 with incompatible values (commit 6d5600e85) - */ - AV_PIX_FMT_YUVA422P_LIBAV, ///< planar YUV 4:2:2 24bpp, (1 Cr & Cb sample per 2x1 Y & A samples) - AV_PIX_FMT_YUVA444P_LIBAV, ///< planar YUV 4:4:4 32bpp, (1 Cr & Cb sample per 1x1 Y & A samples) - - AV_PIX_FMT_YUVA420P9BE, ///< planar YUV 4:2:0 22.5bpp, (1 Cr & Cb sample per 2x2 Y & A samples), big-endian - AV_PIX_FMT_YUVA420P9LE, ///< planar YUV 4:2:0 22.5bpp, (1 Cr & Cb sample per 2x2 Y & A samples), little-endian - AV_PIX_FMT_YUVA422P9BE, ///< planar YUV 4:2:2 27bpp, (1 Cr & Cb sample per 2x1 Y & A samples), big-endian - AV_PIX_FMT_YUVA422P9LE, ///< planar YUV 4:2:2 27bpp, (1 Cr & Cb sample per 2x1 Y & A samples), little-endian - AV_PIX_FMT_YUVA444P9BE, ///< planar YUV 4:4:4 36bpp, (1 Cr & Cb sample per 1x1 Y & A samples), big-endian - AV_PIX_FMT_YUVA444P9LE, ///< planar YUV 4:4:4 36bpp, (1 Cr & Cb sample per 1x1 Y & A samples), little-endian - AV_PIX_FMT_YUVA420P10BE, ///< planar YUV 4:2:0 25bpp, (1 Cr & Cb sample per 2x2 Y & A samples, big-endian) - AV_PIX_FMT_YUVA420P10LE, ///< planar YUV 4:2:0 25bpp, (1 Cr & Cb sample per 2x2 Y & A samples, little-endian) - AV_PIX_FMT_YUVA422P10BE, ///< planar YUV 4:2:2 30bpp, (1 Cr & Cb sample per 2x1 Y & A samples, big-endian) - AV_PIX_FMT_YUVA422P10LE, ///< planar YUV 4:2:2 30bpp, (1 Cr & Cb sample per 2x1 Y & A samples, little-endian) - AV_PIX_FMT_YUVA444P10BE, ///< planar YUV 4:4:4 40bpp, (1 Cr & Cb sample per 1x1 Y & A samples, big-endian) - AV_PIX_FMT_YUVA444P10LE, ///< planar YUV 4:4:4 40bpp, (1 Cr & Cb sample per 1x1 Y & A samples, little-endian) - AV_PIX_FMT_YUVA420P16BE, ///< planar YUV 4:2:0 40bpp, (1 Cr & Cb sample per 2x2 Y & A samples, big-endian) - AV_PIX_FMT_YUVA420P16LE, ///< planar YUV 4:2:0 40bpp, (1 Cr & Cb sample per 2x2 Y & A samples, little-endian) - AV_PIX_FMT_YUVA422P16BE, ///< planar YUV 4:2:2 48bpp, (1 Cr & Cb sample per 2x1 Y & A samples, big-endian) - AV_PIX_FMT_YUVA422P16LE, ///< planar YUV 4:2:2 48bpp, (1 Cr & Cb sample per 2x1 Y & A samples, little-endian) - AV_PIX_FMT_YUVA444P16BE, ///< planar YUV 4:4:4 64bpp, (1 Cr & Cb sample per 1x1 Y & A samples, big-endian) - AV_PIX_FMT_YUVA444P16LE, ///< planar YUV 4:4:4 64bpp, (1 Cr & Cb sample per 1x1 Y & A samples, little-endian) - - AV_PIX_FMT_VDPAU, ///< HW acceleration through VDPAU, Picture.data[3] contains a VdpVideoSurface - - AV_PIX_FMT_XYZ12LE, ///< packed XYZ 4:4:4, 36 bpp, (msb) 12X, 12Y, 12Z (lsb), the 2-byte value for each X/Y/Z is stored as little-endian, the 4 lower bits are set to 0 - AV_PIX_FMT_XYZ12BE, ///< packed XYZ 4:4:4, 36 bpp, (msb) 12X, 12Y, 12Z (lsb), the 2-byte value for each X/Y/Z is stored as big-endian, the 4 lower bits are set to 0 - AV_PIX_FMT_NV16, ///< interleaved chroma YUV 4:2:2, 16bpp, (1 Cr & Cb sample per 2x1 Y samples) - AV_PIX_FMT_NV20LE, ///< interleaved chroma YUV 4:2:2, 20bpp, (1 Cr & Cb sample per 2x1 Y samples), little-endian - AV_PIX_FMT_NV20BE, ///< interleaved chroma YUV 4:2:2, 20bpp, (1 Cr & Cb sample per 2x1 Y samples), big-endian - - /** - * duplicated pixel formats for compatibility with libav. - * FFmpeg supports these formats since Sat Sep 24 06:01:45 2011 +0200 (commits 9569a3c9f41387a8c7d1ce97d8693520477a66c3) - * also see Fri Nov 25 01:38:21 2011 +0100 92afb431621c79155fcb7171d26f137eb1bee028 - * Libav added them Sun Mar 16 23:05:47 2014 +0100 with incompatible values (commit 1481d24c3a0abf81e1d7a514547bd5305232be30) - */ - AV_PIX_FMT_RGBA64BE_LIBAV, ///< packed RGBA 16:16:16:16, 64bpp, 16R, 16G, 16B, 16A, the 2-byte value for each R/G/B/A component is stored as big-endian - AV_PIX_FMT_RGBA64LE_LIBAV, ///< packed RGBA 16:16:16:16, 64bpp, 16R, 16G, 16B, 16A, the 2-byte value for each R/G/B/A component is stored as little-endian - AV_PIX_FMT_BGRA64BE_LIBAV, ///< packed RGBA 16:16:16:16, 64bpp, 16B, 16G, 16R, 16A, the 2-byte value for each R/G/B/A component is stored as big-endian - AV_PIX_FMT_BGRA64LE_LIBAV, ///< packed RGBA 16:16:16:16, 64bpp, 16B, 16G, 16R, 16A, the 2-byte value for each R/G/B/A component is stored as little-endian - - AV_PIX_FMT_YVYU422, ///< packed YUV 4:2:2, 16bpp, Y0 Cr Y1 Cb - -#ifndef AV_PIX_FMT_ABI_GIT_MASTER - AV_PIX_FMT_RGBA64BE=0x123, ///< packed RGBA 16:16:16:16, 64bpp, 16R, 16G, 16B, 16A, the 2-byte value for each R/G/B/A component is stored as big-endian - AV_PIX_FMT_RGBA64LE, ///< packed RGBA 16:16:16:16, 64bpp, 16R, 16G, 16B, 16A, the 2-byte value for each R/G/B/A component is stored as little-endian - AV_PIX_FMT_BGRA64BE, ///< packed RGBA 16:16:16:16, 64bpp, 16B, 16G, 16R, 16A, the 2-byte value for each R/G/B/A component is stored as big-endian - AV_PIX_FMT_BGRA64LE, ///< packed RGBA 16:16:16:16, 64bpp, 16B, 16G, 16R, 16A, the 2-byte value for each R/G/B/A component is stored as little-endian -#endif - AV_PIX_FMT_0RGB=0x123+4, ///< packed RGB 8:8:8, 32bpp, 0RGB0RGB... - AV_PIX_FMT_RGB0, ///< packed RGB 8:8:8, 32bpp, RGB0RGB0... - AV_PIX_FMT_0BGR, ///< packed BGR 8:8:8, 32bpp, 0BGR0BGR... - AV_PIX_FMT_BGR0, ///< packed BGR 8:8:8, 32bpp, BGR0BGR0... - AV_PIX_FMT_YUVA444P, ///< planar YUV 4:4:4 32bpp, (1 Cr & Cb sample per 1x1 Y & A samples) - AV_PIX_FMT_YUVA422P, ///< planar YUV 4:2:2 24bpp, (1 Cr & Cb sample per 2x1 Y & A samples) - - AV_PIX_FMT_YUV420P12BE, ///< planar YUV 4:2:0,18bpp, (1 Cr & Cb sample per 2x2 Y samples), big-endian - AV_PIX_FMT_YUV420P12LE, ///< planar YUV 4:2:0,18bpp, (1 Cr & Cb sample per 2x2 Y samples), little-endian - AV_PIX_FMT_YUV420P14BE, ///< planar YUV 4:2:0,21bpp, (1 Cr & Cb sample per 2x2 Y samples), big-endian - AV_PIX_FMT_YUV420P14LE, ///< planar YUV 4:2:0,21bpp, (1 Cr & Cb sample per 2x2 Y samples), little-endian - AV_PIX_FMT_YUV422P12BE, ///< planar YUV 4:2:2,24bpp, (1 Cr & Cb sample per 2x1 Y samples), big-endian - AV_PIX_FMT_YUV422P12LE, ///< planar YUV 4:2:2,24bpp, (1 Cr & Cb sample per 2x1 Y samples), little-endian - AV_PIX_FMT_YUV422P14BE, ///< planar YUV 4:2:2,28bpp, (1 Cr & Cb sample per 2x1 Y samples), big-endian - AV_PIX_FMT_YUV422P14LE, ///< planar YUV 4:2:2,28bpp, (1 Cr & Cb sample per 2x1 Y samples), little-endian - AV_PIX_FMT_YUV444P12BE, ///< planar YUV 4:4:4,36bpp, (1 Cr & Cb sample per 1x1 Y samples), big-endian - AV_PIX_FMT_YUV444P12LE, ///< planar YUV 4:4:4,36bpp, (1 Cr & Cb sample per 1x1 Y samples), little-endian - AV_PIX_FMT_YUV444P14BE, ///< planar YUV 4:4:4,42bpp, (1 Cr & Cb sample per 1x1 Y samples), big-endian - AV_PIX_FMT_YUV444P14LE, ///< planar YUV 4:4:4,42bpp, (1 Cr & Cb sample per 1x1 Y samples), little-endian - AV_PIX_FMT_GBRP12BE, ///< planar GBR 4:4:4 36bpp, big-endian - AV_PIX_FMT_GBRP12LE, ///< planar GBR 4:4:4 36bpp, little-endian - AV_PIX_FMT_GBRP14BE, ///< planar GBR 4:4:4 42bpp, big-endian - AV_PIX_FMT_GBRP14LE, ///< planar GBR 4:4:4 42bpp, little-endian - AV_PIX_FMT_GBRAP, ///< planar GBRA 4:4:4:4 32bpp - AV_PIX_FMT_GBRAP16BE, ///< planar GBRA 4:4:4:4 64bpp, big-endian - AV_PIX_FMT_GBRAP16LE, ///< planar GBRA 4:4:4:4 64bpp, little-endian - AV_PIX_FMT_YUVJ411P, ///< planar YUV 4:1:1, 12bpp, (1 Cr & Cb sample per 4x1 Y samples) full scale (JPEG), deprecated in favor of PIX_FMT_YUV411P and setting color_range - - AV_PIX_FMT_BAYER_BGGR8, ///< bayer, BGBG..(odd line), GRGR..(even line), 8-bit samples */ - AV_PIX_FMT_BAYER_RGGB8, ///< bayer, RGRG..(odd line), GBGB..(even line), 8-bit samples */ - AV_PIX_FMT_BAYER_GBRG8, ///< bayer, GBGB..(odd line), RGRG..(even line), 8-bit samples */ - AV_PIX_FMT_BAYER_GRBG8, ///< bayer, GRGR..(odd line), BGBG..(even line), 8-bit samples */ - AV_PIX_FMT_BAYER_BGGR16LE, ///< bayer, BGBG..(odd line), GRGR..(even line), 16-bit samples, little-endian */ - AV_PIX_FMT_BAYER_BGGR16BE, ///< bayer, BGBG..(odd line), GRGR..(even line), 16-bit samples, big-endian */ - AV_PIX_FMT_BAYER_RGGB16LE, ///< bayer, RGRG..(odd line), GBGB..(even line), 16-bit samples, little-endian */ - AV_PIX_FMT_BAYER_RGGB16BE, ///< bayer, RGRG..(odd line), GBGB..(even line), 16-bit samples, big-endian */ - AV_PIX_FMT_BAYER_GBRG16LE, ///< bayer, GBGB..(odd line), RGRG..(even line), 16-bit samples, little-endian */ - AV_PIX_FMT_BAYER_GBRG16BE, ///< bayer, GBGB..(odd line), RGRG..(even line), 16-bit samples, big-endian */ - AV_PIX_FMT_BAYER_GRBG16LE, ///< bayer, GRGR..(odd line), BGBG..(even line), 16-bit samples, little-endian */ - AV_PIX_FMT_BAYER_GRBG16BE, ///< bayer, GRGR..(odd line), BGBG..(even line), 16-bit samples, big-endian */ -#if !FF_API_XVMC - AV_PIX_FMT_XVMC,///< XVideo Motion Acceleration via common packet passing -#endif /* !FF_API_XVMC */ - - AV_PIX_FMT_NB, ///< number of pixel formats, DO NOT USE THIS if you want to link with shared libav* because the number of formats might differ between versions - -#if FF_API_PIX_FMT -#include "old_pix_fmts.h" -#endif -}; - -#if AV_HAVE_INCOMPATIBLE_LIBAV_ABI -#define AV_PIX_FMT_YUVA422P AV_PIX_FMT_YUVA422P_LIBAV -#define AV_PIX_FMT_YUVA444P AV_PIX_FMT_YUVA444P_LIBAV -#define AV_PIX_FMT_RGBA64BE AV_PIX_FMT_RGBA64BE_LIBAV -#define AV_PIX_FMT_RGBA64LE AV_PIX_FMT_RGBA64LE_LIBAV -#define AV_PIX_FMT_BGRA64BE AV_PIX_FMT_BGRA64BE_LIBAV -#define AV_PIX_FMT_BGRA64LE AV_PIX_FMT_BGRA64LE_LIBAV -#endif - - -#define AV_PIX_FMT_Y400A AV_PIX_FMT_GRAY8A -#define AV_PIX_FMT_GBR24P AV_PIX_FMT_GBRP - -#if AV_HAVE_BIGENDIAN -# define AV_PIX_FMT_NE(be, le) AV_PIX_FMT_##be -#else -# define AV_PIX_FMT_NE(be, le) AV_PIX_FMT_##le -#endif - -#define AV_PIX_FMT_RGB32 AV_PIX_FMT_NE(ARGB, BGRA) -#define AV_PIX_FMT_RGB32_1 AV_PIX_FMT_NE(RGBA, ABGR) -#define AV_PIX_FMT_BGR32 AV_PIX_FMT_NE(ABGR, RGBA) -#define AV_PIX_FMT_BGR32_1 AV_PIX_FMT_NE(BGRA, ARGB) -#define AV_PIX_FMT_0RGB32 AV_PIX_FMT_NE(0RGB, BGR0) -#define AV_PIX_FMT_0BGR32 AV_PIX_FMT_NE(0BGR, RGB0) - -#define AV_PIX_FMT_GRAY16 AV_PIX_FMT_NE(GRAY16BE, GRAY16LE) -#define AV_PIX_FMT_RGB48 AV_PIX_FMT_NE(RGB48BE, RGB48LE) -#define AV_PIX_FMT_RGB565 AV_PIX_FMT_NE(RGB565BE, RGB565LE) -#define AV_PIX_FMT_RGB555 AV_PIX_FMT_NE(RGB555BE, RGB555LE) -#define AV_PIX_FMT_RGB444 AV_PIX_FMT_NE(RGB444BE, RGB444LE) -#define AV_PIX_FMT_RGBA64 AV_PIX_FMT_NE(RGBA64BE, RGBA64LE) -#define AV_PIX_FMT_BGR48 AV_PIX_FMT_NE(BGR48BE, BGR48LE) -#define AV_PIX_FMT_BGR565 AV_PIX_FMT_NE(BGR565BE, BGR565LE) -#define AV_PIX_FMT_BGR555 AV_PIX_FMT_NE(BGR555BE, BGR555LE) -#define AV_PIX_FMT_BGR444 AV_PIX_FMT_NE(BGR444BE, BGR444LE) -#define AV_PIX_FMT_BGRA64 AV_PIX_FMT_NE(BGRA64BE, BGRA64LE) - -#define AV_PIX_FMT_YUV420P9 AV_PIX_FMT_NE(YUV420P9BE , YUV420P9LE) -#define AV_PIX_FMT_YUV422P9 AV_PIX_FMT_NE(YUV422P9BE , YUV422P9LE) -#define AV_PIX_FMT_YUV444P9 AV_PIX_FMT_NE(YUV444P9BE , YUV444P9LE) -#define AV_PIX_FMT_YUV420P10 AV_PIX_FMT_NE(YUV420P10BE, YUV420P10LE) -#define AV_PIX_FMT_YUV422P10 AV_PIX_FMT_NE(YUV422P10BE, YUV422P10LE) -#define AV_PIX_FMT_YUV444P10 AV_PIX_FMT_NE(YUV444P10BE, YUV444P10LE) -#define AV_PIX_FMT_YUV420P12 AV_PIX_FMT_NE(YUV420P12BE, YUV420P12LE) -#define AV_PIX_FMT_YUV422P12 AV_PIX_FMT_NE(YUV422P12BE, YUV422P12LE) -#define AV_PIX_FMT_YUV444P12 AV_PIX_FMT_NE(YUV444P12BE, YUV444P12LE) -#define AV_PIX_FMT_YUV420P14 AV_PIX_FMT_NE(YUV420P14BE, YUV420P14LE) -#define AV_PIX_FMT_YUV422P14 AV_PIX_FMT_NE(YUV422P14BE, YUV422P14LE) -#define AV_PIX_FMT_YUV444P14 AV_PIX_FMT_NE(YUV444P14BE, YUV444P14LE) -#define AV_PIX_FMT_YUV420P16 AV_PIX_FMT_NE(YUV420P16BE, YUV420P16LE) -#define AV_PIX_FMT_YUV422P16 AV_PIX_FMT_NE(YUV422P16BE, YUV422P16LE) -#define AV_PIX_FMT_YUV444P16 AV_PIX_FMT_NE(YUV444P16BE, YUV444P16LE) - -#define AV_PIX_FMT_GBRP9 AV_PIX_FMT_NE(GBRP9BE , GBRP9LE) -#define AV_PIX_FMT_GBRP10 AV_PIX_FMT_NE(GBRP10BE, GBRP10LE) -#define AV_PIX_FMT_GBRP12 AV_PIX_FMT_NE(GBRP12BE, GBRP12LE) -#define AV_PIX_FMT_GBRP14 AV_PIX_FMT_NE(GBRP14BE, GBRP14LE) -#define AV_PIX_FMT_GBRP16 AV_PIX_FMT_NE(GBRP16BE, GBRP16LE) -#define AV_PIX_FMT_GBRAP16 AV_PIX_FMT_NE(GBRAP16BE, GBRAP16LE) - -#define AV_PIX_FMT_BAYER_BGGR16 AV_PIX_FMT_NE(BAYER_BGGR16BE, BAYER_BGGR16LE) -#define AV_PIX_FMT_BAYER_RGGB16 AV_PIX_FMT_NE(BAYER_RGGB16BE, BAYER_RGGB16LE) -#define AV_PIX_FMT_BAYER_GBRG16 AV_PIX_FMT_NE(BAYER_GBRG16BE, BAYER_GBRG16LE) -#define AV_PIX_FMT_BAYER_GRBG16 AV_PIX_FMT_NE(BAYER_GRBG16BE, BAYER_GRBG16LE) - - -#define AV_PIX_FMT_YUVA420P9 AV_PIX_FMT_NE(YUVA420P9BE , YUVA420P9LE) -#define AV_PIX_FMT_YUVA422P9 AV_PIX_FMT_NE(YUVA422P9BE , YUVA422P9LE) -#define AV_PIX_FMT_YUVA444P9 AV_PIX_FMT_NE(YUVA444P9BE , YUVA444P9LE) -#define AV_PIX_FMT_YUVA420P10 AV_PIX_FMT_NE(YUVA420P10BE, YUVA420P10LE) -#define AV_PIX_FMT_YUVA422P10 AV_PIX_FMT_NE(YUVA422P10BE, YUVA422P10LE) -#define AV_PIX_FMT_YUVA444P10 AV_PIX_FMT_NE(YUVA444P10BE, YUVA444P10LE) -#define AV_PIX_FMT_YUVA420P16 AV_PIX_FMT_NE(YUVA420P16BE, YUVA420P16LE) -#define AV_PIX_FMT_YUVA422P16 AV_PIX_FMT_NE(YUVA422P16BE, YUVA422P16LE) -#define AV_PIX_FMT_YUVA444P16 AV_PIX_FMT_NE(YUVA444P16BE, YUVA444P16LE) - -#define AV_PIX_FMT_XYZ12 AV_PIX_FMT_NE(XYZ12BE, XYZ12LE) -#define AV_PIX_FMT_NV20 AV_PIX_FMT_NE(NV20BE, NV20LE) - - -#if FF_API_PIX_FMT -#define PixelFormat AVPixelFormat - -#define PIX_FMT_Y400A AV_PIX_FMT_Y400A -#define PIX_FMT_GBR24P AV_PIX_FMT_GBR24P - -#define PIX_FMT_NE(be, le) AV_PIX_FMT_NE(be, le) - -#define PIX_FMT_RGB32 AV_PIX_FMT_RGB32 -#define PIX_FMT_RGB32_1 AV_PIX_FMT_RGB32_1 -#define PIX_FMT_BGR32 AV_PIX_FMT_BGR32 -#define PIX_FMT_BGR32_1 AV_PIX_FMT_BGR32_1 -#define PIX_FMT_0RGB32 AV_PIX_FMT_0RGB32 -#define PIX_FMT_0BGR32 AV_PIX_FMT_0BGR32 - -#define PIX_FMT_GRAY16 AV_PIX_FMT_GRAY16 -#define PIX_FMT_RGB48 AV_PIX_FMT_RGB48 -#define PIX_FMT_RGB565 AV_PIX_FMT_RGB565 -#define PIX_FMT_RGB555 AV_PIX_FMT_RGB555 -#define PIX_FMT_RGB444 AV_PIX_FMT_RGB444 -#define PIX_FMT_BGR48 AV_PIX_FMT_BGR48 -#define PIX_FMT_BGR565 AV_PIX_FMT_BGR565 -#define PIX_FMT_BGR555 AV_PIX_FMT_BGR555 -#define PIX_FMT_BGR444 AV_PIX_FMT_BGR444 - -#define PIX_FMT_YUV420P9 AV_PIX_FMT_YUV420P9 -#define PIX_FMT_YUV422P9 AV_PIX_FMT_YUV422P9 -#define PIX_FMT_YUV444P9 AV_PIX_FMT_YUV444P9 -#define PIX_FMT_YUV420P10 AV_PIX_FMT_YUV420P10 -#define PIX_FMT_YUV422P10 AV_PIX_FMT_YUV422P10 -#define PIX_FMT_YUV444P10 AV_PIX_FMT_YUV444P10 -#define PIX_FMT_YUV420P12 AV_PIX_FMT_YUV420P12 -#define PIX_FMT_YUV422P12 AV_PIX_FMT_YUV422P12 -#define PIX_FMT_YUV444P12 AV_PIX_FMT_YUV444P12 -#define PIX_FMT_YUV420P14 AV_PIX_FMT_YUV420P14 -#define PIX_FMT_YUV422P14 AV_PIX_FMT_YUV422P14 -#define PIX_FMT_YUV444P14 AV_PIX_FMT_YUV444P14 -#define PIX_FMT_YUV420P16 AV_PIX_FMT_YUV420P16 -#define PIX_FMT_YUV422P16 AV_PIX_FMT_YUV422P16 -#define PIX_FMT_YUV444P16 AV_PIX_FMT_YUV444P16 - -#define PIX_FMT_RGBA64 AV_PIX_FMT_RGBA64 -#define PIX_FMT_BGRA64 AV_PIX_FMT_BGRA64 -#define PIX_FMT_GBRP9 AV_PIX_FMT_GBRP9 -#define PIX_FMT_GBRP10 AV_PIX_FMT_GBRP10 -#define PIX_FMT_GBRP12 AV_PIX_FMT_GBRP12 -#define PIX_FMT_GBRP14 AV_PIX_FMT_GBRP14 -#define PIX_FMT_GBRP16 AV_PIX_FMT_GBRP16 -#endif - -#endif /* AVUTIL_PIXFMT_H */ diff --git a/dji_sdk_manifold_read_cam/include/libavutil/random_seed.h b/dji_sdk_manifold_read_cam/include/libavutil/random_seed.h deleted file mode 100644 index 0462a04..0000000 --- a/dji_sdk_manifold_read_cam/include/libavutil/random_seed.h +++ /dev/null @@ -1,43 +0,0 @@ -/* - * Copyright (c) 2009 Baptiste Coudurier - * - * This file is part of FFmpeg. - * - * FFmpeg is free software; you can redistribute it and/or - * modify it under the terms of the GNU Lesser General Public - * License as published by the Free Software Foundation; either - * version 2.1 of the License, or (at your option) any later version. - * - * FFmpeg is distributed in the hope that it will be useful, - * but WITHOUT ANY WARRANTY; without even the implied warranty of - * MERCHANTABILITY or FITNESS FOR A PARTICULAR PURPOSE. See the GNU - * Lesser General Public License for more details. - * - * You should have received a copy of the GNU Lesser General Public - * License along with FFmpeg; if not, write to the Free Software - * Foundation, Inc., 51 Franklin Street, Fifth Floor, Boston, MA 02110-1301 USA - */ - -#ifndef AVUTIL_RANDOM_SEED_H -#define AVUTIL_RANDOM_SEED_H - -#include -/** - * @addtogroup lavu_crypto - * @{ - */ - -/** - * Get a seed to use in conjunction with random functions. - * This function tries to provide a good seed at a best effort bases. - * Its possible to call this function multiple times if more bits are needed. - * It can be quite slow, which is why it should only be used as seed for a faster - * PRNG. The quality of the seed depends on the platform. - */ -uint32_t av_get_random_seed(void); - -/** - * @} - */ - -#endif /* AVUTIL_RANDOM_SEED_H */ diff --git a/dji_sdk_manifold_read_cam/include/libavutil/rational.h b/dji_sdk_manifold_read_cam/include/libavutil/rational.h deleted file mode 100644 index 7439701..0000000 --- a/dji_sdk_manifold_read_cam/include/libavutil/rational.h +++ /dev/null @@ -1,166 +0,0 @@ -/* - * rational numbers - * Copyright (c) 2003 Michael Niedermayer - * - * This file is part of FFmpeg. - * - * FFmpeg is free software; you can redistribute it and/or - * modify it under the terms of the GNU Lesser General Public - * License as published by the Free Software Foundation; either - * version 2.1 of the License, or (at your option) any later version. - * - * FFmpeg is distributed in the hope that it will be useful, - * but WITHOUT ANY WARRANTY; without even the implied warranty of - * MERCHANTABILITY or FITNESS FOR A PARTICULAR PURPOSE. See the GNU - * Lesser General Public License for more details. - * - * You should have received a copy of the GNU Lesser General Public - * License along with FFmpeg; if not, write to the Free Software - * Foundation, Inc., 51 Franklin Street, Fifth Floor, Boston, MA 02110-1301 USA - */ - -/** - * @file - * rational numbers - * @author Michael Niedermayer - */ - -#ifndef AVUTIL_RATIONAL_H -#define AVUTIL_RATIONAL_H - -#include -#include -#include "attributes.h" - -/** - * @addtogroup lavu_math - * @{ - */ - -/** - * rational number numerator/denominator - */ -typedef struct AVRational{ - int num; ///< numerator - int den; ///< denominator -} AVRational; - -/** - * Create a rational. - * Useful for compilers that do not support compound literals. - * @note The return value is not reduced. - */ -static inline AVRational av_make_q(int num, int den) -{ - AVRational r = { num, den }; - return r; -} - -/** - * Compare two rationals. - * @param a first rational - * @param b second rational - * @return 0 if a==b, 1 if a>b, -1 if a>63)|1; - else if(b.den && a.den) return 0; - else if(a.num && b.num) return (a.num>>31) - (b.num>>31); - else return INT_MIN; -} - -/** - * Convert rational to double. - * @param a rational to convert - * @return (double) a - */ -static inline double av_q2d(AVRational a){ - return a.num / (double) a.den; -} - -/** - * Reduce a fraction. - * This is useful for framerate calculations. - * @param dst_num destination numerator - * @param dst_den destination denominator - * @param num source numerator - * @param den source denominator - * @param max the maximum allowed for dst_num & dst_den - * @return 1 if exact, 0 otherwise - */ -int av_reduce(int *dst_num, int *dst_den, int64_t num, int64_t den, int64_t max); - -/** - * Multiply two rationals. - * @param b first rational - * @param c second rational - * @return b*c - */ -AVRational av_mul_q(AVRational b, AVRational c) av_const; - -/** - * Divide one rational by another. - * @param b first rational - * @param c second rational - * @return b/c - */ -AVRational av_div_q(AVRational b, AVRational c) av_const; - -/** - * Add two rationals. - * @param b first rational - * @param c second rational - * @return b+c - */ -AVRational av_add_q(AVRational b, AVRational c) av_const; - -/** - * Subtract one rational from another. - * @param b first rational - * @param c second rational - * @return b-c - */ -AVRational av_sub_q(AVRational b, AVRational c) av_const; - -/** - * Invert a rational. - * @param q value - * @return 1 / q - */ -static av_always_inline AVRational av_inv_q(AVRational q) -{ - AVRational r = { q.den, q.num }; - return r; -} - -/** - * Convert a double precision floating point number to a rational. - * inf is expressed as {1,0} or {-1,0} depending on the sign. - * - * @param d double to convert - * @param max the maximum allowed numerator and denominator - * @return (AVRational) d - */ -AVRational av_d2q(double d, int max) av_const; - -/** - * @return 1 if q1 is nearer to q than q2, -1 if q2 is nearer - * than q1, 0 if they have the same distance. - */ -int av_nearer_q(AVRational q, AVRational q1, AVRational q2); - -/** - * Find the nearest value in q_list to q. - * @param q_list an array of rationals terminated by {0, 0} - * @return the index of the nearest value found in the array - */ -int av_find_nearest_q_idx(AVRational q, const AVRational* q_list); - -/** - * @} - */ - -#endif /* AVUTIL_RATIONAL_H */ diff --git a/dji_sdk_manifold_read_cam/include/libavutil/replaygain.h b/dji_sdk_manifold_read_cam/include/libavutil/replaygain.h deleted file mode 100644 index 5c03e19..0000000 --- a/dji_sdk_manifold_read_cam/include/libavutil/replaygain.h +++ /dev/null @@ -1,51 +0,0 @@ -/* - * - * This file is part of FFmpeg. - * - * FFmpeg is free software; you can redistribute it and/or - * modify it under the terms of the GNU Lesser General Public - * License as published by the Free Software Foundation; either - * version 2.1 of the License, or (at your option) any later version. - * - * FFmpeg is distributed in the hope that it will be useful, - * but WITHOUT ANY WARRANTY; without even the implied warranty of - * MERCHANTABILITY or FITNESS FOR A PARTICULAR PURPOSE. See the GNU - * Lesser General Public License for more details. - * - * You should have received a copy of the GNU Lesser General Public - * License along with FFmpeg; if not, write to the Free Software - * Foundation, Inc., 51 Franklin Street, Fifth Floor, Boston, MA 02110-1301 USA - */ - -#ifndef AVUTIL_REPLAYGAIN_H -#define AVUTIL_REPLAYGAIN_H - -#include - -/** - * ReplayGain information (see - * http://wiki.hydrogenaudio.org/index.php?title=ReplayGain_1.0_specification). - * The size of this struct is a part of the public ABI. - */ -typedef struct AVReplayGain { - /** - * Track replay gain in microbels (divide by 100000 to get the value in dB). - * Should be set to INT32_MIN when unknown. - */ - int32_t track_gain; - /** - * Peak track amplitude, with 100000 representing full scale (but values - * may overflow). 0 when unknown. - */ - uint32_t track_peak; - /** - * Same as track_gain, but for the whole album. - */ - int32_t album_gain; - /** - * Same as track_peak, but for the whole album, - */ - uint32_t album_peak; -} AVReplayGain; - -#endif /* AVUTIL_REPLAYGAIN_H */ diff --git a/dji_sdk_manifold_read_cam/include/libavutil/ripemd.h b/dji_sdk_manifold_read_cam/include/libavutil/ripemd.h deleted file mode 100644 index 7b0c8bc..0000000 --- a/dji_sdk_manifold_read_cam/include/libavutil/ripemd.h +++ /dev/null @@ -1,75 +0,0 @@ -/* - * Copyright (C) 2007 Michael Niedermayer - * Copyright (C) 2013 James Almer - * - * This file is part of FFmpeg. - * - * FFmpeg is free software; you can redistribute it and/or - * modify it under the terms of the GNU Lesser General Public - * License as published by the Free Software Foundation; either - * version 2.1 of the License, or (at your option) any later version. - * - * FFmpeg is distributed in the hope that it will be useful, - * but WITHOUT ANY WARRANTY; without even the implied warranty of - * MERCHANTABILITY or FITNESS FOR A PARTICULAR PURPOSE. See the GNU - * Lesser General Public License for more details. - * - * You should have received a copy of the GNU Lesser General Public - * License along with FFmpeg; if not, write to the Free Software - * Foundation, Inc., 51 Franklin Street, Fifth Floor, Boston, MA 02110-1301 USA - */ - -#ifndef AVUTIL_RIPEMD_H -#define AVUTIL_RIPEMD_H - -#include - -#include "attributes.h" -#include "version.h" - -/** - * @defgroup lavu_ripemd RIPEMD - * @ingroup lavu_crypto - * @{ - */ - -extern const int av_ripemd_size; - -struct AVRIPEMD; - -/** - * Allocate an AVRIPEMD context. - */ -struct AVRIPEMD *av_ripemd_alloc(void); - -/** - * Initialize RIPEMD hashing. - * - * @param context pointer to the function context (of size av_ripemd_size) - * @param bits number of bits in digest (128, 160, 256 or 320 bits) - * @return zero if initialization succeeded, -1 otherwise - */ -int av_ripemd_init(struct AVRIPEMD* context, int bits); - -/** - * Update hash value. - * - * @param context hash function context - * @param data input data to update hash with - * @param len input data length - */ -void av_ripemd_update(struct AVRIPEMD* context, const uint8_t* data, unsigned int len); - -/** - * Finish hashing and output digest value. - * - * @param context hash function context - * @param digest buffer where output digest value is stored - */ -void av_ripemd_final(struct AVRIPEMD* context, uint8_t *digest); - -/** - * @} - */ - -#endif /* AVUTIL_RIPEMD_H */ diff --git a/dji_sdk_manifold_read_cam/include/libavutil/samplefmt.h b/dji_sdk_manifold_read_cam/include/libavutil/samplefmt.h deleted file mode 100644 index db17d43..0000000 --- a/dji_sdk_manifold_read_cam/include/libavutil/samplefmt.h +++ /dev/null @@ -1,256 +0,0 @@ -/* - * This file is part of FFmpeg. - * - * FFmpeg is free software; you can redistribute it and/or - * modify it under the terms of the GNU Lesser General Public - * License as published by the Free Software Foundation; either - * version 2.1 of the License, or (at your option) any later version. - * - * FFmpeg is distributed in the hope that it will be useful, - * but WITHOUT ANY WARRANTY; without even the implied warranty of - * MERCHANTABILITY or FITNESS FOR A PARTICULAR PURPOSE. See the GNU - * Lesser General Public License for more details. - * - * You should have received a copy of the GNU Lesser General Public - * License along with FFmpeg; if not, write to the Free Software - * Foundation, Inc., 51 Franklin Street, Fifth Floor, Boston, MA 02110-1301 USA - */ - -#ifndef AVUTIL_SAMPLEFMT_H -#define AVUTIL_SAMPLEFMT_H - -#include - -#include "avutil.h" -#include "attributes.h" - -/** - * Audio Sample Formats - * - * @par - * The data described by the sample format is always in native-endian order. - * Sample values can be expressed by native C types, hence the lack of a signed - * 24-bit sample format even though it is a common raw audio data format. - * - * @par - * The floating-point formats are based on full volume being in the range - * [-1.0, 1.0]. Any values outside this range are beyond full volume level. - * - * @par - * The data layout as used in av_samples_fill_arrays() and elsewhere in FFmpeg - * (such as AVFrame in libavcodec) is as follows: - * - * For planar sample formats, each audio channel is in a separate data plane, - * and linesize is the buffer size, in bytes, for a single plane. All data - * planes must be the same size. For packed sample formats, only the first data - * plane is used, and samples for each channel are interleaved. In this case, - * linesize is the buffer size, in bytes, for the 1 plane. - */ -enum AVSampleFormat { - AV_SAMPLE_FMT_NONE = -1, - AV_SAMPLE_FMT_U8, ///< unsigned 8 bits - AV_SAMPLE_FMT_S16, ///< signed 16 bits - AV_SAMPLE_FMT_S32, ///< signed 32 bits - AV_SAMPLE_FMT_FLT, ///< float - AV_SAMPLE_FMT_DBL, ///< double - - AV_SAMPLE_FMT_U8P, ///< unsigned 8 bits, planar - AV_SAMPLE_FMT_S16P, ///< signed 16 bits, planar - AV_SAMPLE_FMT_S32P, ///< signed 32 bits, planar - AV_SAMPLE_FMT_FLTP, ///< float, planar - AV_SAMPLE_FMT_DBLP, ///< double, planar - - AV_SAMPLE_FMT_NB ///< Number of sample formats. DO NOT USE if linking dynamically -}; - -/** - * Return the name of sample_fmt, or NULL if sample_fmt is not - * recognized. - */ -const char *av_get_sample_fmt_name(enum AVSampleFormat sample_fmt); - -/** - * Return a sample format corresponding to name, or AV_SAMPLE_FMT_NONE - * on error. - */ -enum AVSampleFormat av_get_sample_fmt(const char *name); - -/** - * Return the planar<->packed alternative form of the given sample format, or - * AV_SAMPLE_FMT_NONE on error. If the passed sample_fmt is already in the - * requested planar/packed format, the format returned is the same as the - * input. - */ -enum AVSampleFormat av_get_alt_sample_fmt(enum AVSampleFormat sample_fmt, int planar); - -/** - * Get the packed alternative form of the given sample format. - * - * If the passed sample_fmt is already in packed format, the format returned is - * the same as the input. - * - * @return the packed alternative form of the given sample format or - AV_SAMPLE_FMT_NONE on error. - */ -enum AVSampleFormat av_get_packed_sample_fmt(enum AVSampleFormat sample_fmt); - -/** - * Get the planar alternative form of the given sample format. - * - * If the passed sample_fmt is already in planar format, the format returned is - * the same as the input. - * - * @return the planar alternative form of the given sample format or - AV_SAMPLE_FMT_NONE on error. - */ -enum AVSampleFormat av_get_planar_sample_fmt(enum AVSampleFormat sample_fmt); - -/** - * Generate a string corresponding to the sample format with - * sample_fmt, or a header if sample_fmt is negative. - * - * @param buf the buffer where to write the string - * @param buf_size the size of buf - * @param sample_fmt the number of the sample format to print the - * corresponding info string, or a negative value to print the - * corresponding header. - * @return the pointer to the filled buffer or NULL if sample_fmt is - * unknown or in case of other errors - */ -char *av_get_sample_fmt_string(char *buf, int buf_size, enum AVSampleFormat sample_fmt); - -#if FF_API_GET_BITS_PER_SAMPLE_FMT -/** - * @deprecated Use av_get_bytes_per_sample() instead. - */ -attribute_deprecated -int av_get_bits_per_sample_fmt(enum AVSampleFormat sample_fmt); -#endif - -/** - * Return number of bytes per sample. - * - * @param sample_fmt the sample format - * @return number of bytes per sample or zero if unknown for the given - * sample format - */ -int av_get_bytes_per_sample(enum AVSampleFormat sample_fmt); - -/** - * Check if the sample format is planar. - * - * @param sample_fmt the sample format to inspect - * @return 1 if the sample format is planar, 0 if it is interleaved - */ -int av_sample_fmt_is_planar(enum AVSampleFormat sample_fmt); - -/** - * Get the required buffer size for the given audio parameters. - * - * @param[out] linesize calculated linesize, may be NULL - * @param nb_channels the number of channels - * @param nb_samples the number of samples in a single channel - * @param sample_fmt the sample format - * @param align buffer size alignment (0 = default, 1 = no alignment) - * @return required buffer size, or negative error code on failure - */ -int av_samples_get_buffer_size(int *linesize, int nb_channels, int nb_samples, - enum AVSampleFormat sample_fmt, int align); - -/** - * Fill plane data pointers and linesize for samples with sample - * format sample_fmt. - * - * The audio_data array is filled with the pointers to the samples data planes: - * for planar, set the start point of each channel's data within the buffer, - * for packed, set the start point of the entire buffer only. - * - * The value pointed to by linesize is set to the aligned size of each - * channel's data buffer for planar layout, or to the aligned size of the - * buffer for all channels for packed layout. - * - * The buffer in buf must be big enough to contain all the samples - * (use av_samples_get_buffer_size() to compute its minimum size), - * otherwise the audio_data pointers will point to invalid data. - * - * @see enum AVSampleFormat - * The documentation for AVSampleFormat describes the data layout. - * - * @param[out] audio_data array to be filled with the pointer for each channel - * @param[out] linesize calculated linesize, may be NULL - * @param buf the pointer to a buffer containing the samples - * @param nb_channels the number of channels - * @param nb_samples the number of samples in a single channel - * @param sample_fmt the sample format - * @param align buffer size alignment (0 = default, 1 = no alignment) - * @return >=0 on success or a negative error code on failure - * @todo return minimum size in bytes required for the buffer in case - * of success at the next bump - */ -int av_samples_fill_arrays(uint8_t **audio_data, int *linesize, - const uint8_t *buf, - int nb_channels, int nb_samples, - enum AVSampleFormat sample_fmt, int align); - -/** - * Allocate a samples buffer for nb_samples samples, and fill data pointers and - * linesize accordingly. - * The allocated samples buffer can be freed by using av_freep(&audio_data[0]) - * Allocated data will be initialized to silence. - * - * @see enum AVSampleFormat - * The documentation for AVSampleFormat describes the data layout. - * - * @param[out] audio_data array to be filled with the pointer for each channel - * @param[out] linesize aligned size for audio buffer(s), may be NULL - * @param nb_channels number of audio channels - * @param nb_samples number of samples per channel - * @param align buffer size alignment (0 = default, 1 = no alignment) - * @return >=0 on success or a negative error code on failure - * @todo return the size of the allocated buffer in case of success at the next bump - * @see av_samples_fill_arrays() - * @see av_samples_alloc_array_and_samples() - */ -int av_samples_alloc(uint8_t **audio_data, int *linesize, int nb_channels, - int nb_samples, enum AVSampleFormat sample_fmt, int align); - -/** - * Allocate a data pointers array, samples buffer for nb_samples - * samples, and fill data pointers and linesize accordingly. - * - * This is the same as av_samples_alloc(), but also allocates the data - * pointers array. - * - * @see av_samples_alloc() - */ -int av_samples_alloc_array_and_samples(uint8_t ***audio_data, int *linesize, int nb_channels, - int nb_samples, enum AVSampleFormat sample_fmt, int align); - -/** - * Copy samples from src to dst. - * - * @param dst destination array of pointers to data planes - * @param src source array of pointers to data planes - * @param dst_offset offset in samples at which the data will be written to dst - * @param src_offset offset in samples at which the data will be read from src - * @param nb_samples number of samples to be copied - * @param nb_channels number of audio channels - * @param sample_fmt audio sample format - */ -int av_samples_copy(uint8_t **dst, uint8_t * const *src, int dst_offset, - int src_offset, int nb_samples, int nb_channels, - enum AVSampleFormat sample_fmt); - -/** - * Fill an audio buffer with silence. - * - * @param audio_data array of pointers to data planes - * @param offset offset in samples at which to start filling - * @param nb_samples number of samples to fill - * @param nb_channels number of audio channels - * @param sample_fmt audio sample format - */ -int av_samples_set_silence(uint8_t **audio_data, int offset, int nb_samples, - int nb_channels, enum AVSampleFormat sample_fmt); - -#endif /* AVUTIL_SAMPLEFMT_H */ diff --git a/dji_sdk_manifold_read_cam/include/libavutil/sha.h b/dji_sdk_manifold_read_cam/include/libavutil/sha.h deleted file mode 100644 index bf4377e..0000000 --- a/dji_sdk_manifold_read_cam/include/libavutil/sha.h +++ /dev/null @@ -1,74 +0,0 @@ -/* - * Copyright (C) 2007 Michael Niedermayer - * - * This file is part of FFmpeg. - * - * FFmpeg is free software; you can redistribute it and/or - * modify it under the terms of the GNU Lesser General Public - * License as published by the Free Software Foundation; either - * version 2.1 of the License, or (at your option) any later version. - * - * FFmpeg is distributed in the hope that it will be useful, - * but WITHOUT ANY WARRANTY; without even the implied warranty of - * MERCHANTABILITY or FITNESS FOR A PARTICULAR PURPOSE. See the GNU - * Lesser General Public License for more details. - * - * You should have received a copy of the GNU Lesser General Public - * License along with FFmpeg; if not, write to the Free Software - * Foundation, Inc., 51 Franklin Street, Fifth Floor, Boston, MA 02110-1301 USA - */ - -#ifndef AVUTIL_SHA_H -#define AVUTIL_SHA_H - -#include - -#include "attributes.h" -#include "version.h" - -/** - * @defgroup lavu_sha SHA - * @ingroup lavu_crypto - * @{ - */ - -extern const int av_sha_size; - -struct AVSHA; - -/** - * Allocate an AVSHA context. - */ -struct AVSHA *av_sha_alloc(void); - -/** - * Initialize SHA-1 or SHA-2 hashing. - * - * @param context pointer to the function context (of size av_sha_size) - * @param bits number of bits in digest (SHA-1 - 160 bits, SHA-2 224 or 256 bits) - * @return zero if initialization succeeded, -1 otherwise - */ -int av_sha_init(struct AVSHA* context, int bits); - -/** - * Update hash value. - * - * @param context hash function context - * @param data input data to update hash with - * @param len input data length - */ -void av_sha_update(struct AVSHA* context, const uint8_t* data, unsigned int len); - -/** - * Finish hashing and output digest value. - * - * @param context hash function context - * @param digest buffer where output digest value is stored - */ -void av_sha_final(struct AVSHA* context, uint8_t *digest); - -/** - * @} - */ - -#endif /* AVUTIL_SHA_H */ diff --git a/dji_sdk_manifold_read_cam/include/libavutil/sha512.h b/dji_sdk_manifold_read_cam/include/libavutil/sha512.h deleted file mode 100644 index 7b08701..0000000 --- a/dji_sdk_manifold_read_cam/include/libavutil/sha512.h +++ /dev/null @@ -1,75 +0,0 @@ -/* - * Copyright (C) 2007 Michael Niedermayer - * Copyright (C) 2013 James Almer - * - * This file is part of FFmpeg. - * - * FFmpeg is free software; you can redistribute it and/or - * modify it under the terms of the GNU Lesser General Public - * License as published by the Free Software Foundation; either - * version 2.1 of the License, or (at your option) any later version. - * - * FFmpeg is distributed in the hope that it will be useful, - * but WITHOUT ANY WARRANTY; without even the implied warranty of - * MERCHANTABILITY or FITNESS FOR A PARTICULAR PURPOSE. See the GNU - * Lesser General Public License for more details. - * - * You should have received a copy of the GNU Lesser General Public - * License along with FFmpeg; if not, write to the Free Software - * Foundation, Inc., 51 Franklin Street, Fifth Floor, Boston, MA 02110-1301 USA - */ - -#ifndef AVUTIL_SHA512_H -#define AVUTIL_SHA512_H - -#include - -#include "attributes.h" -#include "version.h" - -/** - * @defgroup lavu_sha512 SHA512 - * @ingroup lavu_crypto - * @{ - */ - -extern const int av_sha512_size; - -struct AVSHA512; - -/** - * Allocate an AVSHA512 context. - */ -struct AVSHA512 *av_sha512_alloc(void); - -/** - * Initialize SHA-2 512 hashing. - * - * @param context pointer to the function context (of size av_sha512_size) - * @param bits number of bits in digest (224, 256, 384 or 512 bits) - * @return zero if initialization succeeded, -1 otherwise - */ -int av_sha512_init(struct AVSHA512* context, int bits); - -/** - * Update hash value. - * - * @param context hash function context - * @param data input data to update hash with - * @param len input data length - */ -void av_sha512_update(struct AVSHA512* context, const uint8_t* data, unsigned int len); - -/** - * Finish hashing and output digest value. - * - * @param context hash function context - * @param digest buffer where output digest value is stored - */ -void av_sha512_final(struct AVSHA512* context, uint8_t *digest); - -/** - * @} - */ - -#endif /* AVUTIL_SHA512_H */ diff --git a/dji_sdk_manifold_read_cam/include/libavutil/stereo3d.h b/dji_sdk_manifold_read_cam/include/libavutil/stereo3d.h deleted file mode 100644 index 8829da9..0000000 --- a/dji_sdk_manifold_read_cam/include/libavutil/stereo3d.h +++ /dev/null @@ -1,147 +0,0 @@ -/* - * Copyright (c) 2013 Vittorio Giovara - * - * This file is part of FFmpeg. - * - * FFmpeg is free software; you can redistribute it and/or - * modify it under the terms of the GNU Lesser General Public - * License as published by the Free Software Foundation; either - * version 2.1 of the License, or (at your option) any later version. - * - * FFmpeg is distributed in the hope that it will be useful, - * but WITHOUT ANY WARRANTY; without even the implied warranty of - * MERCHANTABILITY or FITNESS FOR A PARTICULAR PURPOSE. See the GNU - * Lesser General Public License for more details. - * - * You should have received a copy of the GNU Lesser General Public - * License along with FFmpeg; if not, write to the Free Software - * Foundation, Inc., 51 Franklin Street, Fifth Floor, Boston, MA 02110-1301 USA - */ - -#include - -#include "frame.h" - -/** - * List of possible 3D Types - */ -enum AVStereo3DType { - /** - * Video is not stereoscopic (and metadata has to be there). - */ - AV_STEREO3D_2D, - - /** - * Views are next to each other. - * - * LLLLRRRR - * LLLLRRRR - * LLLLRRRR - * ... - */ - AV_STEREO3D_SIDEBYSIDE, - - /** - * Views are on top of each other. - * - * LLLLLLLL - * LLLLLLLL - * RRRRRRRR - * RRRRRRRR - */ - AV_STEREO3D_TOPBOTTOM, - - /** - * Views are alternated temporally. - * - * frame0 frame1 frame2 ... - * LLLLLLLL RRRRRRRR LLLLLLLL - * LLLLLLLL RRRRRRRR LLLLLLLL - * LLLLLLLL RRRRRRRR LLLLLLLL - * ... ... ... - */ - AV_STEREO3D_FRAMESEQUENCE, - - /** - * Views are packed in a checkerboard-like structure per pixel. - * - * LRLRLRLR - * RLRLRLRL - * LRLRLRLR - * ... - */ - AV_STEREO3D_CHECKERBOARD, - - /** - * Views are next to each other, but when upscaling - * apply a checkerboard pattern. - * - * LLLLRRRR L L L L R R R R - * LLLLRRRR => L L L L R R R R - * LLLLRRRR L L L L R R R R - * LLLLRRRR L L L L R R R R - */ - AV_STEREO3D_SIDEBYSIDE_QUINCUNX, - - /** - * Views are packed per line, as if interlaced. - * - * LLLLLLLL - * RRRRRRRR - * LLLLLLLL - * ... - */ - AV_STEREO3D_LINES, - - /** - * Views are packed per column. - * - * LRLRLRLR - * LRLRLRLR - * LRLRLRLR - * ... - */ - AV_STEREO3D_COLUMNS, -}; - - -/** - * Inverted views, Right/Bottom represents the left view. - */ -#define AV_STEREO3D_FLAG_INVERT (1 << 0) - -/** - * Stereo 3D type: this structure describes how two videos are packed - * within a single video surface, with additional information as needed. - * - * @note The struct must be allocated with av_stereo3d_alloc() and - * its size is not a part of the public ABI. - */ -typedef struct AVStereo3D { - /** - * How views are packed within the video. - */ - enum AVStereo3DType type; - - /** - * Additional information about the frame packing. - */ - int flags; -} AVStereo3D; - -/** - * Allocate an AVStereo3D structure and set its fields to default values. - * The resulting struct can be freed using av_freep(). - * - * @return An AVStereo3D filled with default values or NULL on failure. - */ -AVStereo3D *av_stereo3d_alloc(void); - -/** - * Allocate a complete AVFrameSideData and add it to the frame. - * - * @param frame The frame which side data is added to. - * - * @return The AVStereo3D structure to be filled by caller. - */ -AVStereo3D *av_stereo3d_create_side_data(AVFrame *frame); diff --git a/dji_sdk_manifold_read_cam/include/libavutil/time.h b/dji_sdk_manifold_read_cam/include/libavutil/time.h deleted file mode 100644 index 90eb436..0000000 --- a/dji_sdk_manifold_read_cam/include/libavutil/time.h +++ /dev/null @@ -1,41 +0,0 @@ -/* - * Copyright (c) 2000-2003 Fabrice Bellard - * - * This file is part of FFmpeg. - * - * FFmpeg is free software; you can redistribute it and/or - * modify it under the terms of the GNU Lesser General Public - * License as published by the Free Software Foundation; either - * version 2.1 of the License, or (at your option) any later version. - * - * FFmpeg is distributed in the hope that it will be useful, - * but WITHOUT ANY WARRANTY; without even the implied warranty of - * MERCHANTABILITY or FITNESS FOR A PARTICULAR PURPOSE. See the GNU - * Lesser General Public License for more details. - * - * You should have received a copy of the GNU Lesser General Public - * License along with FFmpeg; if not, write to the Free Software - * Foundation, Inc., 51 Franklin Street, Fifth Floor, Boston, MA 02110-1301 USA - */ - -#ifndef AVUTIL_TIME_H -#define AVUTIL_TIME_H - -#include - -/** - * Get the current time in microseconds. - */ -int64_t av_gettime(void); - -/** - * Sleep for a period of time. Although the duration is expressed in - * microseconds, the actual delay may be rounded to the precision of the - * system timer. - * - * @param usec Number of microseconds to sleep. - * @return zero on success or (negative) error code. - */ -int av_usleep(unsigned usec); - -#endif /* AVUTIL_TIME_H */ diff --git a/dji_sdk_manifold_read_cam/include/libavutil/timecode.h b/dji_sdk_manifold_read_cam/include/libavutil/timecode.h deleted file mode 100644 index 56e3975..0000000 --- a/dji_sdk_manifold_read_cam/include/libavutil/timecode.h +++ /dev/null @@ -1,140 +0,0 @@ -/* - * Copyright (c) 2006 Smartjog S.A.S, Baptiste Coudurier - * Copyright (c) 2011-2012 Smartjog S.A.S, Clément Bœsch - * - * This file is part of FFmpeg. - * - * FFmpeg is free software; you can redistribute it and/or - * modify it under the terms of the GNU Lesser General Public - * License as published by the Free Software Foundation; either - * version 2.1 of the License, or (at your option) any later version. - * - * FFmpeg is distributed in the hope that it will be useful, - * but WITHOUT ANY WARRANTY; without even the implied warranty of - * MERCHANTABILITY or FITNESS FOR A PARTICULAR PURPOSE. See the GNU - * Lesser General Public License for more details. - * - * You should have received a copy of the GNU Lesser General Public - * License along with FFmpeg; if not, write to the Free Software - * Foundation, Inc., 51 Franklin Street, Fifth Floor, Boston, MA 02110-1301 USA - */ - -/** - * @file - * Timecode helpers header - */ - -#ifndef AVUTIL_TIMECODE_H -#define AVUTIL_TIMECODE_H - -#include -#include "rational.h" - -#define AV_TIMECODE_STR_SIZE 16 - -enum AVTimecodeFlag { - AV_TIMECODE_FLAG_DROPFRAME = 1<<0, ///< timecode is drop frame - AV_TIMECODE_FLAG_24HOURSMAX = 1<<1, ///< timecode wraps after 24 hours - AV_TIMECODE_FLAG_ALLOWNEGATIVE = 1<<2, ///< negative time values are allowed -}; - -typedef struct { - int start; ///< timecode frame start (first base frame number) - uint32_t flags; ///< flags such as drop frame, +24 hours support, ... - AVRational rate; ///< frame rate in rational form - unsigned fps; ///< frame per second; must be consistent with the rate field -} AVTimecode; - -/** - * Adjust frame number for NTSC drop frame time code. - * - * @param framenum frame number to adjust - * @param fps frame per second, 30 or 60 - * @return adjusted frame number - * @warning adjustment is only valid in NTSC 29.97 and 59.94 - */ -int av_timecode_adjust_ntsc_framenum2(int framenum, int fps); - -/** - * Convert frame number to SMPTE 12M binary representation. - * - * @param tc timecode data correctly initialized - * @param framenum frame number - * @return the SMPTE binary representation - * - * @note Frame number adjustment is automatically done in case of drop timecode, - * you do NOT have to call av_timecode_adjust_ntsc_framenum2(). - * @note The frame number is relative to tc->start. - * @note Color frame (CF), binary group flags (BGF) and biphase mark polarity - * correction (PC) bits are set to zero. - */ -uint32_t av_timecode_get_smpte_from_framenum(const AVTimecode *tc, int framenum); - -/** - * Load timecode string in buf. - * - * @param buf destination buffer, must be at least AV_TIMECODE_STR_SIZE long - * @param tc timecode data correctly initialized - * @param framenum frame number - * @return the buf parameter - * - * @note Timecode representation can be a negative timecode and have more than - * 24 hours, but will only be honored if the flags are correctly set. - * @note The frame number is relative to tc->start. - */ -char *av_timecode_make_string(const AVTimecode *tc, char *buf, int framenum); - -/** - * Get the timecode string from the SMPTE timecode format. - * - * @param buf destination buffer, must be at least AV_TIMECODE_STR_SIZE long - * @param tcsmpte the 32-bit SMPTE timecode - * @param prevent_df prevent the use of a drop flag when it is known the DF bit - * is arbitrary - * @return the buf parameter - */ -char *av_timecode_make_smpte_tc_string(char *buf, uint32_t tcsmpte, int prevent_df); - -/** - * Get the timecode string from the 25-bit timecode format (MPEG GOP format). - * - * @param buf destination buffer, must be at least AV_TIMECODE_STR_SIZE long - * @param tc25bit the 25-bits timecode - * @return the buf parameter - */ -char *av_timecode_make_mpeg_tc_string(char *buf, uint32_t tc25bit); - -/** - * Init a timecode struct with the passed parameters. - * - * @param log_ctx a pointer to an arbitrary struct of which the first field - * is a pointer to an AVClass struct (used for av_log) - * @param tc pointer to an allocated AVTimecode - * @param rate frame rate in rational form - * @param flags miscellaneous flags such as drop frame, +24 hours, ... - * (see AVTimecodeFlag) - * @param frame_start the first frame number - * @return 0 on success, AVERROR otherwise - */ -int av_timecode_init(AVTimecode *tc, AVRational rate, int flags, int frame_start, void *log_ctx); - -/** - * Parse timecode representation (hh:mm:ss[:;.]ff). - * - * @param log_ctx a pointer to an arbitrary struct of which the first field is a - * pointer to an AVClass struct (used for av_log). - * @param tc pointer to an allocated AVTimecode - * @param rate frame rate in rational form - * @param str timecode string which will determine the frame start - * @return 0 on success, AVERROR otherwise - */ -int av_timecode_init_from_string(AVTimecode *tc, AVRational rate, const char *str, void *log_ctx); - -/** - * Check if the timecode feature is available for the given frame rate - * - * @return 0 if supported, <0 otherwise - */ -int av_timecode_check_frame_rate(AVRational rate); - -#endif /* AVUTIL_TIMECODE_H */ diff --git a/dji_sdk_manifold_read_cam/include/libavutil/timestamp.h b/dji_sdk_manifold_read_cam/include/libavutil/timestamp.h deleted file mode 100644 index f010a7e..0000000 --- a/dji_sdk_manifold_read_cam/include/libavutil/timestamp.h +++ /dev/null @@ -1,78 +0,0 @@ -/* - * This file is part of FFmpeg. - * - * FFmpeg is free software; you can redistribute it and/or - * modify it under the terms of the GNU Lesser General Public - * License as published by the Free Software Foundation; either - * version 2.1 of the License, or (at your option) any later version. - * - * FFmpeg is distributed in the hope that it will be useful, - * but WITHOUT ANY WARRANTY; without even the implied warranty of - * MERCHANTABILITY or FITNESS FOR A PARTICULAR PURPOSE. See the GNU - * Lesser General Public License for more details. - * - * You should have received a copy of the GNU Lesser General Public - * License along with FFmpeg; if not, write to the Free Software - * Foundation, Inc., 51 Franklin Street, Fifth Floor, Boston, MA 02110-1301 USA - */ - -/** - * @file - * timestamp utils, mostly useful for debugging/logging purposes - */ - -#ifndef AVUTIL_TIMESTAMP_H -#define AVUTIL_TIMESTAMP_H - -#include "common.h" - -#if defined(__cplusplus) && !defined(__STDC_FORMAT_MACROS) && !defined(PRId64) -#error missing -D__STDC_FORMAT_MACROS / #define __STDC_FORMAT_MACROS -#endif - -#define AV_TS_MAX_STRING_SIZE 32 - -/** - * Fill the provided buffer with a string containing a timestamp - * representation. - * - * @param buf a buffer with size in bytes of at least AV_TS_MAX_STRING_SIZE - * @param ts the timestamp to represent - * @return the buffer in input - */ -static inline char *av_ts_make_string(char *buf, int64_t ts) -{ - if (ts == AV_NOPTS_VALUE) snprintf(buf, AV_TS_MAX_STRING_SIZE, "NOPTS"); - else snprintf(buf, AV_TS_MAX_STRING_SIZE, "%"PRId64, ts); - return buf; -} - -/** - * Convenience macro, the return value should be used only directly in - * function arguments but never stand-alone. - */ -#define av_ts2str(ts) av_ts_make_string((char[AV_TS_MAX_STRING_SIZE]){0}, ts) - -/** - * Fill the provided buffer with a string containing a timestamp time - * representation. - * - * @param buf a buffer with size in bytes of at least AV_TS_MAX_STRING_SIZE - * @param ts the timestamp to represent - * @param tb the timebase of the timestamp - * @return the buffer in input - */ -static inline char *av_ts_make_time_string(char *buf, int64_t ts, AVRational *tb) -{ - if (ts == AV_NOPTS_VALUE) snprintf(buf, AV_TS_MAX_STRING_SIZE, "NOPTS"); - else snprintf(buf, AV_TS_MAX_STRING_SIZE, "%.6g", av_q2d(*tb) * ts); - return buf; -} - -/** - * Convenience macro, the return value should be used only directly in - * function arguments but never stand-alone. - */ -#define av_ts2timestr(ts, tb) av_ts_make_time_string((char[AV_TS_MAX_STRING_SIZE]){0}, ts, tb) - -#endif /* AVUTIL_TIMESTAMP_H */ diff --git a/dji_sdk_manifold_read_cam/include/libavutil/version.h b/dji_sdk_manifold_read_cam/include/libavutil/version.h deleted file mode 100644 index 3cb5b66..0000000 --- a/dji_sdk_manifold_read_cam/include/libavutil/version.h +++ /dev/null @@ -1,146 +0,0 @@ -/* - * copyright (c) 2003 Fabrice Bellard - * - * This file is part of FFmpeg. - * - * FFmpeg is free software; you can redistribute it and/or - * modify it under the terms of the GNU Lesser General Public - * License as published by the Free Software Foundation; either - * version 2.1 of the License, or (at your option) any later version. - * - * FFmpeg is distributed in the hope that it will be useful, - * but WITHOUT ANY WARRANTY; without even the implied warranty of - * MERCHANTABILITY or FITNESS FOR A PARTICULAR PURPOSE. See the GNU - * Lesser General Public License for more details. - * - * You should have received a copy of the GNU Lesser General Public - * License along with FFmpeg; if not, write to the Free Software - * Foundation, Inc., 51 Franklin Street, Fifth Floor, Boston, MA 02110-1301 USA - */ - -#ifndef AVUTIL_VERSION_H -#define AVUTIL_VERSION_H - -#include "macros.h" - -/** - * @defgroup version_utils Library Version Macros - * - * Useful to check and match library version in order to maintain - * backward compatibility. - * - * @{ - */ - -#define AV_VERSION_INT(a, b, c) (a<<16 | b<<8 | c) -#define AV_VERSION_DOT(a, b, c) a ##.## b ##.## c -#define AV_VERSION(a, b, c) AV_VERSION_DOT(a, b, c) - -/** - * @} - */ - -/** - * @file - * @ingroup lavu - * Libavutil version macros - */ - -/** - * @defgroup lavu_ver Version and Build diagnostics - * - * Macros and function useful to check at compiletime and at runtime - * which version of libavutil is in use. - * - * @{ - */ - -#define LIBAVUTIL_VERSION_MAJOR 52 -#define LIBAVUTIL_VERSION_MINOR 81 -#define LIBAVUTIL_VERSION_MICRO 100 - -#define LIBAVUTIL_VERSION_INT AV_VERSION_INT(LIBAVUTIL_VERSION_MAJOR, \ - LIBAVUTIL_VERSION_MINOR, \ - LIBAVUTIL_VERSION_MICRO) -#define LIBAVUTIL_VERSION AV_VERSION(LIBAVUTIL_VERSION_MAJOR, \ - LIBAVUTIL_VERSION_MINOR, \ - LIBAVUTIL_VERSION_MICRO) -#define LIBAVUTIL_BUILD LIBAVUTIL_VERSION_INT - -#define LIBAVUTIL_IDENT "Lavu" AV_STRINGIFY(LIBAVUTIL_VERSION) - -/** - * @} - * - * @defgroup depr_guards Deprecation guards - * FF_API_* defines may be placed below to indicate public API that will be - * dropped at a future version bump. The defines themselves are not part of - * the public API and may change, break or disappear at any time. - * - * @{ - */ - -#ifndef FF_API_GET_BITS_PER_SAMPLE_FMT -#define FF_API_GET_BITS_PER_SAMPLE_FMT (LIBAVUTIL_VERSION_MAJOR < 54) -#endif -#ifndef FF_API_FIND_OPT -#define FF_API_FIND_OPT (LIBAVUTIL_VERSION_MAJOR < 54) -#endif -#ifndef FF_API_OLD_AVOPTIONS -#define FF_API_OLD_AVOPTIONS (LIBAVUTIL_VERSION_MAJOR < 54) -#endif -#ifndef FF_API_PIX_FMT -#define FF_API_PIX_FMT (LIBAVUTIL_VERSION_MAJOR < 54) -#endif -#ifndef FF_API_CONTEXT_SIZE -#define FF_API_CONTEXT_SIZE (LIBAVUTIL_VERSION_MAJOR < 54) -#endif -#ifndef FF_API_PIX_FMT_DESC -#define FF_API_PIX_FMT_DESC (LIBAVUTIL_VERSION_MAJOR < 54) -#endif -#ifndef FF_API_AV_REVERSE -#define FF_API_AV_REVERSE (LIBAVUTIL_VERSION_MAJOR < 54) -#endif -#ifndef FF_API_AUDIOCONVERT -#define FF_API_AUDIOCONVERT (LIBAVUTIL_VERSION_MAJOR < 54) -#endif -#ifndef FF_API_CPU_FLAG_MMX2 -#define FF_API_CPU_FLAG_MMX2 (LIBAVUTIL_VERSION_MAJOR < 54) -#endif -#ifndef FF_API_SAMPLES_UTILS_RETURN_ZERO -#define FF_API_SAMPLES_UTILS_RETURN_ZERO (LIBAVUTIL_VERSION_MAJOR < 54) -#endif -#ifndef FF_API_LLS_PRIVATE -#define FF_API_LLS_PRIVATE (LIBAVUTIL_VERSION_MAJOR < 54) -#endif -#ifndef FF_API_LLS1 -#define FF_API_LLS1 (LIBAVUTIL_VERSION_MAJOR < 54) -#endif -#ifndef FF_API_AVFRAME_LAVC -#define FF_API_AVFRAME_LAVC (LIBAVUTIL_VERSION_MAJOR < 54) -#endif -#ifndef FF_API_VDPAU -#define FF_API_VDPAU (LIBAVUTIL_VERSION_MAJOR < 54) -#endif -#ifndef FF_API_GET_CHANNEL_LAYOUT_COMPAT -#define FF_API_GET_CHANNEL_LAYOUT_COMPAT (LIBAVUTIL_VERSION_MAJOR < 54) -#endif -#ifndef FF_API_OLD_OPENCL -#define FF_API_OLD_OPENCL (LIBAVUTIL_VERSION_MAJOR < 54) -#endif -#ifndef FF_API_XVMC -#define FF_API_XVMC (LIBAVUTIL_VERSION_MAJOR < 54) -#endif -#ifndef FF_API_INTFLOAT -#define FF_API_INTFLOAT (LIBAVUTIL_VERSION_MAJOR < 54) -#endif -#ifndef FF_API_OPT_TYPE_METADATA -#define FF_API_OPT_TYPE_METADATA (LIBAVUTIL_VERSION_MAJOR < 54) -#endif - -/** - * @} - */ - -#endif /* AVUTIL_VERSION_H */ - diff --git a/dji_sdk_manifold_read_cam/include/libavutil/xtea.h b/dji_sdk_manifold_read_cam/include/libavutil/xtea.h deleted file mode 100644 index 6f1e71e..0000000 --- a/dji_sdk_manifold_read_cam/include/libavutil/xtea.h +++ /dev/null @@ -1,64 +0,0 @@ -/* - * A 32-bit implementation of the XTEA algorithm - * Copyright (c) 2012 Samuel Pitoiset - * - * This file is part of FFmpeg. - * - * FFmpeg is free software; you can redistribute it and/or - * modify it under the terms of the GNU Lesser General Public - * License as published by the Free Software Foundation; either - * version 2.1 of the License, or (at your option) any later version. - * - * FFmpeg is distributed in the hope that it will be useful, - * but WITHOUT ANY WARRANTY; without even the implied warranty of - * MERCHANTABILITY or FITNESS FOR A PARTICULAR PURPOSE. See the GNU - * Lesser General Public License for more details. - * - * You should have received a copy of the GNU Lesser General Public - * License along with FFmpeg; if not, write to the Free Software - * Foundation, Inc., 51 Franklin Street, Fifth Floor, Boston, MA 02110-1301 USA - */ - -#ifndef AVUTIL_XTEA_H -#define AVUTIL_XTEA_H - -#include - -/** - * @file - * @brief Public header for libavutil XTEA algorithm - * @defgroup lavu_xtea XTEA - * @ingroup lavu_crypto - * @{ - */ - -typedef struct AVXTEA { - uint32_t key[16]; -} AVXTEA; - -/** - * Initialize an AVXTEA context. - * - * @param ctx an AVXTEA context - * @param key a key of 16 bytes used for encryption/decryption - */ -void av_xtea_init(struct AVXTEA *ctx, const uint8_t key[16]); - -/** - * Encrypt or decrypt a buffer using a previously initialized context. - * - * @param ctx an AVXTEA context - * @param dst destination array, can be equal to src - * @param src source array, can be equal to dst - * @param count number of 8 byte blocks - * @param iv initialization vector for CBC mode, if NULL then ECB will be used - * @param decrypt 0 for encryption, 1 for decryption - */ -void av_xtea_crypt(struct AVXTEA *ctx, uint8_t *dst, const uint8_t *src, - int count, uint8_t *iv, int decrypt); - -/** - * @} - */ - -#endif /* AVUTIL_XTEA_H */ diff --git a/dji_sdk_manifold_read_cam/include/libpostproc/postprocess.h b/dji_sdk_manifold_read_cam/include/libpostproc/postprocess.h deleted file mode 100644 index 928e01f..0000000 --- a/dji_sdk_manifold_read_cam/include/libpostproc/postprocess.h +++ /dev/null @@ -1,106 +0,0 @@ -/* - * Copyright (C) 2001-2003 Michael Niedermayer (michaelni@gmx.at) - * - * This file is part of FFmpeg. - * - * FFmpeg is free software; you can redistribute it and/or modify - * it under the terms of the GNU General Public License as published by - * the Free Software Foundation; either version 2 of the License, or - * (at your option) any later version. - * - * FFmpeg is distributed in the hope that it will be useful, - * but WITHOUT ANY WARRANTY; without even the implied warranty of - * MERCHANTABILITY or FITNESS FOR A PARTICULAR PURPOSE. See the - * GNU General Public License for more details. - * - * You should have received a copy of the GNU General Public License - * along with FFmpeg; if not, write to the Free Software - * Foundation, Inc., 51 Franklin Street, Fifth Floor, Boston, MA 02110-1301 USA - */ - -#ifndef POSTPROC_POSTPROCESS_H -#define POSTPROC_POSTPROCESS_H - -/** - * @file - * @ingroup lpp - * external API header - */ - -/** - * @defgroup lpp Libpostproc - * @{ - */ - -#include "libpostproc/version.h" - -/** - * Return the LIBPOSTPROC_VERSION_INT constant. - */ -unsigned postproc_version(void); - -/** - * Return the libpostproc build-time configuration. - */ -const char *postproc_configuration(void); - -/** - * Return the libpostproc license. - */ -const char *postproc_license(void); - -#define PP_QUALITY_MAX 6 - -#define QP_STORE_T int8_t - -#include - -typedef void pp_context; -typedef void pp_mode; - -#if LIBPOSTPROC_VERSION_INT < (52<<16) -typedef pp_context pp_context_t; -typedef pp_mode pp_mode_t; -extern const char *const pp_help; ///< a simple help text -#else -extern const char pp_help[]; ///< a simple help text -#endif - -void pp_postprocess(const uint8_t * src[3], const int srcStride[3], - uint8_t * dst[3], const int dstStride[3], - int horizontalSize, int verticalSize, - const QP_STORE_T *QP_store, int QP_stride, - pp_mode *mode, pp_context *ppContext, int pict_type); - - -/** - * Return a pp_mode or NULL if an error occurred. - * - * @param name the string after "-pp" on the command line - * @param quality a number from 0 to PP_QUALITY_MAX - */ -pp_mode *pp_get_mode_by_name_and_quality(const char *name, int quality); -void pp_free_mode(pp_mode *mode); - -pp_context *pp_get_context(int width, int height, int flags); -void pp_free_context(pp_context *ppContext); - -#define PP_CPU_CAPS_MMX 0x80000000 -#define PP_CPU_CAPS_MMX2 0x20000000 -#define PP_CPU_CAPS_3DNOW 0x40000000 -#define PP_CPU_CAPS_ALTIVEC 0x10000000 -#define PP_CPU_CAPS_AUTO 0x00080000 - -#define PP_FORMAT 0x00000008 -#define PP_FORMAT_420 (0x00000011|PP_FORMAT) -#define PP_FORMAT_422 (0x00000001|PP_FORMAT) -#define PP_FORMAT_411 (0x00000002|PP_FORMAT) -#define PP_FORMAT_444 (0x00000000|PP_FORMAT) - -#define PP_PICT_TYPE_QP2 0x00000010 ///< MPEG2 style QScale - -/** - * @} - */ - -#endif /* POSTPROC_POSTPROCESS_H */ diff --git a/dji_sdk_manifold_read_cam/include/libpostproc/version.h b/dji_sdk_manifold_read_cam/include/libpostproc/version.h deleted file mode 100644 index 111db44..0000000 --- a/dji_sdk_manifold_read_cam/include/libpostproc/version.h +++ /dev/null @@ -1,45 +0,0 @@ -/* - * Version macros. - * - * This file is part of FFmpeg. - * - * FFmpeg is free software; you can redistribute it and/or - * modify it under the terms of the GNU Lesser General Public - * License as published by the Free Software Foundation; either - * version 2.1 of the License, or (at your option) any later version. - * - * FFmpeg is distributed in the hope that it will be useful, - * but WITHOUT ANY WARRANTY; without even the implied warranty of - * MERCHANTABILITY or FITNESS FOR A PARTICULAR PURPOSE. See the GNU - * Lesser General Public License for more details. - * - * You should have received a copy of the GNU Lesser General Public - * License along with FFmpeg; if not, write to the Free Software - * Foundation, Inc., 51 Franklin Street, Fifth Floor, Boston, MA 02110-1301 USA - */ - -#ifndef POSTPROC_POSTPROCESS_VERSION_H -#define POSTPROC_POSTPROCESS_VERSION_H - -/** - * @file - * Libpostproc version macros - */ - -#include "libavutil/avutil.h" - -#define LIBPOSTPROC_VERSION_MAJOR 52 -#define LIBPOSTPROC_VERSION_MINOR 3 -#define LIBPOSTPROC_VERSION_MICRO 100 - -#define LIBPOSTPROC_VERSION_INT AV_VERSION_INT(LIBPOSTPROC_VERSION_MAJOR, \ - LIBPOSTPROC_VERSION_MINOR, \ - LIBPOSTPROC_VERSION_MICRO) -#define LIBPOSTPROC_VERSION AV_VERSION(LIBPOSTPROC_VERSION_MAJOR, \ - LIBPOSTPROC_VERSION_MINOR, \ - LIBPOSTPROC_VERSION_MICRO) -#define LIBPOSTPROC_BUILD LIBPOSTPROC_VERSION_INT - -#define LIBPOSTPROC_IDENT "postproc" AV_STRINGIFY(LIBPOSTPROC_VERSION) - -#endif /* POSTPROC_POSTPROCESS_VERSION_H */ diff --git a/dji_sdk_manifold_read_cam/include/libswresample/swresample.h b/dji_sdk_manifold_read_cam/include/libswresample/swresample.h deleted file mode 100644 index 0525289..0000000 --- a/dji_sdk_manifold_read_cam/include/libswresample/swresample.h +++ /dev/null @@ -1,318 +0,0 @@ -/* - * Copyright (C) 2011-2013 Michael Niedermayer (michaelni@gmx.at) - * - * This file is part of libswresample - * - * libswresample is free software; you can redistribute it and/or - * modify it under the terms of the GNU Lesser General Public - * License as published by the Free Software Foundation; either - * version 2.1 of the License, or (at your option) any later version. - * - * libswresample is distributed in the hope that it will be useful, - * but WITHOUT ANY WARRANTY; without even the implied warranty of - * MERCHANTABILITY or FITNESS FOR A PARTICULAR PURPOSE. See the GNU - * Lesser General Public License for more details. - * - * You should have received a copy of the GNU Lesser General Public - * License along with libswresample; if not, write to the Free Software - * Foundation, Inc., 51 Franklin Street, Fifth Floor, Boston, MA 02110-1301 USA - */ - -#ifndef SWRESAMPLE_SWRESAMPLE_H -#define SWRESAMPLE_SWRESAMPLE_H - -/** - * @file - * @ingroup lswr - * libswresample public header - */ - -/** - * @defgroup lswr Libswresample - * @{ - * - * Libswresample (lswr) is a library that handles audio resampling, sample - * format conversion and mixing. - * - * Interaction with lswr is done through SwrContext, which is - * allocated with swr_alloc() or swr_alloc_set_opts(). It is opaque, so all parameters - * must be set with the @ref avoptions API. - * - * For example the following code will setup conversion from planar float sample - * format to interleaved signed 16-bit integer, downsampling from 48kHz to - * 44.1kHz and downmixing from 5.1 channels to stereo (using the default mixing - * matrix): - * @code - * SwrContext *swr = swr_alloc(); - * av_opt_set_channel_layout(swr, "in_channel_layout", AV_CH_LAYOUT_5POINT1, 0); - * av_opt_set_channel_layout(swr, "out_channel_layout", AV_CH_LAYOUT_STEREO, 0); - * av_opt_set_int(swr, "in_sample_rate", 48000, 0); - * av_opt_set_int(swr, "out_sample_rate", 44100, 0); - * av_opt_set_sample_fmt(swr, "in_sample_fmt", AV_SAMPLE_FMT_FLTP, 0); - * av_opt_set_sample_fmt(swr, "out_sample_fmt", AV_SAMPLE_FMT_S16, 0); - * @endcode - * - * Once all values have been set, it must be initialized with swr_init(). If - * you need to change the conversion parameters, you can change the parameters - * as described above, or by using swr_alloc_set_opts(), then call swr_init() - * again. - * - * The conversion itself is done by repeatedly calling swr_convert(). - * Note that the samples may get buffered in swr if you provide insufficient - * output space or if sample rate conversion is done, which requires "future" - * samples. Samples that do not require future input can be retrieved at any - * time by using swr_convert() (in_count can be set to 0). - * At the end of conversion the resampling buffer can be flushed by calling - * swr_convert() with NULL in and 0 in_count. - * - * The delay between input and output, can at any time be found by using - * swr_get_delay(). - * - * The following code demonstrates the conversion loop assuming the parameters - * from above and caller-defined functions get_input() and handle_output(): - * @code - * uint8_t **input; - * int in_samples; - * - * while (get_input(&input, &in_samples)) { - * uint8_t *output; - * int out_samples = av_rescale_rnd(swr_get_delay(swr, 48000) + - * in_samples, 44100, 48000, AV_ROUND_UP); - * av_samples_alloc(&output, NULL, 2, out_samples, - * AV_SAMPLE_FMT_S16, 0); - * out_samples = swr_convert(swr, &output, out_samples, - * input, in_samples); - * handle_output(output, out_samples); - * av_freep(&output); - * } - * @endcode - * - * When the conversion is finished, the conversion - * context and everything associated with it must be freed with swr_free(). - * There will be no memory leak if the data is not completely flushed before - * swr_free(). - */ - -#include -#include "libavutil/samplefmt.h" - -#include "libswresample/version.h" - -#if LIBSWRESAMPLE_VERSION_MAJOR < 1 -#define SWR_CH_MAX 32 ///< Maximum number of channels -#endif - -#define SWR_FLAG_RESAMPLE 1 ///< Force resampling even if equal sample rate -//TODO use int resample ? -//long term TODO can we enable this dynamically? - -enum SwrDitherType { - SWR_DITHER_NONE = 0, - SWR_DITHER_RECTANGULAR, - SWR_DITHER_TRIANGULAR, - SWR_DITHER_TRIANGULAR_HIGHPASS, - - SWR_DITHER_NS = 64, ///< not part of API/ABI - SWR_DITHER_NS_LIPSHITZ, - SWR_DITHER_NS_F_WEIGHTED, - SWR_DITHER_NS_MODIFIED_E_WEIGHTED, - SWR_DITHER_NS_IMPROVED_E_WEIGHTED, - SWR_DITHER_NS_SHIBATA, - SWR_DITHER_NS_LOW_SHIBATA, - SWR_DITHER_NS_HIGH_SHIBATA, - SWR_DITHER_NB, ///< not part of API/ABI -}; - -/** Resampling Engines */ -enum SwrEngine { - SWR_ENGINE_SWR, /**< SW Resampler */ - SWR_ENGINE_SOXR, /**< SoX Resampler */ - SWR_ENGINE_NB, ///< not part of API/ABI -}; - -/** Resampling Filter Types */ -enum SwrFilterType { - SWR_FILTER_TYPE_CUBIC, /**< Cubic */ - SWR_FILTER_TYPE_BLACKMAN_NUTTALL, /**< Blackman Nuttall Windowed Sinc */ - SWR_FILTER_TYPE_KAISER, /**< Kaiser Windowed Sinc */ -}; - -typedef struct SwrContext SwrContext; - -/** - * Get the AVClass for swrContext. It can be used in combination with - * AV_OPT_SEARCH_FAKE_OBJ for examining options. - * - * @see av_opt_find(). - */ -const AVClass *swr_get_class(void); - -/** - * Allocate SwrContext. - * - * If you use this function you will need to set the parameters (manually or - * with swr_alloc_set_opts()) before calling swr_init(). - * - * @see swr_alloc_set_opts(), swr_init(), swr_free() - * @return NULL on error, allocated context otherwise - */ -struct SwrContext *swr_alloc(void); - -/** - * Initialize context after user parameters have been set. - * - * @return AVERROR error code in case of failure. - */ -int swr_init(struct SwrContext *s); - -/** - * Check whether an swr context has been initialized or not. - * - * @return positive if it has been initialized, 0 if not initialized - */ -int swr_is_initialized(struct SwrContext *s); - -/** - * Allocate SwrContext if needed and set/reset common parameters. - * - * This function does not require s to be allocated with swr_alloc(). On the - * other hand, swr_alloc() can use swr_alloc_set_opts() to set the parameters - * on the allocated context. - * - * @param s Swr context, can be NULL - * @param out_ch_layout output channel layout (AV_CH_LAYOUT_*) - * @param out_sample_fmt output sample format (AV_SAMPLE_FMT_*). - * @param out_sample_rate output sample rate (frequency in Hz) - * @param in_ch_layout input channel layout (AV_CH_LAYOUT_*) - * @param in_sample_fmt input sample format (AV_SAMPLE_FMT_*). - * @param in_sample_rate input sample rate (frequency in Hz) - * @param log_offset logging level offset - * @param log_ctx parent logging context, can be NULL - * - * @see swr_init(), swr_free() - * @return NULL on error, allocated context otherwise - */ -struct SwrContext *swr_alloc_set_opts(struct SwrContext *s, - int64_t out_ch_layout, enum AVSampleFormat out_sample_fmt, int out_sample_rate, - int64_t in_ch_layout, enum AVSampleFormat in_sample_fmt, int in_sample_rate, - int log_offset, void *log_ctx); - -/** - * Free the given SwrContext and set the pointer to NULL. - */ -void swr_free(struct SwrContext **s); - -/** - * Convert audio. - * - * in and in_count can be set to 0 to flush the last few samples out at the - * end. - * - * If more input is provided than output space then the input will be buffered. - * You can avoid this buffering by providing more output space than input. - * Conversion will run directly without copying whenever possible. - * - * @param s allocated Swr context, with parameters set - * @param out output buffers, only the first one need be set in case of packed audio - * @param out_count amount of space available for output in samples per channel - * @param in input buffers, only the first one need to be set in case of packed audio - * @param in_count number of input samples available in one channel - * - * @return number of samples output per channel, negative value on error - */ -int swr_convert(struct SwrContext *s, uint8_t **out, int out_count, - const uint8_t **in , int in_count); - -/** - * Convert the next timestamp from input to output - * timestamps are in 1/(in_sample_rate * out_sample_rate) units. - * - * @note There are 2 slightly differently behaving modes. - * First is when automatic timestamp compensation is not used, (min_compensation >= FLT_MAX) - * in this case timestamps will be passed through with delays compensated - * Second is when automatic timestamp compensation is used, (min_compensation < FLT_MAX) - * in this case the output timestamps will match output sample numbers - * - * @param pts timestamp for the next input sample, INT64_MIN if unknown - * @return the output timestamp for the next output sample - */ -int64_t swr_next_pts(struct SwrContext *s, int64_t pts); - -/** - * Activate resampling compensation. - */ -int swr_set_compensation(struct SwrContext *s, int sample_delta, int compensation_distance); - -/** - * Set a customized input channel mapping. - * - * @param s allocated Swr context, not yet initialized - * @param channel_map customized input channel mapping (array of channel - * indexes, -1 for a muted channel) - * @return AVERROR error code in case of failure. - */ -int swr_set_channel_mapping(struct SwrContext *s, const int *channel_map); - -/** - * Set a customized remix matrix. - * - * @param s allocated Swr context, not yet initialized - * @param matrix remix coefficients; matrix[i + stride * o] is - * the weight of input channel i in output channel o - * @param stride offset between lines of the matrix - * @return AVERROR error code in case of failure. - */ -int swr_set_matrix(struct SwrContext *s, const double *matrix, int stride); - -/** - * Drops the specified number of output samples. - */ -int swr_drop_output(struct SwrContext *s, int count); - -/** - * Injects the specified number of silence samples. - */ -int swr_inject_silence(struct SwrContext *s, int count); - -/** - * Gets the delay the next input sample will experience relative to the next output sample. - * - * Swresample can buffer data if more input has been provided than available - * output space, also converting between sample rates needs a delay. - * This function returns the sum of all such delays. - * The exact delay is not necessarily an integer value in either input or - * output sample rate. Especially when downsampling by a large value, the - * output sample rate may be a poor choice to represent the delay, similarly - * for upsampling and the input sample rate. - * - * @param s swr context - * @param base timebase in which the returned delay will be - * if its set to 1 the returned delay is in seconds - * if its set to 1000 the returned delay is in milli seconds - * if its set to the input sample rate then the returned delay is in input samples - * if its set to the output sample rate then the returned delay is in output samples - * an exact rounding free delay can be found by using LCM(in_sample_rate, out_sample_rate) - * @returns the delay in 1/base units. - */ -int64_t swr_get_delay(struct SwrContext *s, int64_t base); - -/** - * Return the LIBSWRESAMPLE_VERSION_INT constant. - */ -unsigned swresample_version(void); - -/** - * Return the swr build-time configuration. - */ -const char *swresample_configuration(void); - -/** - * Return the swr license. - */ -const char *swresample_license(void); - -/** - * @} - */ - -#endif /* SWRESAMPLE_SWRESAMPLE_H */ diff --git a/dji_sdk_manifold_read_cam/include/libswresample/version.h b/dji_sdk_manifold_read_cam/include/libswresample/version.h deleted file mode 100644 index 3a92875..0000000 --- a/dji_sdk_manifold_read_cam/include/libswresample/version.h +++ /dev/null @@ -1,45 +0,0 @@ -/* - * Version macros. - * - * This file is part of libswresample - * - * libswresample is free software; you can redistribute it and/or - * modify it under the terms of the GNU Lesser General Public - * License as published by the Free Software Foundation; either - * version 2.1 of the License, or (at your option) any later version. - * - * libswresample is distributed in the hope that it will be useful, - * but WITHOUT ANY WARRANTY; without even the implied warranty of - * MERCHANTABILITY or FITNESS FOR A PARTICULAR PURPOSE. See the GNU - * Lesser General Public License for more details. - * - * You should have received a copy of the GNU Lesser General Public - * License along with libswresample; if not, write to the Free Software - * Foundation, Inc., 51 Franklin Street, Fifth Floor, Boston, MA 02110-1301 USA - */ - -#ifndef SWR_VERSION_H -#define SWR_VERSION_H - -/** - * @file - * Libswresample version macros - */ - -#include "libavutil/avutil.h" - -#define LIBSWRESAMPLE_VERSION_MAJOR 0 -#define LIBSWRESAMPLE_VERSION_MINOR 18 -#define LIBSWRESAMPLE_VERSION_MICRO 100 - -#define LIBSWRESAMPLE_VERSION_INT AV_VERSION_INT(LIBSWRESAMPLE_VERSION_MAJOR, \ - LIBSWRESAMPLE_VERSION_MINOR, \ - LIBSWRESAMPLE_VERSION_MICRO) -#define LIBSWRESAMPLE_VERSION AV_VERSION(LIBSWRESAMPLE_VERSION_MAJOR, \ - LIBSWRESAMPLE_VERSION_MINOR, \ - LIBSWRESAMPLE_VERSION_MICRO) -#define LIBSWRESAMPLE_BUILD LIBSWRESAMPLE_VERSION_INT - -#define LIBSWRESAMPLE_IDENT "SwR" AV_STRINGIFY(LIBSWRESAMPLE_VERSION) - -#endif /* SWR_VERSION_H */ diff --git a/dji_sdk_manifold_read_cam/include/libswscale/swscale.h b/dji_sdk_manifold_read_cam/include/libswscale/swscale.h deleted file mode 100644 index 25c8b5e..0000000 --- a/dji_sdk_manifold_read_cam/include/libswscale/swscale.h +++ /dev/null @@ -1,360 +0,0 @@ -/* - * Copyright (C) 2001-2011 Michael Niedermayer - * - * This file is part of FFmpeg. - * - * FFmpeg is free software; you can redistribute it and/or - * modify it under the terms of the GNU Lesser General Public - * License as published by the Free Software Foundation; either - * version 2.1 of the License, or (at your option) any later version. - * - * FFmpeg is distributed in the hope that it will be useful, - * but WITHOUT ANY WARRANTY; without even the implied warranty of - * MERCHANTABILITY or FITNESS FOR A PARTICULAR PURPOSE. See the GNU - * Lesser General Public License for more details. - * - * You should have received a copy of the GNU Lesser General Public - * License along with FFmpeg; if not, write to the Free Software - * Foundation, Inc., 51 Franklin Street, Fifth Floor, Boston, MA 02110-1301 USA - */ - -#ifndef SWSCALE_SWSCALE_H -#define SWSCALE_SWSCALE_H - -/** - * @file - * @ingroup libsws - * external API header - */ - -#include - -#include "libavutil/avutil.h" -#include "libavutil/log.h" -#include "libavutil/pixfmt.h" -#include "version.h" - -/** - * @defgroup libsws Color conversion and scaling - * @{ - * - * Return the LIBSWSCALE_VERSION_INT constant. - */ -unsigned swscale_version(void); - -/** - * Return the libswscale build-time configuration. - */ -const char *swscale_configuration(void); - -/** - * Return the libswscale license. - */ -const char *swscale_license(void); - -/* values for the flags, the stuff on the command line is different */ -#define SWS_FAST_BILINEAR 1 -#define SWS_BILINEAR 2 -#define SWS_BICUBIC 4 -#define SWS_X 8 -#define SWS_POINT 0x10 -#define SWS_AREA 0x20 -#define SWS_BICUBLIN 0x40 -#define SWS_GAUSS 0x80 -#define SWS_SINC 0x100 -#define SWS_LANCZOS 0x200 -#define SWS_SPLINE 0x400 - -#define SWS_SRC_V_CHR_DROP_MASK 0x30000 -#define SWS_SRC_V_CHR_DROP_SHIFT 16 - -#define SWS_PARAM_DEFAULT 123456 - -#define SWS_PRINT_INFO 0x1000 - -//the following 3 flags are not completely implemented -//internal chrominace subsampling info -#define SWS_FULL_CHR_H_INT 0x2000 -//input subsampling info -#define SWS_FULL_CHR_H_INP 0x4000 -#define SWS_DIRECT_BGR 0x8000 -#define SWS_ACCURATE_RND 0x40000 -#define SWS_BITEXACT 0x80000 -#define SWS_ERROR_DIFFUSION 0x800000 - -#if FF_API_SWS_CPU_CAPS -/** - * CPU caps are autodetected now, those flags - * are only provided for API compatibility. - */ -#define SWS_CPU_CAPS_MMX 0x80000000 -#define SWS_CPU_CAPS_MMXEXT 0x20000000 -#define SWS_CPU_CAPS_MMX2 0x20000000 -#define SWS_CPU_CAPS_3DNOW 0x40000000 -#define SWS_CPU_CAPS_ALTIVEC 0x10000000 -#define SWS_CPU_CAPS_BFIN 0x01000000 -#define SWS_CPU_CAPS_SSE2 0x02000000 -#endif - -#define SWS_MAX_REDUCE_CUTOFF 0.002 - -#define SWS_CS_ITU709 1 -#define SWS_CS_FCC 4 -#define SWS_CS_ITU601 5 -#define SWS_CS_ITU624 5 -#define SWS_CS_SMPTE170M 5 -#define SWS_CS_SMPTE240M 7 -#define SWS_CS_DEFAULT 5 - -/** - * Return a pointer to yuv<->rgb coefficients for the given colorspace - * suitable for sws_setColorspaceDetails(). - * - * @param colorspace One of the SWS_CS_* macros. If invalid, - * SWS_CS_DEFAULT is used. - */ -const int *sws_getCoefficients(int colorspace); - -// when used for filters they must have an odd number of elements -// coeffs cannot be shared between vectors -typedef struct SwsVector { - double *coeff; ///< pointer to the list of coefficients - int length; ///< number of coefficients in the vector -} SwsVector; - -// vectors can be shared -typedef struct SwsFilter { - SwsVector *lumH; - SwsVector *lumV; - SwsVector *chrH; - SwsVector *chrV; -} SwsFilter; - -struct SwsContext; - -/** - * Return a positive value if pix_fmt is a supported input format, 0 - * otherwise. - */ -int sws_isSupportedInput(enum AVPixelFormat pix_fmt); - -/** - * Return a positive value if pix_fmt is a supported output format, 0 - * otherwise. - */ -int sws_isSupportedOutput(enum AVPixelFormat pix_fmt); - -/** - * @param[in] pix_fmt the pixel format - * @return a positive value if an endianness conversion for pix_fmt is - * supported, 0 otherwise. - */ -int sws_isSupportedEndiannessConversion(enum AVPixelFormat pix_fmt); - -/** - * Allocate an empty SwsContext. This must be filled and passed to - * sws_init_context(). For filling see AVOptions, options.c and - * sws_setColorspaceDetails(). - */ -struct SwsContext *sws_alloc_context(void); - -/** - * Initialize the swscaler context sws_context. - * - * @return zero or positive value on success, a negative value on - * error - */ -int sws_init_context(struct SwsContext *sws_context, SwsFilter *srcFilter, SwsFilter *dstFilter); - -/** - * Free the swscaler context swsContext. - * If swsContext is NULL, then does nothing. - */ -void sws_freeContext(struct SwsContext *swsContext); - -#if FF_API_SWS_GETCONTEXT -/** - * Allocate and return an SwsContext. You need it to perform - * scaling/conversion operations using sws_scale(). - * - * @param srcW the width of the source image - * @param srcH the height of the source image - * @param srcFormat the source image format - * @param dstW the width of the destination image - * @param dstH the height of the destination image - * @param dstFormat the destination image format - * @param flags specify which algorithm and options to use for rescaling - * @return a pointer to an allocated context, or NULL in case of error - * @note this function is to be removed after a saner alternative is - * written - * @deprecated Use sws_getCachedContext() instead. - */ -struct SwsContext *sws_getContext(int srcW, int srcH, enum AVPixelFormat srcFormat, - int dstW, int dstH, enum AVPixelFormat dstFormat, - int flags, SwsFilter *srcFilter, - SwsFilter *dstFilter, const double *param); -#endif - -/** - * Scale the image slice in srcSlice and put the resulting scaled - * slice in the image in dst. A slice is a sequence of consecutive - * rows in an image. - * - * Slices have to be provided in sequential order, either in - * top-bottom or bottom-top order. If slices are provided in - * non-sequential order the behavior of the function is undefined. - * - * @param c the scaling context previously created with - * sws_getContext() - * @param srcSlice the array containing the pointers to the planes of - * the source slice - * @param srcStride the array containing the strides for each plane of - * the source image - * @param srcSliceY the position in the source image of the slice to - * process, that is the number (counted starting from - * zero) in the image of the first row of the slice - * @param srcSliceH the height of the source slice, that is the number - * of rows in the slice - * @param dst the array containing the pointers to the planes of - * the destination image - * @param dstStride the array containing the strides for each plane of - * the destination image - * @return the height of the output slice - */ -int sws_scale(struct SwsContext *c, const uint8_t *const srcSlice[], - const int srcStride[], int srcSliceY, int srcSliceH, - uint8_t *const dst[], const int dstStride[]); - -/** - * @param dstRange flag indicating the while-black range of the output (1=jpeg / 0=mpeg) - * @param srcRange flag indicating the while-black range of the input (1=jpeg / 0=mpeg) - * @param table the yuv2rgb coefficients describing the output yuv space, normally ff_yuv2rgb_coeffs[x] - * @param inv_table the yuv2rgb coefficients describing the input yuv space, normally ff_yuv2rgb_coeffs[x] - * @param brightness 16.16 fixed point brightness correction - * @param contrast 16.16 fixed point contrast correction - * @param saturation 16.16 fixed point saturation correction - * @return -1 if not supported - */ -int sws_setColorspaceDetails(struct SwsContext *c, const int inv_table[4], - int srcRange, const int table[4], int dstRange, - int brightness, int contrast, int saturation); - -/** - * @return -1 if not supported - */ -int sws_getColorspaceDetails(struct SwsContext *c, int **inv_table, - int *srcRange, int **table, int *dstRange, - int *brightness, int *contrast, int *saturation); - -/** - * Allocate and return an uninitialized vector with length coefficients. - */ -SwsVector *sws_allocVec(int length); - -/** - * Return a normalized Gaussian curve used to filter stuff - * quality = 3 is high quality, lower is lower quality. - */ -SwsVector *sws_getGaussianVec(double variance, double quality); - -/** - * Allocate and return a vector with length coefficients, all - * with the same value c. - */ -SwsVector *sws_getConstVec(double c, int length); - -/** - * Allocate and return a vector with just one coefficient, with - * value 1.0. - */ -SwsVector *sws_getIdentityVec(void); - -/** - * Scale all the coefficients of a by the scalar value. - */ -void sws_scaleVec(SwsVector *a, double scalar); - -/** - * Scale all the coefficients of a so that their sum equals height. - */ -void sws_normalizeVec(SwsVector *a, double height); -void sws_convVec(SwsVector *a, SwsVector *b); -void sws_addVec(SwsVector *a, SwsVector *b); -void sws_subVec(SwsVector *a, SwsVector *b); -void sws_shiftVec(SwsVector *a, int shift); - -/** - * Allocate and return a clone of the vector a, that is a vector - * with the same coefficients as a. - */ -SwsVector *sws_cloneVec(SwsVector *a); - -/** - * Print with av_log() a textual representation of the vector a - * if log_level <= av_log_level. - */ -void sws_printVec2(SwsVector *a, AVClass *log_ctx, int log_level); - -void sws_freeVec(SwsVector *a); - -SwsFilter *sws_getDefaultFilter(float lumaGBlur, float chromaGBlur, - float lumaSharpen, float chromaSharpen, - float chromaHShift, float chromaVShift, - int verbose); -void sws_freeFilter(SwsFilter *filter); - -/** - * Check if context can be reused, otherwise reallocate a new one. - * - * If context is NULL, just calls sws_getContext() to get a new - * context. Otherwise, checks if the parameters are the ones already - * saved in context. If that is the case, returns the current - * context. Otherwise, frees context and gets a new context with - * the new parameters. - * - * Be warned that srcFilter and dstFilter are not checked, they - * are assumed to remain the same. - */ -struct SwsContext *sws_getCachedContext(struct SwsContext *context, - int srcW, int srcH, enum AVPixelFormat srcFormat, - int dstW, int dstH, enum AVPixelFormat dstFormat, - int flags, SwsFilter *srcFilter, - SwsFilter *dstFilter, const double *param); - -/** - * Convert an 8-bit paletted frame into a frame with a color depth of 32 bits. - * - * The output frame will have the same packed format as the palette. - * - * @param src source frame buffer - * @param dst destination frame buffer - * @param num_pixels number of pixels to convert - * @param palette array with [256] entries, which must match color arrangement (RGB or BGR) of src - */ -void sws_convertPalette8ToPacked32(const uint8_t *src, uint8_t *dst, int num_pixels, const uint8_t *palette); - -/** - * Convert an 8-bit paletted frame into a frame with a color depth of 24 bits. - * - * With the palette format "ABCD", the destination frame ends up with the format "ABC". - * - * @param src source frame buffer - * @param dst destination frame buffer - * @param num_pixels number of pixels to convert - * @param palette array with [256] entries, which must match color arrangement (RGB or BGR) of src - */ -void sws_convertPalette8ToPacked24(const uint8_t *src, uint8_t *dst, int num_pixels, const uint8_t *palette); - -/** - * Get the AVClass for swsContext. It can be used in combination with - * AV_OPT_SEARCH_FAKE_OBJ for examining options. - * - * @see av_opt_find(). - */ -const AVClass *sws_get_class(void); - -/** - * @} - */ - -#endif /* SWSCALE_SWSCALE_H */ diff --git a/dji_sdk_manifold_read_cam/include/libswscale/version.h b/dji_sdk_manifold_read_cam/include/libswscale/version.h deleted file mode 100644 index b033863..0000000 --- a/dji_sdk_manifold_read_cam/include/libswscale/version.h +++ /dev/null @@ -1,59 +0,0 @@ -/* - * This file is part of FFmpeg. - * - * FFmpeg is free software; you can redistribute it and/or - * modify it under the terms of the GNU Lesser General Public - * License as published by the Free Software Foundation; either - * version 2.1 of the License, or (at your option) any later version. - * - * FFmpeg is distributed in the hope that it will be useful, - * but WITHOUT ANY WARRANTY; without even the implied warranty of - * MERCHANTABILITY or FITNESS FOR A PARTICULAR PURPOSE. See the GNU - * Lesser General Public License for more details. - * - * You should have received a copy of the GNU Lesser General Public - * License along with FFmpeg; if not, write to the Free Software - * Foundation, Inc., 51 Franklin Street, Fifth Floor, Boston, MA 02110-1301 USA - */ - -#ifndef SWSCALE_VERSION_H -#define SWSCALE_VERSION_H - -/** - * @file - * swscale version macros - */ - -#include "libavutil/version.h" - -#define LIBSWSCALE_VERSION_MAJOR 2 -#define LIBSWSCALE_VERSION_MINOR 6 -#define LIBSWSCALE_VERSION_MICRO 100 - -#define LIBSWSCALE_VERSION_INT AV_VERSION_INT(LIBSWSCALE_VERSION_MAJOR, \ - LIBSWSCALE_VERSION_MINOR, \ - LIBSWSCALE_VERSION_MICRO) -#define LIBSWSCALE_VERSION AV_VERSION(LIBSWSCALE_VERSION_MAJOR, \ - LIBSWSCALE_VERSION_MINOR, \ - LIBSWSCALE_VERSION_MICRO) -#define LIBSWSCALE_BUILD LIBSWSCALE_VERSION_INT - -#define LIBSWSCALE_IDENT "SwS" AV_STRINGIFY(LIBSWSCALE_VERSION) - -/** - * FF_API_* defines may be placed below to indicate public API that will be - * dropped at a future version bump. The defines themselves are not part of - * the public API and may change, break or disappear at any time. - */ - -#ifndef FF_API_SWS_GETCONTEXT -#define FF_API_SWS_GETCONTEXT (LIBSWSCALE_VERSION_MAJOR < 3) -#endif -#ifndef FF_API_SWS_CPU_CAPS -#define FF_API_SWS_CPU_CAPS (LIBSWSCALE_VERSION_MAJOR < 3) -#endif -#ifndef FF_API_SWS_FORMAT_NAME -#define FF_API_SWS_FORMAT_NAME (LIBSWSCALE_VERSION_MAJOR < 3) -#endif - -#endif /* SWSCALE_VERSION_H */ diff --git a/dji_sdk_manifold_read_cam/include/libusb-gadget/COPYING.LESSER b/dji_sdk_manifold_read_cam/include/libusb-gadget/COPYING.LESSER deleted file mode 100644 index cca7fc2..0000000 --- a/dji_sdk_manifold_read_cam/include/libusb-gadget/COPYING.LESSER +++ /dev/null @@ -1,165 +0,0 @@ - GNU LESSER GENERAL PUBLIC LICENSE - Version 3, 29 June 2007 - - Copyright (C) 2007 Free Software Foundation, Inc. - Everyone is permitted to copy and distribute verbatim copies - of this license document, but changing it is not allowed. - - - This version of the GNU Lesser General Public License incorporates -the terms and conditions of version 3 of the GNU General Public -License, supplemented by the additional permissions listed below. - - 0. Additional Definitions. - - As used herein, "this License" refers to version 3 of the GNU Lesser -General Public License, and the "GNU GPL" refers to version 3 of the GNU -General Public License. - - "The Library" refers to a covered work governed by this License, -other than an Application or a Combined Work as defined below. - - An "Application" is any work that makes use of an interface provided -by the Library, but which is not otherwise based on the Library. -Defining a subclass of a class defined by the Library is deemed a mode -of using an interface provided by the Library. - - A "Combined Work" is a work produced by combining or linking an -Application with the Library. The particular version of the Library -with which the Combined Work was made is also called the "Linked -Version". - - The "Minimal Corresponding Source" for a Combined Work means the -Corresponding Source for the Combined Work, excluding any source code -for portions of the Combined Work that, considered in isolation, are -based on the Application, and not on the Linked Version. - - The "Corresponding Application Code" for a Combined Work means the -object code and/or source code for the Application, including any data -and utility programs needed for reproducing the Combined Work from the -Application, but excluding the System Libraries of the Combined Work. - - 1. Exception to Section 3 of the GNU GPL. - - You may convey a covered work under sections 3 and 4 of this License -without being bound by section 3 of the GNU GPL. - - 2. Conveying Modified Versions. - - If you modify a copy of the Library, and, in your modifications, a -facility refers to a function or data to be supplied by an Application -that uses the facility (other than as an argument passed when the -facility is invoked), then you may convey a copy of the modified -version: - - a) under this License, provided that you make a good faith effort to - ensure that, in the event an Application does not supply the - function or data, the facility still operates, and performs - whatever part of its purpose remains meaningful, or - - b) under the GNU GPL, with none of the additional permissions of - this License applicable to that copy. - - 3. Object Code Incorporating Material from Library Header Files. - - The object code form of an Application may incorporate material from -a header file that is part of the Library. You may convey such object -code under terms of your choice, provided that, if the incorporated -material is not limited to numerical parameters, data structure -layouts and accessors, or small macros, inline functions and templates -(ten or fewer lines in length), you do both of the following: - - a) Give prominent notice with each copy of the object code that the - Library is used in it and that the Library and its use are - covered by this License. - - b) Accompany the object code with a copy of the GNU GPL and this license - document. - - 4. Combined Works. - - You may convey a Combined Work under terms of your choice that, -taken together, effectively do not restrict modification of the -portions of the Library contained in the Combined Work and reverse -engineering for debugging such modifications, if you also do each of -the following: - - a) Give prominent notice with each copy of the Combined Work that - the Library is used in it and that the Library and its use are - covered by this License. - - b) Accompany the Combined Work with a copy of the GNU GPL and this license - document. - - c) For a Combined Work that displays copyright notices during - execution, include the copyright notice for the Library among - these notices, as well as a reference directing the user to the - copies of the GNU GPL and this license document. - - d) Do one of the following: - - 0) Convey the Minimal Corresponding Source under the terms of this - License, and the Corresponding Application Code in a form - suitable for, and under terms that permit, the user to - recombine or relink the Application with a modified version of - the Linked Version to produce a modified Combined Work, in the - manner specified by section 6 of the GNU GPL for conveying - Corresponding Source. - - 1) Use a suitable shared library mechanism for linking with the - Library. A suitable mechanism is one that (a) uses at run time - a copy of the Library already present on the user's computer - system, and (b) will operate properly with a modified version - of the Library that is interface-compatible with the Linked - Version. - - e) Provide Installation Information, but only if you would otherwise - be required to provide such information under section 6 of the - GNU GPL, and only to the extent that such information is - necessary to install and execute a modified version of the - Combined Work produced by recombining or relinking the - Application with a modified version of the Linked Version. (If - you use option 4d0, the Installation Information must accompany - the Minimal Corresponding Source and Corresponding Application - Code. If you use option 4d1, you must provide the Installation - Information in the manner specified by section 6 of the GNU GPL - for conveying Corresponding Source.) - - 5. Combined Libraries. - - You may place library facilities that are a work based on the -Library side by side in a single library together with other library -facilities that are not Applications and are not covered by this -License, and convey such a combined library under terms of your -choice, if you do both of the following: - - a) Accompany the combined library with a copy of the same work based - on the Library, uncombined with any other library facilities, - conveyed under the terms of this License. - - b) Give prominent notice with the combined library that part of it - is a work based on the Library, and explaining where to find the - accompanying uncombined form of the same work. - - 6. Revised Versions of the GNU Lesser General Public License. - - The Free Software Foundation may publish revised and/or new versions -of the GNU Lesser General Public License from time to time. Such new -versions will be similar in spirit to the present version, but may -differ in detail to address new problems or concerns. - - Each version is given a distinguishing version number. If the -Library as you received it specifies that a certain numbered version -of the GNU Lesser General Public License "or any later version" -applies to it, you have the option of following the terms and -conditions either of that published version or of any later version -published by the Free Software Foundation. If the Library as you -received it does not specify a version number of the GNU Lesser -General Public License, you may choose any version of the GNU Lesser -General Public License ever published by the Free Software Foundation. - - If the Library as you received it specifies that a proxy can decide -whether future versions of the GNU Lesser General Public License shall -apply, that proxy's public statement of acceptance of any version is -permanent authorization for you to choose that version for the -Library. diff --git a/dji_sdk_manifold_read_cam/include/libusb-gadget/Makefile.am b/dji_sdk_manifold_read_cam/include/libusb-gadget/Makefile.am deleted file mode 100644 index 7b40664..0000000 --- a/dji_sdk_manifold_read_cam/include/libusb-gadget/Makefile.am +++ /dev/null @@ -1,4 +0,0 @@ -AUTOMAKE_OPTIONS = foreign -ACLOCAL_AMFLAGS = -I m4 -SUBDIRS = src tests scripts -pkgconfig_DATA = libusb-gadget.pc \ No newline at end of file diff --git a/dji_sdk_manifold_read_cam/include/libusb-gadget/README b/dji_sdk_manifold_read_cam/include/libusb-gadget/README deleted file mode 100644 index 3b40107..0000000 --- a/dji_sdk_manifold_read_cam/include/libusb-gadget/README +++ /dev/null @@ -1,78 +0,0 @@ -* What's this? - -libusb-gadget is a simple wrapper around Linux USB GadgetFS[1], which enables -USB target development in userspace. It allows developers to write a -trivial gadget in ~200 lines, while the original GadgetFS example[2] -is ~1700 lines. - -* Requirements - -- linux 2.6.XX - -* Quick start - -I assume that you are using Debian GNU/Linux. Since the USB gadget -framework is not compiled in the stock kernel (as of 2.6.29-1), you -will need to generate a couple of kernel modules by hand: - - $ sudo apt-get install linux-source-2.6.XX linux-headers-2.6.XX - $ cd /usr/src - $ tar xf linux-source-2.6.XX.tar.bz2 - $ cd libusb-gadget/scripts - $ ./generate-kernel-modules /usr/src/linux-source-2.6.XX - -After successful build, you will find "dummy_hcd.ko" and -"gadgetfs.ko" in the current working directory. You can load them with: - - $ sudo insmod dummy_hcd.ko - $ sudo insmod gadgetfs.ko - -and mount the GadgetFS: - - $ sudo mkdir /dev/gadget - $ sudo mount -t gadgetfs none /dev/gadget - -Now you can try libusb-gadget. - - $ cd libusb-gadget - $ ./configure - $ make - -tests/ contains an example gadget. - - $ cd tests - $ sudo ./loopback 00FF:0000 # VEND:PROD - -On another terminal: - - $ cd libusb-gadget/tests - $ sudo ./loopback-test 00FF:0000 # VEND:PROD - -* Limitations - -- Multithreading is necessary since /dev/gadget/$ENDPOINT (except for - ep0) do not support polling. - -- The endpoint number in the endpoint descriptor must be specified - explicitly, while the kernel space API assigns them automatically. - -- The max packet size is also mandatory in that descriptor. - -* License - -LGPLv3+. See COPYING.LESSER for detail. - -Footnotes: -[1] http://www.linux-usb.org/gadget/ -[2] http://www.linux-usb.org/gadget/usb.c - -* Copyright - -All files are under the copyright of: - -Copyright (C) 2009 Daiki Ueno - -except src/usbstring.[ch] which are based on the version by David -Brownell and under the copyright of: - -Copyright (C) 2003 David Brownell diff --git a/dji_sdk_manifold_read_cam/include/libusb-gadget/configure.ac b/dji_sdk_manifold_read_cam/include/libusb-gadget/configure.ac deleted file mode 100644 index e1c48ef..0000000 --- a/dji_sdk_manifold_read_cam/include/libusb-gadget/configure.ac +++ /dev/null @@ -1,24 +0,0 @@ -AC_INIT([libusb-gadget], [0.0.0], [ueno@unixuser.org]) -AM_INIT_AUTOMAKE -AC_PROG_CC -AC_CONFIG_MACRO_DIR([m4]) -LT_INIT - -AC_CHECK_HEADERS([linux/usb/gadgetfs.h], - [AC_DEFINE([HAVE_LINUX_USB_SUBDIR], 1, - [Linux USB headers are arranged in a dedicated directory.])], - dnl Don't check the existence of linux/usb_gadgetfs.h here to - dnl ignore autoconf cache of the above check. - [AC_CHECK_HEADERS([linux/usb_ch9.h], , - [AC_MSG_ERROR([Can't find linux/usb/gadgetfs.h nor linux/usb_gadgetfs.h.])])]) - -pkgconfigdir='${libdir}/pkgconfig' -AC_SUBST(pkgconfigdir) -PKG_CHECK_MODULES([libusb], [libusb >= 0.1.12]) -AC_CONFIG_HEADERS([src/config.h]) -AC_CONFIG_FILES([Makefile -libusb-gadget.pc -src/Makefile -tests/Makefile -scripts/Makefile]) -AC_OUTPUT diff --git a/dji_sdk_manifold_read_cam/include/libusb-gadget/libusb-gadget.pc.in b/dji_sdk_manifold_read_cam/include/libusb-gadget/libusb-gadget.pc.in deleted file mode 100644 index 34e9018..0000000 --- a/dji_sdk_manifold_read_cam/include/libusb-gadget/libusb-gadget.pc.in +++ /dev/null @@ -1,11 +0,0 @@ -prefix=@prefix@ -exec_prefix=@exec_prefix@ -libdir=@libdir@ -includedir=@includedir@ - -Name: libusb-gadget -Description: USB gadget development library -Version: @VERSION@ -Libs: -L${libdir} -lusb-gadget -Cflags: -I${includedir} - diff --git a/dji_sdk_manifold_read_cam/include/libusb-gadget/scripts/.gitignore b/dji_sdk_manifold_read_cam/include/libusb-gadget/scripts/.gitignore deleted file mode 100644 index 8a39a5a..0000000 --- a/dji_sdk_manifold_read_cam/include/libusb-gadget/scripts/.gitignore +++ /dev/null @@ -1,3 +0,0 @@ -Makefile -Makefile.in -*.ko diff --git a/dji_sdk_manifold_read_cam/include/libusb-gadget/scripts/Kbuild b/dji_sdk_manifold_read_cam/include/libusb-gadget/scripts/Kbuild deleted file mode 100644 index 7a40bec..0000000 --- a/dji_sdk_manifold_read_cam/include/libusb-gadget/scripts/Kbuild +++ /dev/null @@ -1,6 +0,0 @@ -# This is a Kbuild file to build some modules outside of the kernel source. -EXTRA_CFLAGS += -DDEBUG - -obj-m := dummy_hcd.o gadgetfs.o -gadgetfs-y := inode.o - diff --git a/dji_sdk_manifold_read_cam/include/libusb-gadget/scripts/Makefile.Linux b/dji_sdk_manifold_read_cam/include/libusb-gadget/scripts/Makefile.Linux deleted file mode 100644 index f7fe31c..0000000 --- a/dji_sdk_manifold_read_cam/include/libusb-gadget/scripts/Makefile.Linux +++ /dev/null @@ -1,24 +0,0 @@ -KERNELSRC = -KERNELDIR = /lib/modules/$(shell uname -r)/build -srcdir = $(shell pwd) - -CORESRCS = $(KERNELSRC)/drivers/usb/core/hcd.h \ - $(KERNELSRC)/drivers/usb/core/hub.h -GADGETSRCS = $(KERNELSRC)/drivers/usb/gadget/config.c \ - $(KERNELSRC)/drivers/usb/gadget/epautoconf.c \ - $(KERNELSRC)/drivers/usb/gadget/usbstring.c \ - $(KERNELSRC)/drivers/usb/gadget/gadget_chips.h \ - $(KERNELSRC)/drivers/usb/gadget/dummy_hcd.c \ - $(KERNELSRC)/drivers/usb/gadget/inode.c - -all: - mkdir -p $(srcdir)/kernel/drivers/usb/core $(srcdir)/kernel/drivers/usb/gadget - cp -u $(CORESRCS) $(srcdir)/kernel/drivers/usb/core - cp -u $(GADGETSRCS) $(srcdir)/kernel/drivers/usb/gadget - cp -sf $(srcdir)/Kbuild $(srcdir)/kernel/drivers/usb/gadget - make -C $(KERNELDIR) M=$(srcdir)/kernel/drivers/usb/gadget - cp $(srcdir)/kernel/drivers/usb/gadget/dummy_hcd.ko . - cp $(srcdir)/kernel/drivers/usb/gadget/gadgetfs.ko . - -clean: - rm -rf $(srcdir)/kernel diff --git a/dji_sdk_manifold_read_cam/include/libusb-gadget/scripts/Makefile.am b/dji_sdk_manifold_read_cam/include/libusb-gadget/scripts/Makefile.am deleted file mode 100644 index bf921eb..0000000 --- a/dji_sdk_manifold_read_cam/include/libusb-gadget/scripts/Makefile.am +++ /dev/null @@ -1,2 +0,0 @@ -EXTRA_DIST = Makefile.Linux Kbuild generate-kernel-modules -CLEANFILES = dummy_hcd.ko gadgetfs.ko diff --git a/dji_sdk_manifold_read_cam/include/libusb-gadget/scripts/generate-kernel-modules b/dji_sdk_manifold_read_cam/include/libusb-gadget/scripts/generate-kernel-modules deleted file mode 100644 index 7cc3ea7..0000000 --- a/dji_sdk_manifold_read_cam/include/libusb-gadget/scripts/generate-kernel-modules +++ /dev/null @@ -1,9 +0,0 @@ -#!/bin/sh - -if test $# != 1; then - echo "Usage: $0 KERNELSRC" 1>&2 - exit 1 -fi - -make -f Makefile.Linux KERNELSRC="$1" -make -f Makefile.Linux clean diff --git a/dji_sdk_manifold_read_cam/include/libusb-gadget/src/.gitignore b/dji_sdk_manifold_read_cam/include/libusb-gadget/src/.gitignore deleted file mode 100644 index 2fe57d0..0000000 --- a/dji_sdk_manifold_read_cam/include/libusb-gadget/src/.gitignore +++ /dev/null @@ -1,5 +0,0 @@ -Makefile -Makefile.in -config.h -config.h.in -stamp-h1 diff --git a/dji_sdk_manifold_read_cam/include/libusb-gadget/src/Makefile.am b/dji_sdk_manifold_read_cam/include/libusb-gadget/src/Makefile.am deleted file mode 100644 index c8d9ed3..0000000 --- a/dji_sdk_manifold_read_cam/include/libusb-gadget/src/Makefile.am +++ /dev/null @@ -1,3 +0,0 @@ -include_HEADERS = usb-gadget.h -lib_LTLIBRARIES = libusb-gadget.la -libusb_gadget_la_SOURCES = usb-gadget.c usbstring.c list.h diff --git a/dji_sdk_manifold_read_cam/include/libusb-gadget/src/list.h b/dji_sdk_manifold_read_cam/include/libusb-gadget/src/list.h deleted file mode 100644 index d392e62..0000000 --- a/dji_sdk_manifold_read_cam/include/libusb-gadget/src/list.h +++ /dev/null @@ -1,80 +0,0 @@ -/* - * Copyright (C) 2009 Daiki Ueno - * This file is part of libusb-gadget. - * - * libusb-gadget is free software: you can redistribute it and/or modify - * it under the terms of the GNU Lesser General Public License as published by - * the Free Software Foundation, either version 3 of the License, or - * (at your option) any later version. - * - * libusb-gadget is distributed in the hope that it will be useful, - * but WITHOUT ANY WARRANTY; without even the implied warranty of - * MERCHANTABILITY or FITNESS FOR A PARTICULAR PURPOSE. See the - * GNU Lesser General Public License for more details. - * - * You should have received a copy of the GNU Lesser General Public License - * along with Foobar. If not, see . - */ - -#ifndef __LIST_H -#define __LIST_H - -#include /* offsetof */ - -struct usb_gadget_list_head { - struct usb_gadget_list_head *next, *prev; -}; - -/* copied and renamed from linux/include/linux/kernel.h */ -#define usb_gadget_container_of(ptr, type, member) ({ \ - const typeof( ((type *)0)->member ) *__mptr = (ptr); \ - (type *)( (char *)__mptr - offsetof(type,member) );}) - -#define usb_gadget_list_entry(ptr, type, member) \ - usb_gadget_container_of(ptr, type, member) - -#define usb_gadget_list_for_each_entry(pos, head, member) \ - for (pos = usb_gadget_list_entry((head)->next, typeof(*pos), member); \ - pos->member.next, &pos->member != (head); \ - pos = usb_gadget_list_entry(pos->member.next, typeof(*pos), member)) - -static inline void usb_gadget_init_list_head (struct usb_gadget_list_head *list) -{ - list->next = list; - list->prev = list; -} - -static inline void __usb_gadget_list_add (struct usb_gadget_list_head *new, - struct usb_gadget_list_head *prev, - struct usb_gadget_list_head *next) -{ - next->prev = new; - new->next = next; - new->prev = prev; - prev->next = new; -} - -static inline void usb_gadget_list_add (struct usb_gadget_list_head *new, - struct usb_gadget_list_head *head) -{ - __usb_gadget_list_add (new, head, head->next); -} - -static inline void usb_gadget_list_add_tail (struct usb_gadget_list_head *new, - struct usb_gadget_list_head *head) -{ - __usb_gadget_list_add (new, head->prev, head); -} - -static inline void usb_gadget_list_del (struct usb_gadget_list_head *head) -{ - head->next->prev = head->prev; - head->prev->next = head->next; -} - -static inline int usb_gadget_list_empty (struct usb_gadget_list_head *head) -{ - return head->next == head; -} - -#endif diff --git a/dji_sdk_manifold_read_cam/include/libusb-gadget/src/usb-gadget.c b/dji_sdk_manifold_read_cam/include/libusb-gadget/src/usb-gadget.c deleted file mode 100644 index 4aa5505..0000000 --- a/dji_sdk_manifold_read_cam/include/libusb-gadget/src/usb-gadget.c +++ /dev/null @@ -1,798 +0,0 @@ -/* - * Copyright (C) 2009 Daiki Ueno - * This file is part of libusb-gadget. - * - * libusb-gadget is free software: you can redistribute it and/or modify - * it under the terms of the GNU Lesser General Public License as published by - * the Free Software Foundation, either version 3 of the License, or - * (at your option) any later version. - * - * libusb-gadget is distributed in the hope that it will be useful, - * but WITHOUT ANY WARRANTY; without even the implied warranty of - * MERCHANTABILITY or FITNESS FOR A PARTICULAR PURPOSE. See the - * GNU Lesser General Public License for more details. - * - * You should have received a copy of the GNU Lesser General Public License - * along with Foobar. If not, see . - */ - -#include -#include -#include -#include -#include -#include -#include -#include -#include -#include -#include -#include -#include "config.h" -#if HAVE_LINUX_USB_SUBDIR -#include -#else -#include -#endif -#include "usb-gadget.h" -#include "list.h" - -#define GADGETFS_DEVICE_PATH "/dev/gadget" -#define USB_BUFSIZ (7 * 1024) -#define NEVENT 5 - -struct _usb_gadget_endpoint -{ - struct usb_gadget_endpoint ep; - struct usb_endpoint_descriptor *descriptor, *hs_descriptor; - struct usb_gadget_list_head ep_list; - usb_gadget_dev_handle *handle; - int fd; -}; - -struct usb_gadget_dev_handle -{ - struct _usb_gadget_endpoint *ep0; - struct usb_gadget_device *device; - struct usb_gadget_list_head ep_list; - usb_gadget_event_cb event_cb; - void *event_arg; - int debug_level; - enum usb_device_speed speed; -}; - -static inline void -debug (usb_gadget_dev_handle *handle, int level, const char *format, ...) -{ - va_list ap; - va_start(ap, format); - if (handle->debug_level >= level) - { - vfprintf (stderr, format, ap); - fflush (stderr); - } - va_end(ap); -} - -void -usb_gadget_set_debug_level (usb_gadget_dev_handle *handle, int level) -{ - handle->debug_level = level; -} - -static int -config_buf (void *buf, unsigned buflen, struct usb_descriptor_header **config) -{ - void *p = buf; - int i; - - if (config[0]->bDescriptorType != USB_DT_CONFIG) - { - errno = EINVAL; - return -1; - } - for (i = 0; config[i]; i++) - { - memcpy (p, config[i], config[i]->bLength); - p += config[i]->bLength; - } - - ((struct usb_config_descriptor *)buf)->wTotalLength = - usb_gadget_cpu_to_le16(p - buf); - - return p - buf; -} - -static struct _usb_gadget_endpoint * -find_ep0 (struct usb_gadget_dev_handle *handle) -{ - DIR *dirp; - struct dirent *entry; - static const char *table[] = { - "tegra-udc", /*add by dji*/ - "dummy_udc", - "net2280", - "gfs_udc", - "pxa2xx_udc", - "goku_udc", - "sh_udc", - "omap_udc", - "musb_hdrc", - "at91_udc", - "lh740x_udc", - "atmel_usba_udc", - NULL - }; - struct _usb_gadget_endpoint *ep0 = NULL; - - dirp = opendir (GADGETFS_DEVICE_PATH); - if (!dirp) - return NULL; - - entry = malloc (offsetof(struct dirent, d_name) - + pathconf (GADGETFS_DEVICE_PATH, _PC_NAME_MAX) - + 1); - if (!entry) - { - closedir (dirp); - return NULL; - } - - while (1) - { - struct dirent *result; - int i; - - if (readdir_r (dirp, entry, &result) < 0) - break; - if (!result) - break; - for (i = 0; table[i] && strcmp (table[i], entry->d_name); i++) - ; - if (table[i]) - { - ep0 = malloc (sizeof(*ep0)); - if (!ep0) - break; - usb_gadget_init_list_head (&ep0->ep_list); - ep0->ep.name = strdup (table[i]); - if (!ep0->ep.name) - { - free (ep0); - ep0 = NULL; - break; - } - ep0->fd = -1; - break; - } - } - - free (entry); - closedir (dirp); - - return ep0; -} - -static int -open_ep0 (struct usb_gadget_dev_handle *handle) -{ - int ret; - char buf[USB_BUFSIZ], *p; - struct _usb_gadget_endpoint *ep0 = handle->ep0; - - snprintf (buf, sizeof(buf), "%s/%s", GADGETFS_DEVICE_PATH, ep0->ep.name); - ep0->fd = open (buf, O_RDWR); - if (ep0->fd < 0) - return -1; - - p = buf; - *(uint32_t *)p = 0; /* tag */ - p += sizeof(uint32_t); - - ret = config_buf (p, sizeof(buf) - (p - buf), handle->device->config); - if (ret < 0) - goto error; - p += ret; - - if (handle->device->hs_config) - { - ret = config_buf (p, sizeof(buf) - (p - buf), handle->device->hs_config); - if (ret < 0) - goto error; - p += ret; - } - - memcpy (p, handle->device->device, sizeof(struct usb_device_descriptor)); - p += sizeof(struct usb_device_descriptor); - - if (write (ep0->fd, buf, p - buf) < 0) - { - debug (ep0->handle, 2, "libusb-gadget: open_ep0: can't write config\n"); - goto error; - } - - return 0; - - error: - close (ep0->fd); - ep0->fd = -1; - return -1; -} - -static int -ep_matches (struct usb_gadget_dev_handle *handle, - const char *name, struct usb_endpoint_descriptor *descriptor) -{ - int address = -1, desired_address; - int direction = -1, desired_direction; - int type = -1, desired_type; - - if ('0' <= name[2] && name[2] <= '9') - { - char *endptr; - - address = strtoul (&name[2], &endptr, 10); - if (!strncmp (endptr, "in", 2)) - { - direction = USB_DIR_IN; - endptr += 2; - } - else if (!strncmp (endptr, "out", 3)) - { - direction = USB_DIR_OUT; - endptr += 3; - } - - if (!strcmp (endptr, "-bulk")) - type = USB_ENDPOINT_XFER_BULK; - else if (!strcmp (endptr, "-iso")) - type = USB_ENDPOINT_XFER_ISOC; - else if (!strcmp (endptr, "-int")) - type = USB_ENDPOINT_XFER_INT; - } - - desired_address = descriptor->bEndpointAddress & USB_ENDPOINT_NUMBER_MASK; - if (desired_address && address >= 0 && address != desired_address) - return 0; - desired_direction = descriptor->bEndpointAddress & USB_ENDPOINT_DIR_MASK; - if (direction >= 0 && direction != desired_direction) - return 0; - desired_type = descriptor->bmAttributes & USB_ENDPOINT_XFERTYPE_MASK; - if (type >= 0 && type != desired_type) - return 0; - - return 1; -} - -static struct _usb_gadget_endpoint * -find_ep (struct usb_gadget_dev_handle *handle, - struct usb_endpoint_descriptor *descriptor) -{ - DIR *dirp; - struct dirent *entry; - struct _usb_gadget_endpoint *ep = NULL; - - assert (handle->ep0); - - dirp = opendir (GADGETFS_DEVICE_PATH); - if (!dirp) - return NULL; - - entry = malloc (offsetof(struct dirent, d_name) - + pathconf (GADGETFS_DEVICE_PATH, _PC_NAME_MAX) - + 1); - if (!entry) - { - closedir (dirp); - return NULL; - } - - while (!ep) - { - struct dirent *result; - int i; - - next: - if (readdir_r (dirp, entry, &result) < 0) - break; - if (!result) - break; - - if (strcmp (handle->ep0->ep.name, entry->d_name) && - !strncmp (entry->d_name, "ep", 2)) - { - struct _usb_gadget_endpoint *_ep; - usb_gadget_list_for_each_entry (_ep, &handle->ep_list, ep_list) - { - if (!strcmp (_ep->ep.name, entry->d_name)) - goto next; - } - - if (!ep_matches (handle, entry->d_name, descriptor)) - continue; - - ep = malloc (sizeof(*ep)); - if (!ep) - break; - ep->ep.name = strdup (entry->d_name); - if (!ep->ep.name) - { - free (ep); - ep = NULL; - break; - } - ep->fd = -1; - usb_gadget_init_list_head (&ep->ep_list); - usb_gadget_list_add (&ep->ep_list, &handle->ep_list); - } - } - - free (entry); - closedir (dirp); - return ep; -} - -static int -open_ep (struct _usb_gadget_endpoint *ep, - struct usb_endpoint_descriptor *descriptor, - struct usb_endpoint_descriptor *hs_descriptor) -{ - int ret; - char buf[USB_BUFSIZ], *p; - - snprintf (buf, sizeof(buf), "%s/%s", GADGETFS_DEVICE_PATH, ep->ep.name); - ep->fd = open (buf, O_RDWR); - if (ep->fd < 0) - return -1; - - p = buf; - *(uint32_t *)p = 1; /* tag */ - p += sizeof(uint32_t); - - memcpy (p, descriptor, USB_DT_ENDPOINT_SIZE); - p += USB_DT_ENDPOINT_SIZE; - if (hs_descriptor) - { - memcpy (p, hs_descriptor, USB_DT_ENDPOINT_SIZE); - p += USB_DT_ENDPOINT_SIZE; - } - ret = write (ep->fd, buf, p - buf); - if (ret < 0) - { - debug (ep->handle, 2, "libusb-gadget: open_ep: can't write config\n"); - close (ep->fd); - return -1; - } - - return 0; -} - -static void -close_ep (struct _usb_gadget_endpoint *ep) -{ - assert (ep); - - usb_gadget_list_del (&ep->ep_list); - if (ep->fd > 0) - close (ep->fd); - free (ep->ep.name); - - ep->fd = -1; - ep->ep.name = NULL; -} - -int -usb_gadget_endpoint_close (struct usb_gadget_endpoint *ep) -{ - struct _usb_gadget_endpoint *_ep; - - _ep = usb_gadget_container_of(ep, struct _usb_gadget_endpoint, ep); - close_ep (_ep); - - return 0; -} - -usb_gadget_dev_handle * -usb_gadget_open (struct usb_gadget_device *device) -{ - struct usb_gadget_dev_handle *handle; - - if (!device || !device->device || !device->config) - { - errno = EINVAL; - return NULL; - } - - handle = malloc (sizeof(*handle)); - if (!handle) - goto error; - handle->device = device; - - handle->ep0 = find_ep0 (handle); - if (!handle->ep0) - goto error; - - if (open_ep0 (handle) < 0) - goto error; - - usb_gadget_init_list_head (&handle->ep_list); - return handle; - - error: - if (handle->ep0) - { - close_ep (handle->ep0); - free (handle->ep0); - handle->ep0 = NULL; - } - free (handle); - return NULL; -} - -int -usb_gadget_close (usb_gadget_dev_handle *handle) -{ - struct _usb_gadget_endpoint *ep; - - if (!handle || !handle->ep0) - { - errno = EINVAL; - return -1; - } - close_ep (handle->ep0); - free (handle->ep0); - handle->ep0 = NULL; - - usb_gadget_list_for_each_entry (ep, &handle->ep_list, ep_list) - { - close_ep (ep); - free (ep); - //ep = NULL; /*masked by dji*/ - } - - return 0; -} - -struct usb_gadget_endpoint * -usb_gadget_endpoint (usb_gadget_dev_handle *handle, int number) -{ - struct _usb_gadget_endpoint *ep; - - if (number == 0) - return &handle->ep0->ep; - - usb_gadget_list_for_each_entry (ep, &handle->ep_list, ep_list) - if ((ep->descriptor->bEndpointAddress & USB_ENDPOINT_NUMBER_MASK) == number) - return &ep->ep; - - return NULL; -} - -static int -set_config (usb_gadget_dev_handle *handle, int value) -{ - struct usb_descriptor_header **header; - struct usb_config_descriptor *config; - struct _usb_gadget_endpoint *ep; - - if (value == 0) - { - usb_gadget_list_for_each_entry (ep, &handle->ep_list, ep_list) - { - int number; - - number = ep->descriptor->bEndpointAddress & USB_ENDPOINT_NUMBER_MASK; - - close_ep (ep); - if (handle->event_cb) - { - struct usb_gadget_event event; - - event.type = USG_EVENT_ENDPOINT_DISABLE; - event.u.number = number; - handle->event_cb (handle, &event, handle->event_arg); - } - } - return 0; - } - - config = (struct usb_config_descriptor *)handle->device->config[0]; - if (value != config->bConfigurationValue) - { - errno = EINVAL; - return -1; - } - - for (header = handle->device->config; *header; header++) - { - struct usb_descriptor_header **hs_header; - struct usb_endpoint_descriptor *descriptor = NULL, *hs_descriptor = NULL; - struct _usb_gadget_endpoint *ep; - int number; - - if ((*header)->bDescriptorType != USB_DT_ENDPOINT) - continue; - descriptor = (struct usb_endpoint_descriptor *)*header; - number = descriptor->bEndpointAddress & USB_ENDPOINT_NUMBER_MASK; - assert (number); - - if (handle->device->hs_config) - { - for (hs_header = handle->device->hs_config; *hs_header; hs_header++) - { - if ((*hs_header)->bDescriptorType != USB_DT_ENDPOINT) - continue; - hs_descriptor = (struct usb_endpoint_descriptor *)*hs_header; - if ((hs_descriptor->bEndpointAddress & USB_ENDPOINT_NUMBER_MASK) - == number) - break; - } - if (!*hs_header) - hs_descriptor = NULL; - } - ep = find_ep (handle, descriptor); - if (!ep) - { - debug (handle, 2, "libusb-gadget: set_config: find_ep failed\n"); - return -1; - } - if (open_ep (ep, descriptor, hs_descriptor) < 0) - { - debug (handle, 2, "libusb-gadget: set_config: %s open failed\n", - ep->ep.name); - close_ep (ep); - return -1; - } - debug (handle, 2, "libusb-gadget: set_config: %s opened\n", ep->ep.name); - ep->descriptor = descriptor; - ep->hs_descriptor = hs_descriptor; - ep->handle = handle; - if (handle->event_cb) - { - struct usb_gadget_event event; - - event.type = USG_EVENT_ENDPOINT_ENABLE; - event.u.number = number; - handle->event_cb (handle, &event, handle->event_arg); - } - } - return 0; -} - -static void -setup (struct usb_gadget_dev_handle *handle, struct usb_ctrlrequest *ctrl) -{ - int ret; - uint8_t buf[256]; - uint16_t value = usb_gadget_le16_to_cpu(ctrl->wValue); - uint16_t index = usb_gadget_le16_to_cpu(ctrl->wIndex); - uint16_t length = usb_gadget_le16_to_cpu(ctrl->wLength); - struct _usb_gadget_endpoint *ep; - - debug (handle, 2, - "libusb-gadget: setup: ctrl->bRequestType = %d, ctrl->bRequest = %d, " - "ctrl->wValue = %d, ctrl->wIndex = %d, ctrl->wLength = %d\n", - ctrl->bRequestType, ctrl->bRequest, value, index, length); - switch (ctrl->bRequestType & USB_TYPE_MASK) - { - case USB_TYPE_STANDARD: - switch (ctrl->bRequest) - { - case USB_REQ_GET_DESCRIPTOR: - if (ctrl->bRequestType != USB_DIR_IN) - goto stall; - switch (value >> 8) - { - case USB_DT_DEVICE: - ret = sizeof(struct usb_device_descriptor); - if (ret > length) - ret = length; - write (handle->ep0->fd, handle->device->device, ret); - break; - case USB_DT_CONFIG: - ret = config_buf (buf, value >> 8, - handle->device->hs_config ? - handle->device->hs_config : - handle->device->config); - if (ret < 0) - goto stall; - write (handle->ep0->fd, buf, ret); - break; - case USB_DT_STRING: - ret = usb_gadget_get_string (handle->device->strings, value & 0xff, buf); - if (ret < 0) - goto stall; - if (ret > length) - ret = length; - write (handle->ep0->fd, buf, ret); - break; - default: - goto stall; - } - return; - - case USB_REQ_SET_CONFIGURATION: - if (ctrl->bRequestType != USB_DIR_OUT) - goto stall; - if (set_config (handle, value) < 0) - { - debug (handle, 2, "libusb-gadget: setup: set_config failed\n"); - goto stall; - } - - read (handle->ep0->fd, &ret, 0); - return; - case USB_REQ_GET_INTERFACE: - if (ctrl->bRequestType != (USB_DIR_IN|USB_RECIP_INTERFACE) - || index != 0 - || length > 1) - goto stall; - - buf[0] = 0; - write (handle->ep0->fd, buf, length); - return; - case USB_REQ_SET_INTERFACE: - if (ctrl->bRequestType != USB_RECIP_INTERFACE - || index != 0 - || value != 0) - goto stall; - - ret = 0; - usb_gadget_list_for_each_entry (ep, &handle->ep_list, ep_list) - { - debug (handle, 2, "libusb-gadget: setup: clear halt %s %d %d\n", - ep->ep.name, ep->fd, ret); - if (ep->fd > 0 - /* FIXME: dummy_udc and musb_hdrc don't return from - this ioctl */ - && (strcmp (handle->ep0->ep.name, "dummy_udc") - || strcmp (handle->ep0->ep.name, "musb_hdrc")) - && ioctl (ep->fd, GADGETFS_CLEAR_HALT) < 0) - ret = -1; - } - if (ret < 0) - goto stall; - - read (handle->ep0->fd, &ret, 0); - return; - default: - goto stall; - } - break; - } - -stall: - if (ctrl->bRequestType & USB_DIR_IN) - read (handle->ep0->fd, &ret, 0); - else - write (handle->ep0->fd, &ret, 0); -} - -int -usb_gadget_handle_control_event (usb_gadget_dev_handle *handle) -{ - struct usb_gadgetfs_event events[NEVENT]; - struct usb_gadget_event event; - int ret, nevent, i; - - ret = read (handle->ep0->fd, &events, sizeof(events)); - if (ret < 0) - return ret; - - nevent = ret / sizeof(events[0]); - debug (handle, 2, "libusb-gadget: %d events received\n", nevent); - for (i = 0; i < nevent; i++) - { - debug (handle, 2, "libusb-gadget: event %d\n", events[i].type); - switch (events[i].type) - { - case GADGETFS_SETUP: - setup (handle, &events[i].u.setup); - break; - case GADGETFS_NOP: - break; - case GADGETFS_CONNECT: - if (handle->event_cb) - { - event.type = USG_EVENT_CONNECT; - handle->speed = events[i].u.speed; - debug (handle, 2, "libusb-gadget: connected with speed %d\n", - handle->speed); - handle->event_cb (handle, &event, handle->event_arg); - } - break; - case GADGETFS_DISCONNECT: - if (handle->event_cb) - { - handle->speed = USB_SPEED_UNKNOWN; - event.type = USG_EVENT_DISCONNECT; - handle->event_cb (handle, &event, handle->event_arg); - } - break; - case GADGETFS_SUSPEND: - if (handle->event_cb) - { - event.type = USG_EVENT_SUSPEND; - handle->event_cb (handle, &event, handle->event_arg); - } - break; - default: - break; - } - } -} - -ssize_t -usb_gadget_endpoint_write (struct usb_gadget_endpoint *ep, const void *buf, size_t len, - int timeout) -{ - struct _usb_gadget_endpoint *_ep; - struct usb_endpoint_descriptor *descriptor; - - _ep = usb_gadget_container_of(ep, struct _usb_gadget_endpoint, ep); - if (_ep->fd < 0) - { - debug (_ep->handle, 2, "libusb-gadget: usb_gadget_endpoint_write: %s is closed\n", - ep->name); - errno = EINVAL; - return -1; - } - - if (_ep->handle->speed == USB_SPEED_HIGH) - descriptor = _ep->hs_descriptor; - else - descriptor = _ep->descriptor; - - if (len > usb_gadget_le16_to_cpu(descriptor->wMaxPacketSize)) - { - debug (_ep->handle, 2, "libusb-gadget: usb_gadget_endpoint_write: too long message\n"); - errno = EINVAL; - return -1; - } - - return write (_ep->fd, buf, len); -} - -ssize_t -usb_gadget_endpoint_read (struct usb_gadget_endpoint *ep, void *buf, size_t len, - int timeout) -{ - struct _usb_gadget_endpoint *_ep; - struct usb_endpoint_descriptor *descriptor; - - _ep = usb_gadget_container_of(ep, struct _usb_gadget_endpoint, ep); - if (_ep->fd < 0) - { - debug (_ep->handle, 2, "libusb-gadget: usb_gadget_endpoint_read: %s is closed\n", - ep->name); - errno = EINVAL; - return -1; - } - - if (_ep->handle->speed == USB_SPEED_HIGH) - descriptor = _ep->hs_descriptor; - else - descriptor = _ep->descriptor; - - if (len > usb_gadget_le16_to_cpu(descriptor->wMaxPacketSize)) - { - debug (_ep->handle, 2, "libusb-gadget: usb_gadget_endpoint_read: too long message\n"); - errno = EINVAL; - return -1; - } - - return read (_ep->fd, buf, len); -} - -void -usb_gadget_set_event_cb (usb_gadget_dev_handle *handle, usb_gadget_event_cb cb, void *arg) -{ - handle->event_cb = cb; - handle->event_arg = arg; -} - -int -usb_gadget_control_fd (usb_gadget_dev_handle *handle) -{ - return handle->ep0->fd; -} diff --git a/dji_sdk_manifold_read_cam/include/libusb-gadget/src/usb-gadget.c~ b/dji_sdk_manifold_read_cam/include/libusb-gadget/src/usb-gadget.c~ deleted file mode 100644 index c540ae4..0000000 --- a/dji_sdk_manifold_read_cam/include/libusb-gadget/src/usb-gadget.c~ +++ /dev/null @@ -1,798 +0,0 @@ -/* - * Copyright (C) 2009 Daiki Ueno - * This file is part of libusb-gadget. - * - * libusb-gadget is free software: you can redistribute it and/or modify - * it under the terms of the GNU Lesser General Public License as published by - * the Free Software Foundation, either version 3 of the License, or - * (at your option) any later version. - * - * libusb-gadget is distributed in the hope that it will be useful, - * but WITHOUT ANY WARRANTY; without even the implied warranty of - * MERCHANTABILITY or FITNESS FOR A PARTICULAR PURPOSE. See the - * GNU Lesser General Public License for more details. - * - * You should have received a copy of the GNU Lesser General Public License - * along with Foobar. If not, see . - */ - -#include -#include -#include -#include -#include -#include -#include -#include -#include -#include -#include -#include -#include "config.h" -#if HAVE_LINUX_USB_SUBDIR -#include -#else -#include -#endif -#include "usb-gadget.h" -#include "list.h" - -#define GADGETFS_DEVICE_PATH "/dev/gadget" -#define USB_BUFSIZ (7 * 1024) -#define NEVENT 5 - -struct _usb_gadget_endpoint -{ - struct usb_gadget_endpoint ep; - struct usb_endpoint_descriptor *descriptor, *hs_descriptor; - struct usb_gadget_list_head ep_list; - usb_gadget_dev_handle *handle; - int fd; -}; - -struct usb_gadget_dev_handle -{ - struct _usb_gadget_endpoint *ep0; - struct usb_gadget_device *device; - struct usb_gadget_list_head ep_list; - usb_gadget_event_cb event_cb; - void *event_arg; - int debug_level; - enum usb_device_speed speed; -}; - -static inline void -debug (usb_gadget_dev_handle *handle, int level, const char *format, ...) -{ - va_list ap; - va_start(ap, format); - if (handle->debug_level >= level) - { - vfprintf (stderr, format, ap); - fflush (stderr); - } - va_end(ap); -} - -void -usb_gadget_set_debug_level (usb_gadget_dev_handle *handle, int level) -{ - handle->debug_level = level; -} - -static int -config_buf (void *buf, unsigned buflen, struct usb_descriptor_header **config) -{ - void *p = buf; - int i; - - if (config[0]->bDescriptorType != USB_DT_CONFIG) - { - errno = EINVAL; - return -1; - } - for (i = 0; config[i]; i++) - { - memcpy (p, config[i], config[i]->bLength); - p += config[i]->bLength; - } - - ((struct usb_config_descriptor *)buf)->wTotalLength = - usb_gadget_cpu_to_le16(p - buf); - - return p - buf; -} - -static struct _usb_gadget_endpoint * -find_ep0 (struct usb_gadget_dev_handle *handle) -{ - DIR *dirp; - struct dirent *entry; - static const char *table[] = { - "tegra-udc", /*add by dji*/ - "dummy_udc", - "net2280", - "gfs_udc", - "pxa2xx_udc", - "goku_udc", - "sh_udc", - "omap_udc", - "musb_hdrc", - "at91_udc", - "lh740x_udc", - "atmel_usba_udc", - NULL - }; - struct _usb_gadget_endpoint *ep0 = NULL; - - dirp = opendir (GADGETFS_DEVICE_PATH); - if (!dirp) - return NULL; - - entry = malloc (offsetof(struct dirent, d_name) - + pathconf (GADGETFS_DEVICE_PATH, _PC_NAME_MAX) - + 1); - if (!entry) - { - closedir (dirp); - return NULL; - } - - while (1) - { - struct dirent *result; - int i; - - if (readdir_r (dirp, entry, &result) < 0) - break; - if (!result) - break; - for (i = 0; table[i] && strcmp (table[i], entry->d_name); i++) - ; - if (table[i]) - { - ep0 = malloc (sizeof(*ep0)); - if (!ep0) - break; - usb_gadget_init_list_head (&ep0->ep_list); - ep0->ep.name = strdup (table[i]); - if (!ep0->ep.name) - { - free (ep0); - ep0 = NULL; - break; - } - ep0->fd = -1; - break; - } - } - - free (entry); - closedir (dirp); - - return ep0; -} - -static int -open_ep0 (struct usb_gadget_dev_handle *handle) -{ - int ret; - char buf[USB_BUFSIZ], *p; - struct _usb_gadget_endpoint *ep0 = handle->ep0; - - snprintf (buf, sizeof(buf), "%s/%s", GADGETFS_DEVICE_PATH, ep0->ep.name); - ep0->fd = open (buf, O_RDWR); - if (ep0->fd < 0) - return -1; - - p = buf; - *(uint32_t *)p = 0; /* tag */ - p += sizeof(uint32_t); - - ret = config_buf (p, sizeof(buf) - (p - buf), handle->device->config); - if (ret < 0) - goto error; - p += ret; - - if (handle->device->hs_config) - { - ret = config_buf (p, sizeof(buf) - (p - buf), handle->device->hs_config); - if (ret < 0) - goto error; - p += ret; - } - - memcpy (p, handle->device->device, sizeof(struct usb_device_descriptor)); - p += sizeof(struct usb_device_descriptor); - - if (write (ep0->fd, buf, p - buf) < 0) - { - debug (ep0->handle, 2, "libusb-gadget: open_ep0: can't write config\n"); - goto error; - } - - return 0; - - error: - close (ep0->fd); - ep0->fd = -1; - return -1; -} - -static int -ep_matches (struct usb_gadget_dev_handle *handle, - const char *name, struct usb_endpoint_descriptor *descriptor) -{ - int address = -1, desired_address; - int direction = -1, desired_direction; - int type = -1, desired_type; - - if ('0' <= name[2] && name[2] <= '9') - { - char *endptr; - - address = strtoul (&name[2], &endptr, 10); - if (!strncmp (endptr, "in", 2)) - { - direction = USB_DIR_IN; - endptr += 2; - } - else if (!strncmp (endptr, "out", 3)) - { - direction = USB_DIR_OUT; - endptr += 3; - } - - if (!strcmp (endptr, "-bulk")) - type = USB_ENDPOINT_XFER_BULK; - else if (!strcmp (endptr, "-iso")) - type = USB_ENDPOINT_XFER_ISOC; - else if (!strcmp (endptr, "-int")) - type = USB_ENDPOINT_XFER_INT; - } - - desired_address = descriptor->bEndpointAddress & USB_ENDPOINT_NUMBER_MASK; - if (desired_address && address >= 0 && address != desired_address) - return 0; - desired_direction = descriptor->bEndpointAddress & USB_ENDPOINT_DIR_MASK; - if (direction >= 0 && direction != desired_direction) - return 0; - desired_type = descriptor->bmAttributes & USB_ENDPOINT_XFERTYPE_MASK; - if (type >= 0 && type != desired_type) - return 0; - - return 1; -} - -static struct _usb_gadget_endpoint * -find_ep (struct usb_gadget_dev_handle *handle, - struct usb_endpoint_descriptor *descriptor) -{ - DIR *dirp; - struct dirent *entry; - struct _usb_gadget_endpoint *ep = NULL; - - assert (handle->ep0); - - dirp = opendir (GADGETFS_DEVICE_PATH); - if (!dirp) - return NULL; - - entry = malloc (offsetof(struct dirent, d_name) - + pathconf (GADGETFS_DEVICE_PATH, _PC_NAME_MAX) - + 1); - if (!entry) - { - closedir (dirp); - return NULL; - } - - while (!ep) - { - struct dirent *result; - int i; - - next: - if (readdir_r (dirp, entry, &result) < 0) - break; - if (!result) - break; - - if (strcmp (handle->ep0->ep.name, entry->d_name) && - !strncmp (entry->d_name, "ep", 2)) - { - struct _usb_gadget_endpoint *_ep; - usb_gadget_list_for_each_entry (_ep, &handle->ep_list, ep_list) - { - if (!strcmp (_ep->ep.name, entry->d_name)) - goto next; - } - - if (!ep_matches (handle, entry->d_name, descriptor)) - continue; - - ep = malloc (sizeof(*ep)); - if (!ep) - break; - ep->ep.name = strdup (entry->d_name); - if (!ep->ep.name) - { - free (ep); - ep = NULL; - break; - } - ep->fd = -1; - usb_gadget_init_list_head (&ep->ep_list); - usb_gadget_list_add (&ep->ep_list, &handle->ep_list); - } - } - - free (entry); - closedir (dirp); - return ep; -} - -static int -open_ep (struct _usb_gadget_endpoint *ep, - struct usb_endpoint_descriptor *descriptor, - struct usb_endpoint_descriptor *hs_descriptor) -{ - int ret; - char buf[USB_BUFSIZ], *p; - - snprintf (buf, sizeof(buf), "%s/%s", GADGETFS_DEVICE_PATH, ep->ep.name); - ep->fd = open (buf, O_RDWR); - if (ep->fd < 0) - return -1; - - p = buf; - *(uint32_t *)p = 1; /* tag */ - p += sizeof(uint32_t); - - memcpy (p, descriptor, USB_DT_ENDPOINT_SIZE); - p += USB_DT_ENDPOINT_SIZE; - if (hs_descriptor) - { - memcpy (p, hs_descriptor, USB_DT_ENDPOINT_SIZE); - p += USB_DT_ENDPOINT_SIZE; - } - ret = write (ep->fd, buf, p - buf); - if (ret < 0) - { - debug (ep->handle, 2, "libusb-gadget: open_ep: can't write config\n"); - close (ep->fd); - return -1; - } - - return 0; -} - -static void -close_ep (struct _usb_gadget_endpoint *ep) -{ - assert (ep); - - usb_gadget_list_del (&ep->ep_list); - if (ep->fd > 0) - close (ep->fd); - free (ep->ep.name); - - ep->fd = -1; - ep->ep.name = NULL; -} - -int -usb_gadget_endpoint_close (struct usb_gadget_endpoint *ep) -{ - struct _usb_gadget_endpoint *_ep; - - _ep = usb_gadget_container_of(ep, struct _usb_gadget_endpoint, ep); - close_ep (_ep); - - return 0; -} - -usb_gadget_dev_handle * -usb_gadget_open (struct usb_gadget_device *device) -{ - struct usb_gadget_dev_handle *handle; - - if (!device || !device->device || !device->config) - { - errno = EINVAL; - return NULL; - } - - handle = malloc (sizeof(*handle)); - if (!handle) - goto error; - handle->device = device; - - handle->ep0 = find_ep0 (handle); - if (!handle->ep0) - goto error; - - if (open_ep0 (handle) < 0) - goto error; - - usb_gadget_init_list_head (&handle->ep_list); - return handle; - - error: - if (handle->ep0) - { - close_ep (handle->ep0); - free (handle->ep0); - handle->ep0 = NULL; - } - free (handle); - return NULL; -} - -int -usb_gadget_close (usb_gadget_dev_handle *handle) -{ - struct _usb_gadget_endpoint *ep; - - if (!handle || !handle->ep0) - { - errno = EINVAL; - return -1; - } - close_ep (handle->ep0); - free (handle->ep0); - handle->ep0 = NULL; - - usb_gadget_list_for_each_entry (ep, &handle->ep_list, ep_list) - { - close_ep (ep); - free (ep); - //ep = NULL; - } - - return 0; -} - -struct usb_gadget_endpoint * -usb_gadget_endpoint (usb_gadget_dev_handle *handle, int number) -{ - struct _usb_gadget_endpoint *ep; - - if (number == 0) - return &handle->ep0->ep; - - usb_gadget_list_for_each_entry (ep, &handle->ep_list, ep_list) - if ((ep->descriptor->bEndpointAddress & USB_ENDPOINT_NUMBER_MASK) == number) - return &ep->ep; - - return NULL; -} - -static int -set_config (usb_gadget_dev_handle *handle, int value) -{ - struct usb_descriptor_header **header; - struct usb_config_descriptor *config; - struct _usb_gadget_endpoint *ep; - - if (value == 0) - { - usb_gadget_list_for_each_entry (ep, &handle->ep_list, ep_list) - { - int number; - - number = ep->descriptor->bEndpointAddress & USB_ENDPOINT_NUMBER_MASK; - - close_ep (ep); - if (handle->event_cb) - { - struct usb_gadget_event event; - - event.type = USG_EVENT_ENDPOINT_DISABLE; - event.u.number = number; - handle->event_cb (handle, &event, handle->event_arg); - } - } - return 0; - } - - config = (struct usb_config_descriptor *)handle->device->config[0]; - if (value != config->bConfigurationValue) - { - errno = EINVAL; - return -1; - } - - for (header = handle->device->config; *header; header++) - { - struct usb_descriptor_header **hs_header; - struct usb_endpoint_descriptor *descriptor = NULL, *hs_descriptor = NULL; - struct _usb_gadget_endpoint *ep; - int number; - - if ((*header)->bDescriptorType != USB_DT_ENDPOINT) - continue; - descriptor = (struct usb_endpoint_descriptor *)*header; - number = descriptor->bEndpointAddress & USB_ENDPOINT_NUMBER_MASK; - assert (number); - - if (handle->device->hs_config) - { - for (hs_header = handle->device->hs_config; *hs_header; hs_header++) - { - if ((*hs_header)->bDescriptorType != USB_DT_ENDPOINT) - continue; - hs_descriptor = (struct usb_endpoint_descriptor *)*hs_header; - if ((hs_descriptor->bEndpointAddress & USB_ENDPOINT_NUMBER_MASK) - == number) - break; - } - if (!*hs_header) - hs_descriptor = NULL; - } - ep = find_ep (handle, descriptor); - if (!ep) - { - debug (handle, 2, "libusb-gadget: set_config: find_ep failed\n"); - return -1; - } - if (open_ep (ep, descriptor, hs_descriptor) < 0) - { - debug (handle, 2, "libusb-gadget: set_config: %s open failed\n", - ep->ep.name); - close_ep (ep); - return -1; - } - debug (handle, 2, "libusb-gadget: set_config: %s opened\n", ep->ep.name); - ep->descriptor = descriptor; - ep->hs_descriptor = hs_descriptor; - ep->handle = handle; - if (handle->event_cb) - { - struct usb_gadget_event event; - - event.type = USG_EVENT_ENDPOINT_ENABLE; - event.u.number = number; - handle->event_cb (handle, &event, handle->event_arg); - } - } - return 0; -} - -static void -setup (struct usb_gadget_dev_handle *handle, struct usb_ctrlrequest *ctrl) -{ - int ret; - uint8_t buf[256]; - uint16_t value = usb_gadget_le16_to_cpu(ctrl->wValue); - uint16_t index = usb_gadget_le16_to_cpu(ctrl->wIndex); - uint16_t length = usb_gadget_le16_to_cpu(ctrl->wLength); - struct _usb_gadget_endpoint *ep; - - debug (handle, 2, - "libusb-gadget: setup: ctrl->bRequestType = %d, ctrl->bRequest = %d, " - "ctrl->wValue = %d, ctrl->wIndex = %d, ctrl->wLength = %d\n", - ctrl->bRequestType, ctrl->bRequest, value, index, length); - switch (ctrl->bRequestType & USB_TYPE_MASK) - { - case USB_TYPE_STANDARD: - switch (ctrl->bRequest) - { - case USB_REQ_GET_DESCRIPTOR: - if (ctrl->bRequestType != USB_DIR_IN) - goto stall; - switch (value >> 8) - { - case USB_DT_DEVICE: - ret = sizeof(struct usb_device_descriptor); - if (ret > length) - ret = length; - write (handle->ep0->fd, handle->device->device, ret); - break; - case USB_DT_CONFIG: - ret = config_buf (buf, value >> 8, - handle->device->hs_config ? - handle->device->hs_config : - handle->device->config); - if (ret < 0) - goto stall; - write (handle->ep0->fd, buf, ret); - break; - case USB_DT_STRING: - ret = usb_gadget_get_string (handle->device->strings, value & 0xff, buf); - if (ret < 0) - goto stall; - if (ret > length) - ret = length; - write (handle->ep0->fd, buf, ret); - break; - default: - goto stall; - } - return; - - case USB_REQ_SET_CONFIGURATION: - if (ctrl->bRequestType != USB_DIR_OUT) - goto stall; - if (set_config (handle, value) < 0) - { - debug (handle, 2, "libusb-gadget: setup: set_config failed\n"); - goto stall; - } - - read (handle->ep0->fd, &ret, 0); - return; - case USB_REQ_GET_INTERFACE: - if (ctrl->bRequestType != (USB_DIR_IN|USB_RECIP_INTERFACE) - || index != 0 - || length > 1) - goto stall; - - buf[0] = 0; - write (handle->ep0->fd, buf, length); - return; - case USB_REQ_SET_INTERFACE: - if (ctrl->bRequestType != USB_RECIP_INTERFACE - || index != 0 - || value != 0) - goto stall; - - ret = 0; - usb_gadget_list_for_each_entry (ep, &handle->ep_list, ep_list) - { - debug (handle, 2, "libusb-gadget: setup: clear halt %s %d %d\n", - ep->ep.name, ep->fd, ret); - if (ep->fd > 0 - /* FIXME: dummy_udc and musb_hdrc don't return from - this ioctl */ - && (strcmp (handle->ep0->ep.name, "dummy_udc") - || strcmp (handle->ep0->ep.name, "musb_hdrc")) - && ioctl (ep->fd, GADGETFS_CLEAR_HALT) < 0) - ret = -1; - } - if (ret < 0) - goto stall; - - read (handle->ep0->fd, &ret, 0); - return; - default: - goto stall; - } - break; - } - -stall: - if (ctrl->bRequestType & USB_DIR_IN) - read (handle->ep0->fd, &ret, 0); - else - write (handle->ep0->fd, &ret, 0); -} - -int -usb_gadget_handle_control_event (usb_gadget_dev_handle *handle) -{ - struct usb_gadgetfs_event events[NEVENT]; - struct usb_gadget_event event; - int ret, nevent, i; - - ret = read (handle->ep0->fd, &events, sizeof(events)); - if (ret < 0) - return ret; - - nevent = ret / sizeof(events[0]); - debug (handle, 2, "libusb-gadget: %d events received\n", nevent); - for (i = 0; i < nevent; i++) - { - debug (handle, 2, "libusb-gadget: event %d\n", events[i].type); - switch (events[i].type) - { - case GADGETFS_SETUP: - setup (handle, &events[i].u.setup); - break; - case GADGETFS_NOP: - break; - case GADGETFS_CONNECT: - if (handle->event_cb) - { - event.type = USG_EVENT_CONNECT; - handle->speed = events[i].u.speed; - debug (handle, 2, "libusb-gadget: connected with speed %d\n", - handle->speed); - handle->event_cb (handle, &event, handle->event_arg); - } - break; - case GADGETFS_DISCONNECT: - if (handle->event_cb) - { - handle->speed = USB_SPEED_UNKNOWN; - event.type = USG_EVENT_DISCONNECT; - handle->event_cb (handle, &event, handle->event_arg); - } - break; - case GADGETFS_SUSPEND: - if (handle->event_cb) - { - event.type = USG_EVENT_SUSPEND; - handle->event_cb (handle, &event, handle->event_arg); - } - break; - default: - break; - } - } -} - -ssize_t -usb_gadget_endpoint_write (struct usb_gadget_endpoint *ep, const void *buf, size_t len, - int timeout) -{ - struct _usb_gadget_endpoint *_ep; - struct usb_endpoint_descriptor *descriptor; - - _ep = usb_gadget_container_of(ep, struct _usb_gadget_endpoint, ep); - if (_ep->fd < 0) - { - debug (_ep->handle, 2, "libusb-gadget: usb_gadget_endpoint_write: %s is closed\n", - ep->name); - errno = EINVAL; - return -1; - } - - if (_ep->handle->speed == USB_SPEED_HIGH) - descriptor = _ep->hs_descriptor; - else - descriptor = _ep->descriptor; - - if (len > usb_gadget_le16_to_cpu(descriptor->wMaxPacketSize)) - { - debug (_ep->handle, 2, "libusb-gadget: usb_gadget_endpoint_write: too long message\n"); - errno = EINVAL; - return -1; - } - - return write (_ep->fd, buf, len); -} - -ssize_t -usb_gadget_endpoint_read (struct usb_gadget_endpoint *ep, void *buf, size_t len, - int timeout) -{ - struct _usb_gadget_endpoint *_ep; - struct usb_endpoint_descriptor *descriptor; - - _ep = usb_gadget_container_of(ep, struct _usb_gadget_endpoint, ep); - if (_ep->fd < 0) - { - debug (_ep->handle, 2, "libusb-gadget: usb_gadget_endpoint_read: %s is closed\n", - ep->name); - errno = EINVAL; - return -1; - } - - if (_ep->handle->speed == USB_SPEED_HIGH) - descriptor = _ep->hs_descriptor; - else - descriptor = _ep->descriptor; - - if (len > usb_gadget_le16_to_cpu(descriptor->wMaxPacketSize)) - { - debug (_ep->handle, 2, "libusb-gadget: usb_gadget_endpoint_read: too long message\n"); - errno = EINVAL; - return -1; - } - - return read (_ep->fd, buf, len); -} - -void -usb_gadget_set_event_cb (usb_gadget_dev_handle *handle, usb_gadget_event_cb cb, void *arg) -{ - handle->event_cb = cb; - handle->event_arg = arg; -} - -int -usb_gadget_control_fd (usb_gadget_dev_handle *handle) -{ - return handle->ep0->fd; -} diff --git a/dji_sdk_manifold_read_cam/include/libusb-gadget/src/usb-gadget.h b/dji_sdk_manifold_read_cam/include/libusb-gadget/src/usb-gadget.h deleted file mode 100644 index 9637253..0000000 --- a/dji_sdk_manifold_read_cam/include/libusb-gadget/src/usb-gadget.h +++ /dev/null @@ -1,102 +0,0 @@ -/* - * Copyright (C) 2009 Daiki Ueno - * This file is part of libusb-gadget. - * - * libusb-gadget is free software: you can redistribute it and/or modify - * it under the terms of the GNU Lesser General Public License as published by - * the Free Software Foundation, either version 3 of the License, or - * (at your option) any later version. - * - * libusb-gadget is distributed in the hope that it will be useful, - * but WITHOUT ANY WARRANTY; without even the implied warranty of - * MERCHANTABILITY or FITNESS FOR A PARTICULAR PURPOSE. See the - * GNU Lesser General Public License for more details. - * - * You should have received a copy of the GNU Lesser General Public License - * along with Foobar. If not, see . - */ - -#ifndef __USG_H -#define __USG_H - -#include -#include -#include - -/* borrowed from libusb/libusb.h */ -#define usb_gadget_bswap16(x) (((x & 0xFF) << 8) | (x >> 8)) -#define usb_gadget_bswap32(x) ((usb_gadget_bswap16(x & 0xFFFF) << 16) | usb_gadget_bswap16(x >> 16)) -/* borrowed from libusb/libusb.h */ -#if __BYTE_ORDER == __LITTLE_ENDIAN -#define usb_gadget_cpu_to_le16(x) (x) -#define usb_gadget_le16_to_cpu(x) (x) -#define usb_gadget_cpu_to_le32(x) (x) -#define usb_gadget_le32_to_cpu(x) (x) -#elif __BYTE_ORDER == __BIG_ENDIAN -#define usb_gadget_cpu_to_le16(x) usb_gadget_bswap16(x) -#define usb_gadget_le16_to_cpu(x) usb_gadget_bswap16(x) -#define usb_gadget_cpu_to_le32(x) usb_gadget_bswap32(x) -#define usb_gadget_le32_to_cpu(x) usb_gadget_bswap32(x) -#else -#error "Unrecognized endianness" -#endif - -struct usb_gadget_string -{ - uint8_t id; - const char *s; -}; - -struct usb_gadget_strings -{ - uint16_t language; /* 0x0409 for en-us */ - struct usb_gadget_string *strings; -}; - -struct usb_gadget_endpoint -{ - char *name; -}; - -enum usb_gadget_event_type { - USG_EVENT_ENDPOINT_ENABLE, - USG_EVENT_ENDPOINT_DISABLE, - USG_EVENT_CONNECT, - USG_EVENT_DISCONNECT, - USG_EVENT_SUSPEND -}; - -struct usb_gadget_event -{ - enum usb_gadget_event_type type; - union - { - int number; - } u; -}; - -struct usb_gadget_dev_handle; -typedef struct usb_gadget_dev_handle usb_gadget_dev_handle; - -struct usb_gadget_device -{ - struct usb_device_descriptor *device; - struct usb_descriptor_header **config, **hs_config; - struct usb_gadget_strings *strings; -}; - -struct usb_gadget_endpoint *usb_gadget_endpoint (usb_gadget_dev_handle *, int); -int usb_gadget_endpoint_close (struct usb_gadget_endpoint *); -ssize_t usb_gadget_endpoint_write (struct usb_gadget_endpoint *, const void *, size_t, int); -ssize_t usb_gadget_endpoint_read (struct usb_gadget_endpoint *, void *, size_t, int); - -usb_gadget_dev_handle *usb_gadget_open (struct usb_gadget_device *); -int usb_gadget_close (usb_gadget_dev_handle *); - -typedef void (*usb_gadget_event_cb) (usb_gadget_dev_handle *, struct usb_gadget_event *, void *); -void usb_gadget_set_event_cb (usb_gadget_dev_handle *, usb_gadget_event_cb, void *); -void usb_gadget_set_debug_level (usb_gadget_dev_handle *, int); -int usb_gadget_handle_control_event (usb_gadget_dev_handle *); -int usb_gadget_control_fd (usb_gadget_dev_handle *); - -#endif diff --git a/dji_sdk_manifold_read_cam/include/libusb-gadget/src/usbstring.c b/dji_sdk_manifold_read_cam/include/libusb-gadget/src/usbstring.c deleted file mode 100644 index 6dbe39f..0000000 --- a/dji_sdk_manifold_read_cam/include/libusb-gadget/src/usbstring.c +++ /dev/null @@ -1,144 +0,0 @@ -/* - * Copyright (C) 2003 David Brownell - * - * This program is free software; you can redistribute it and/or modify - * it under the terms of the GNU Lesser General Public License as published - * by the Free Software Foundation; either version 2.1 of the License, or - * (at your option) any later version. - */ - -#include -#include -#include "config.h" -#if HAVE_LINUX_USB_SUBDIR -#include -#else -#include -#endif -#include "usb-gadget.h" - -static inline void put_unaligned_le16(uint16_t val, uint16_t *cp) -{ - uint8_t *p = (void *)cp; - - *p++ = (uint8_t) val; - *p++ = (uint8_t) (val >> 8); -} - -static int utf8_to_utf16le(const char *s, uint16_t *cp, unsigned len) -{ - int count = 0; - uint8_t c; - uint16_t uchar; - - /* this insists on correct encodings, though not minimal ones. - * BUT it currently rejects legit 4-byte UTF-8 code points, - * which need surrogate pairs. (Unicode 3.1 can use them.) - */ - while (len != 0 && (c = (uint8_t) *s++) != 0) { - if (c & 0x80) { - // 2-byte sequence: - // 00000yyyyyxxxxxx = 110yyyyy 10xxxxxx - if ((c & 0xe0) == 0xc0) { - uchar = (c & 0x1f) << 6; - - c = (uint8_t) *s++; - if ((c & 0xc0) != 0xc0) - goto fail; - c &= 0x3f; - uchar |= c; - - // 3-byte sequence (most CJKV characters): - // zzzzyyyyyyxxxxxx = 1110zzzz 10yyyyyy 10xxxxxx - } else if ((c & 0xf0) == 0xe0) { - uchar = (c & 0x0f) << 12; - - c = (uint8_t) *s++; - if ((c & 0xc0) != 0xc0) - goto fail; - c &= 0x3f; - uchar |= c << 6; - - c = (uint8_t) *s++; - if ((c & 0xc0) != 0xc0) - goto fail; - c &= 0x3f; - uchar |= c; - - /* no bogus surrogates */ - if (0xd800 <= uchar && uchar <= 0xdfff) - goto fail; - - // 4-byte sequence (surrogate pairs, currently rare): - // 11101110wwwwzzzzyy + 110111yyyyxxxxxx - // = 11110uuu 10uuzzzz 10yyyyyy 10xxxxxx - // (uuuuu = wwww + 1) - // FIXME accept the surrogate code points (only) - - } else - goto fail; - } else - uchar = c; - put_unaligned_le16 (uchar, cp++); - count++; - len--; - } - return count; -fail: - return -1; -} - - -/** - * usb_gadget_get_string - fill out a string descriptor - * @table: of c strings encoded using UTF-8 - * @id: string id, from low byte of wValue in get string descriptor - * @buf: at least 256 bytes - * - * Finds the UTF-8 string matching the ID, and converts it into a - * string descriptor in utf16-le. - * Returns length of descriptor (always even) or negative errno - * - * If your driver needs strings in multiple languages, you'll probably - * "switch (wIndex) { ... }" in your ep0 string descriptor logic, - * using this routine after choosing which set of UTF-8 strings to use. - * - * Note that US-ASCII is a strict subset of UTF-8; any string bytes with - * the eighth bit set will be multibyte UTF-8 characters, not ISO-8859/1 - * characters. - */ -int -usb_gadget_get_string (struct usb_gadget_strings *table, int id, uint8_t *buf) -{ - struct usb_gadget_string *s; - int len; - - /* descriptor 0 has the language id */ - if (id == 0) { - buf [0] = 4; - buf [1] = USB_DT_STRING; - buf [2] = (uint8_t) table->language; - buf [3] = (uint8_t) (table->language >> 8); - return 4; - } - for (s = table->strings; s && s->s; s++) - if (s->id == id) - break; - - /* unrecognized: stall. */ - if (!s || !s->s) - return -EINVAL; - - /* string descriptors have length, tag, then UTF16-LE text */ - len = strlen (s->s); - if (len > 126) - len = 126; - memset (buf + 2, 0, 2 * len); /* zero all the bytes */ - len = utf8_to_utf16le(s->s, (uint16_t *)&buf[2], len); - if (len < 0) - return -EINVAL; - buf [0] = (len + 1) * 2; - buf [1] = USB_DT_STRING; - return buf [0]; -} - diff --git a/dji_sdk_manifold_read_cam/include/libusb-gadget/tests/.gitignore b/dji_sdk_manifold_read_cam/include/libusb-gadget/tests/.gitignore deleted file mode 100644 index 282522d..0000000 --- a/dji_sdk_manifold_read_cam/include/libusb-gadget/tests/.gitignore +++ /dev/null @@ -1,2 +0,0 @@ -Makefile -Makefile.in diff --git a/dji_sdk_manifold_read_cam/include/libusb-gadget/tests/Makefile.am b/dji_sdk_manifold_read_cam/include/libusb-gadget/tests/Makefile.am deleted file mode 100644 index b688489..0000000 --- a/dji_sdk_manifold_read_cam/include/libusb-gadget/tests/Makefile.am +++ /dev/null @@ -1,7 +0,0 @@ -noinst_PROGRAMS = loopback loopback-test - -loopback_SOURCES = loopback.c -loopback_LDADD = -L$(top_srcdir)/src -lusb-gadget -lpthread - -loopback_test_SOURCES = loopback-test.c -loopback_test_LDADD = $(libusb_LIBS) diff --git a/dji_sdk_manifold_read_cam/include/libusb-gadget/tests/loopback-test.c b/dji_sdk_manifold_read_cam/include/libusb-gadget/tests/loopback-test.c deleted file mode 100644 index 5e21337..0000000 --- a/dji_sdk_manifold_read_cam/include/libusb-gadget/tests/loopback-test.c +++ /dev/null @@ -1,88 +0,0 @@ -/* - * Copyright (C) 2009 Daiki Ueno - * This file is part of libusb-gadget. - * - * libusb-gadget is free software: you can redistribute it and/or modify - * it under the terms of the GNU Lesser General Public License as published by - * the Free Software Foundation, either version 3 of the License, or - * (at your option) any later version. - * - * libusb-gadget is distributed in the hope that it will be useful, - * but WITHOUT ANY WARRANTY; without even the implied warranty of - * MERCHANTABILITY or FITNESS FOR A PARTICULAR PURPOSE. See the - * GNU Lesser General Public License for more details. - * - * You should have received a copy of the GNU Lesser General Public License - * along with Foobar. If not, see . - */ - -#include -#include -#include -#include - -int main (int argc, char **argv) -{ - struct usb_device *dev = NULL; - struct usb_bus *bus; - usb_dev_handle *handle; - int vendor_id, product_id; - - if (argc != 2 || sscanf (argv[1], "%X:%X", &vendor_id, &product_id) < 2) - { - fprintf (stderr, "Usage: %s VEND:PROD\n", argv[0]); - return 1; - } - - usb_init (); - usb_set_debug (2); - usb_find_busses (); - usb_find_devices (); - - for (bus = usb_busses; bus && !dev; bus = bus->next) - for (dev = bus->devices; dev; dev = dev->next) - if (dev->descriptor.idVendor == vendor_id - && dev->descriptor.idProduct == product_id) - break; - - if (!dev) - { - fprintf (stderr, "Can't find device %04X:%04X\n", vendor_id, product_id); - return 1; - } - - handle = usb_open (dev); - usb_claim_interface (handle, 0); - - while (1) - { - char buf[BUFSIZ], *p; - int ret; - - memset (buf, 0, sizeof(buf)); - printf ("Write some text: "); - fflush (stdout); - if (fgets (buf, 512, stdin) == NULL) - break; - p = strchr (buf, '\n'); - if (p) - *p = '\0'; - ret = usb_bulk_write (handle, 3, buf, strlen (buf), 100); - if (ret < 0) - { - perror ("usb_bulk_write"); - continue; - } - ret = usb_bulk_read (handle, 7, buf, sizeof(buf), 100); - if (ret < 0) - perror ("usb_bulk_read"); - printf ("Text from the USB device: "); - fflush (stdout); - write (fileno(stdout), buf, ret); - putchar ('\n'); - } - usb_release_interface (handle, 0); - usb_close (handle); - - return 0; -} diff --git a/dji_sdk_manifold_read_cam/include/libusb-gadget/tests/loopback.c b/dji_sdk_manifold_read_cam/include/libusb-gadget/tests/loopback.c deleted file mode 100644 index 1676d61..0000000 --- a/dji_sdk_manifold_read_cam/include/libusb-gadget/tests/loopback.c +++ /dev/null @@ -1,303 +0,0 @@ -/* - * Copyright (C) 2009 Daiki Ueno - * This file is part of libusb-gadget. - * - * libusb-gadget is free software: you can redistribute it and/or modify - * it under the terms of the GNU Lesser General Public License as published by - * the Free Software Foundation, either version 3 of the License, or - * (at your option) any later version. - * - * libusb-gadget is distributed in the hope that it will be useful, - * but WITHOUT ANY WARRANTY; without even the implied warranty of - * MERCHANTABILITY or FITNESS FOR A PARTICULAR PURPOSE. See the - * GNU Lesser General Public License for more details. - * - * You should have received a copy of the GNU Lesser General Public License - * along with Foobar. If not, see . - */ - -#include -#include -#include -#include -#include -#include -#include "config.h" -#if HAVE_LINUX_USB_SUBDIR -#include -#else -#include -#endif -#include - -/* /dev/gadget/ep* doesn't support poll, we have to use an alternative - approach. */ -#include - -#define STRING_MANUFACTURER 25 -#define STRING_PRODUCT 45 -#define STRING_SERIAL 101 -#define STRING_LOOPBACK 250 - -static struct usb_gadget_string strings[] = { - {STRING_MANUFACTURER, "The manufacturer",}, - {STRING_PRODUCT, "The product",}, - {STRING_SERIAL, "0123456789.0123456789.0123456789",}, - {STRING_LOOPBACK, "The loopback",}, -}; - -static struct usb_gadget_strings loopback_strings = { - .language = 0x0409, /* en-us */ - .strings = strings -}; - -#define CONFIG_LOOPBACK 2 - -static struct usb_device_descriptor loopback_device_descriptor = { - .bLength = sizeof(loopback_device_descriptor), - .bDescriptorType = USB_DT_DEVICE, - - .bcdUSB = usb_gadget_cpu_to_le16(0x0200), - .bDeviceClass = USB_CLASS_VENDOR_SPEC, - - .iManufacturer = usb_gadget_cpu_to_le16(STRING_MANUFACTURER), - .iProduct = usb_gadget_cpu_to_le16(STRING_PRODUCT), - .iSerialNumber = usb_gadget_cpu_to_le16(STRING_SERIAL), - .bNumConfigurations = 1, -}; - -static struct usb_config_descriptor loopback_config_descriptor = { - .bLength = sizeof(loopback_config_descriptor), - .bDescriptorType = USB_DT_CONFIG, - - .bNumInterfaces = 1, - .bConfigurationValue = CONFIG_LOOPBACK, - .iConfiguration = STRING_LOOPBACK, - .bmAttributes = USB_CONFIG_ATT_ONE | USB_CONFIG_ATT_SELFPOWER, - .bMaxPower = 1, /* self-powered */ -}; - -static const struct usb_interface_descriptor loopback_interface_descriptor = { - .bLength = sizeof(loopback_interface_descriptor), - .bDescriptorType = USB_DT_INTERFACE, - - .bNumEndpoints = 2, - .bInterfaceClass = USB_CLASS_VENDOR_SPEC, - .iInterface = STRING_LOOPBACK, -}; - -static struct usb_endpoint_descriptor loopback_ep_in_descriptor = { - .bLength = USB_DT_ENDPOINT_SIZE, - .bDescriptorType = USB_DT_ENDPOINT, - - .bEndpointAddress = USB_DIR_IN | 7, /* number is mandatory for gadgetfs */ - .bmAttributes = USB_ENDPOINT_XFER_BULK, - .wMaxPacketSize = usb_gadget_cpu_to_le16(64), /* mandatory for gadgetfs */ -}; - -static struct usb_endpoint_descriptor loopback_ep_out_descriptor = { - .bLength = USB_DT_ENDPOINT_SIZE, - .bDescriptorType = USB_DT_ENDPOINT, - - .bEndpointAddress = USB_DIR_OUT | 3, /* number is mandatory for gadgetfs */ - .bmAttributes = USB_ENDPOINT_XFER_BULK, - .wMaxPacketSize = usb_gadget_cpu_to_le16(64), /* mandatory for gadgetfs */ -}; - -static struct usb_endpoint_descriptor loopback_hs_ep_in_descriptor = { - .bLength = USB_DT_ENDPOINT_SIZE, - .bDescriptorType = USB_DT_ENDPOINT, - - .bEndpointAddress = USB_DIR_IN | 7, /* number is mandatory for gadgetfs */ - .bmAttributes = USB_ENDPOINT_XFER_BULK, - .wMaxPacketSize = usb_gadget_cpu_to_le16(512), /* mandatory for gadgetfs */ -}; - -static struct usb_endpoint_descriptor loopback_hs_ep_out_descriptor = { - .bLength = USB_DT_ENDPOINT_SIZE, - .bDescriptorType = USB_DT_ENDPOINT, - - .bEndpointAddress = USB_DIR_OUT | 3, /* number is mandatory for gadgetfs */ - .bmAttributes = USB_ENDPOINT_XFER_BULK, - .wMaxPacketSize = usb_gadget_cpu_to_le16(512), /* mandatory for gadgetfs */ -}; - -static struct usb_descriptor_header *loopback_config[] = { - (struct usb_descriptor_header *)&loopback_config_descriptor, - (struct usb_descriptor_header *)&loopback_interface_descriptor, - (struct usb_descriptor_header *)&loopback_ep_in_descriptor, - (struct usb_descriptor_header *)&loopback_ep_out_descriptor, - NULL, -}; - -static struct usb_descriptor_header *loopback_hs_config[] = { - (struct usb_descriptor_header *)&loopback_config_descriptor, - (struct usb_descriptor_header *)&loopback_interface_descriptor, - (struct usb_descriptor_header *)&loopback_hs_ep_in_descriptor, - (struct usb_descriptor_header *)&loopback_hs_ep_out_descriptor, - NULL, -}; - -static struct usb_gadget_endpoint *loopback_ep_in, *loopback_ep_out; -static pthread_t loopback_thread; - -static void -loopback_stop_endpoints (void *data) -{ - usb_gadget_endpoint_close (loopback_ep_in); - usb_gadget_endpoint_close (loopback_ep_out); -} - -static void* -loopback_loop (void *data) -{ - char buf[BUFSIZ]; - int ret; - - pthread_cleanup_push (loopback_stop_endpoints, NULL); - while (1) - { - int i; - - pthread_testcancel (); - ret = usb_gadget_endpoint_read (loopback_ep_out, buf, 64, 100); - if (ret < 0) - { - perror ("usb_gadget_endpoint_read"); - break; - } - for (i = 0; i < ret / 2; i++) - { - char c; - c = buf[i]; - buf[i] = buf[ret - i - 1]; - buf[ret - i - 1] = c; - } - if (usb_gadget_endpoint_write (loopback_ep_in, buf, ret, 100) < 0) - { - perror ("usb_gadget_endpoint_write"); - break; - } - } - pthread_cleanup_pop (1); -} - -static void -loopback_event_cb (usb_gadget_dev_handle *handle, struct usb_gadget_event *event, void *arg) -{ - switch (event->type) - { - case USG_EVENT_ENDPOINT_ENABLE: - if (event->u.number == (loopback_ep_in_descriptor.bEndpointAddress - & USB_ENDPOINT_NUMBER_MASK)) - loopback_ep_in = usb_gadget_endpoint (handle, event->u.number); - else if (event->u.number == (loopback_ep_out_descriptor.bEndpointAddress - & USB_ENDPOINT_NUMBER_MASK)) - loopback_ep_out = usb_gadget_endpoint (handle, event->u.number); - - if (!loopback_ep_in || !loopback_ep_out) - return; - - if (pthread_create (&loopback_thread, 0, loopback_loop, NULL) != 0) - perror ("pthread_create"); - break; - case USG_EVENT_ENDPOINT_DISABLE: - if (event->u.number == (loopback_ep_in_descriptor.bEndpointAddress - & USB_ENDPOINT_NUMBER_MASK)) - loopback_ep_in = NULL; - else if (event->u.number == (loopback_ep_out_descriptor.bEndpointAddress - & USB_ENDPOINT_NUMBER_MASK)) - loopback_ep_out = NULL; - case USG_EVENT_DISCONNECT: /* FALLTHROUGH */ - if (loopback_thread) - pthread_cancel (loopback_thread); - break; - } -} - -static char *program_name; - -static void -usage (FILE *out) -{ - fprintf (out, "Usage: %s [OPTIONS] VEND:PROD\n" - "Options are:\n" - "\t--debug=LEVEL, -d\tSpecify debug level\n" - "\t--help, -h\tShow this help\n", - program_name); -} - -int main (int argc, char **argv) -{ - struct usb_gadget_device device = { - .device = &loopback_device_descriptor, - .config = loopback_config, - .hs_config = loopback_hs_config, - .strings = &loopback_strings, - }; - usb_gadget_dev_handle *handle; - struct usb_gadget_endpoint *ep0; - struct pollfd fds; - int vendor_id, product_id, c, debug_level = 0; - struct option long_options[] = { - {"debug", 1, 0, 'd'}, - {"help", 0, 0, 'h'}, - {0, 0, 0, 0} - }; - program_name = argv[0]; - - while (1) - { - int option_index = 0; - - c = getopt_long (argc, argv, "hd:", long_options, &option_index); - if (c == -1) - break; - switch (c) - { - case 'd': - debug_level = atoi (optarg); - break; - case 'h': - usage (stdout); - exit (0); - default: - usage (stderr); - exit (1); - } - } - - if ((argc - optind) != 1 - || sscanf (argv[optind], "%X:%X", &vendor_id, &product_id) != 2) - { - usage (stderr); - exit (1); - } - - loopback_device_descriptor.idVendor = vendor_id; - loopback_device_descriptor.idProduct = product_id; - handle = usb_gadget_open (&device); - if (!handle) - { - fprintf (stderr, "Couldn't open device.\n"); - exit (1); - } - usb_gadget_set_event_cb (handle, loopback_event_cb, NULL); - usb_gadget_set_debug_level (handle, debug_level); - ep0 = usb_gadget_endpoint (handle, 0); - fds.fd = usb_gadget_control_fd (handle); - fds.events = POLLIN; - while (1) - { - if (poll (&fds, 1, -1) < 0) - { - perror ("poll"); - break; - } - if (fds.revents & POLLIN) - usb_gadget_handle_control_event (handle); - } - usb_gadget_close (handle); - - return 0; -} diff --git a/dji_sdk_manifold_read_cam/include/sdl/SDL.h b/dji_sdk_manifold_read_cam/include/sdl/SDL.h deleted file mode 100644 index 6087b7c..0000000 --- a/dji_sdk_manifold_read_cam/include/sdl/SDL.h +++ /dev/null @@ -1,101 +0,0 @@ -/* - SDL - Simple DirectMedia Layer - Copyright (C) 1997-2012 Sam Lantinga - - This library is free software; you can redistribute it and/or - modify it under the terms of the GNU Lesser General Public - License as published by the Free Software Foundation; either - version 2.1 of the License, or (at your option) any later version. - - This library is distributed in the hope that it will be useful, - but WITHOUT ANY WARRANTY; without even the implied warranty of - MERCHANTABILITY or FITNESS FOR A PARTICULAR PURPOSE. See the GNU - Lesser General Public License for more details. - - You should have received a copy of the GNU Lesser General Public - License along with this library; if not, write to the Free Software - Foundation, Inc., 51 Franklin St, Fifth Floor, Boston, MA 02110-1301 USA - - Sam Lantinga - slouken@libsdl.org -*/ - -/** @file SDL.h - * Main include header for the SDL library - */ - -#ifndef _SDL_H -#define _SDL_H - -#include "SDL_main.h" -#include "SDL_stdinc.h" -#include "SDL_audio.h" -#include "SDL_cdrom.h" -#include "SDL_cpuinfo.h" -#include "SDL_endian.h" -#include "SDL_error.h" -#include "SDL_events.h" -#include "SDL_loadso.h" -#include "SDL_mutex.h" -#include "SDL_rwops.h" -#include "SDL_thread.h" -#include "SDL_timer.h" -#include "SDL_video.h" -#include "SDL_version.h" - -#include "begin_code.h" -/* Set up for C function definitions, even when using C++ */ -#ifdef __cplusplus -extern "C" { -#endif - -/** @file SDL.h - * @note As of version 0.5, SDL is loaded dynamically into the application - */ - -/** @name SDL_INIT Flags - * These are the flags which may be passed to SDL_Init() -- you should - * specify the subsystems which you will be using in your application. - */ -/*@{*/ -#define SDL_INIT_TIMER 0x00000001 -#define SDL_INIT_AUDIO 0x00000010 -#define SDL_INIT_VIDEO 0x00000020 -#define SDL_INIT_CDROM 0x00000100 -#define SDL_INIT_JOYSTICK 0x00000200 -#define SDL_INIT_NOPARACHUTE 0x00100000 /**< Don't catch fatal signals */ -#define SDL_INIT_EVENTTHREAD 0x01000000 /**< Not supported on all OS's */ -#define SDL_INIT_EVERYTHING 0x0000FFFF -/*@}*/ - -/** This function loads the SDL dynamically linked library and initializes - * the subsystems specified by 'flags' (and those satisfying dependencies) - * Unless the SDL_INIT_NOPARACHUTE flag is set, it will install cleanup - * signal handlers for some commonly ignored fatal signals (like SIGSEGV) - */ -extern DECLSPEC int SDLCALL SDL_Init(Uint32 flags); - -/** This function initializes specific SDL subsystems */ -extern DECLSPEC int SDLCALL SDL_InitSubSystem(Uint32 flags); - -/** This function cleans up specific SDL subsystems */ -extern DECLSPEC void SDLCALL SDL_QuitSubSystem(Uint32 flags); - -/** This function returns mask of the specified subsystems which have - * been initialized. - * If 'flags' is 0, it returns a mask of all initialized subsystems. - */ -extern DECLSPEC Uint32 SDLCALL SDL_WasInit(Uint32 flags); - -/** This function cleans up all initialized subsystems and unloads the - * dynamically linked library. You should call it upon all exit conditions. - */ -extern DECLSPEC void SDLCALL SDL_Quit(void); - -/* Ends C function definitions when using C++ */ -#ifdef __cplusplus -} -#endif -#include "close_code.h" - -#endif /* _SDL_H */ diff --git a/dji_sdk_manifold_read_cam/include/sdl/SDL_active.h b/dji_sdk_manifold_read_cam/include/sdl/SDL_active.h deleted file mode 100644 index cd854e8..0000000 --- a/dji_sdk_manifold_read_cam/include/sdl/SDL_active.h +++ /dev/null @@ -1,63 +0,0 @@ -/* - SDL - Simple DirectMedia Layer - Copyright (C) 1997-2012 Sam Lantinga - - This library is free software; you can redistribute it and/or - modify it under the terms of the GNU Lesser General Public - License as published by the Free Software Foundation; either - version 2.1 of the License, or (at your option) any later version. - - This library is distributed in the hope that it will be useful, - but WITHOUT ANY WARRANTY; without even the implied warranty of - MERCHANTABILITY or FITNESS FOR A PARTICULAR PURPOSE. See the GNU - Lesser General Public License for more details. - - You should have received a copy of the GNU Lesser General Public - License along with this library; if not, write to the Free Software - Foundation, Inc., 51 Franklin St, Fifth Floor, Boston, MA 02110-1301 USA - - Sam Lantinga - slouken@libsdl.org -*/ - -/** - * @file SDL_active.h - * Include file for SDL application focus event handling - */ - -#ifndef _SDL_active_h -#define _SDL_active_h - -#include "SDL_stdinc.h" -#include "SDL_error.h" - -#include "begin_code.h" -/* Set up for C function definitions, even when using C++ */ -#ifdef __cplusplus -extern "C" { -#endif - -/** @name The available application states */ -/*@{*/ -#define SDL_APPMOUSEFOCUS 0x01 /**< The app has mouse coverage */ -#define SDL_APPINPUTFOCUS 0x02 /**< The app has input focus */ -#define SDL_APPACTIVE 0x04 /**< The application is active */ -/*@}*/ - -/* Function prototypes */ -/** - * This function returns the current state of the application, which is a - * bitwise combination of SDL_APPMOUSEFOCUS, SDL_APPINPUTFOCUS, and - * SDL_APPACTIVE. If SDL_APPACTIVE is set, then the user is able to - * see your application, otherwise it has been iconified or disabled. - */ -extern DECLSPEC Uint8 SDLCALL SDL_GetAppState(void); - - -/* Ends C function definitions when using C++ */ -#ifdef __cplusplus -} -#endif -#include "close_code.h" - -#endif /* _SDL_active_h */ diff --git a/dji_sdk_manifold_read_cam/include/sdl/SDL_audio.h b/dji_sdk_manifold_read_cam/include/sdl/SDL_audio.h deleted file mode 100644 index e879c98..0000000 --- a/dji_sdk_manifold_read_cam/include/sdl/SDL_audio.h +++ /dev/null @@ -1,284 +0,0 @@ -/* - SDL - Simple DirectMedia Layer - Copyright (C) 1997-2012 Sam Lantinga - - This library is free software; you can redistribute it and/or - modify it under the terms of the GNU Lesser General Public - License as published by the Free Software Foundation; either - version 2.1 of the License, or (at your option) any later version. - - This library is distributed in the hope that it will be useful, - but WITHOUT ANY WARRANTY; without even the implied warranty of - MERCHANTABILITY or FITNESS FOR A PARTICULAR PURPOSE. See the GNU - Lesser General Public License for more details. - - You should have received a copy of the GNU Lesser General Public - License along with this library; if not, write to the Free Software - Foundation, Inc., 51 Franklin St, Fifth Floor, Boston, MA 02110-1301 USA - - Sam Lantinga - slouken@libsdl.org -*/ - -/** - * @file SDL_audio.h - * Access to the raw audio mixing buffer for the SDL library - */ - -#ifndef _SDL_audio_h -#define _SDL_audio_h - -#include "SDL_stdinc.h" -#include "SDL_error.h" -#include "SDL_endian.h" -#include "SDL_mutex.h" -#include "SDL_thread.h" -#include "SDL_rwops.h" - -#include "begin_code.h" -/* Set up for C function definitions, even when using C++ */ -#ifdef __cplusplus -extern "C" { -#endif - -/** - * When filling in the desired audio spec structure, - * - 'desired->freq' should be the desired audio frequency in samples-per-second. - * - 'desired->format' should be the desired audio format. - * - 'desired->samples' is the desired size of the audio buffer, in samples. - * This number should be a power of two, and may be adjusted by the audio - * driver to a value more suitable for the hardware. Good values seem to - * range between 512 and 8096 inclusive, depending on the application and - * CPU speed. Smaller values yield faster response time, but can lead - * to underflow if the application is doing heavy processing and cannot - * fill the audio buffer in time. A stereo sample consists of both right - * and left channels in LR ordering. - * Note that the number of samples is directly related to time by the - * following formula: ms = (samples*1000)/freq - * - 'desired->size' is the size in bytes of the audio buffer, and is - * calculated by SDL_OpenAudio(). - * - 'desired->silence' is the value used to set the buffer to silence, - * and is calculated by SDL_OpenAudio(). - * - 'desired->callback' should be set to a function that will be called - * when the audio device is ready for more data. It is passed a pointer - * to the audio buffer, and the length in bytes of the audio buffer. - * This function usually runs in a separate thread, and so you should - * protect data structures that it accesses by calling SDL_LockAudio() - * and SDL_UnlockAudio() in your code. - * - 'desired->userdata' is passed as the first parameter to your callback - * function. - * - * @note The calculated values in this structure are calculated by SDL_OpenAudio() - * - */ -typedef struct SDL_AudioSpec { - int freq; /**< DSP frequency -- samples per second */ - Uint16 format; /**< Audio data format */ - Uint8 channels; /**< Number of channels: 1 mono, 2 stereo */ - Uint8 silence; /**< Audio buffer silence value (calculated) */ - Uint16 samples; /**< Audio buffer size in samples (power of 2) */ - Uint16 padding; /**< Necessary for some compile environments */ - Uint32 size; /**< Audio buffer size in bytes (calculated) */ - /** - * This function is called when the audio device needs more data. - * - * @param[out] stream A pointer to the audio data buffer - * @param[in] len The length of the audio buffer in bytes. - * - * Once the callback returns, the buffer will no longer be valid. - * Stereo samples are stored in a LRLRLR ordering. - */ - void (SDLCALL *callback)(void *userdata, Uint8 *stream, int len); - void *userdata; -} SDL_AudioSpec; - -/** - * @name Audio format flags - * defaults to LSB byte order - */ -/*@{*/ -#define AUDIO_U8 0x0008 /**< Unsigned 8-bit samples */ -#define AUDIO_S8 0x8008 /**< Signed 8-bit samples */ -#define AUDIO_U16LSB 0x0010 /**< Unsigned 16-bit samples */ -#define AUDIO_S16LSB 0x8010 /**< Signed 16-bit samples */ -#define AUDIO_U16MSB 0x1010 /**< As above, but big-endian byte order */ -#define AUDIO_S16MSB 0x9010 /**< As above, but big-endian byte order */ -#define AUDIO_U16 AUDIO_U16LSB -#define AUDIO_S16 AUDIO_S16LSB - -/** - * @name Native audio byte ordering - */ -/*@{*/ -#if SDL_BYTEORDER == SDL_LIL_ENDIAN -#define AUDIO_U16SYS AUDIO_U16LSB -#define AUDIO_S16SYS AUDIO_S16LSB -#else -#define AUDIO_U16SYS AUDIO_U16MSB -#define AUDIO_S16SYS AUDIO_S16MSB -#endif -/*@}*/ - -/*@}*/ - - -/** A structure to hold a set of audio conversion filters and buffers */ -typedef struct SDL_AudioCVT { - int needed; /**< Set to 1 if conversion possible */ - Uint16 src_format; /**< Source audio format */ - Uint16 dst_format; /**< Target audio format */ - double rate_incr; /**< Rate conversion increment */ - Uint8 *buf; /**< Buffer to hold entire audio data */ - int len; /**< Length of original audio buffer */ - int len_cvt; /**< Length of converted audio buffer */ - int len_mult; /**< buffer must be len*len_mult big */ - double len_ratio; /**< Given len, final size is len*len_ratio */ - void (SDLCALL *filters[10])(struct SDL_AudioCVT *cvt, Uint16 format); - int filter_index; /**< Current audio conversion function */ -} SDL_AudioCVT; - - -/* Function prototypes */ - -/** - * @name Audio Init and Quit - * These functions are used internally, and should not be used unless you - * have a specific need to specify the audio driver you want to use. - * You should normally use SDL_Init() or SDL_InitSubSystem(). - */ -/*@{*/ -extern DECLSPEC int SDLCALL SDL_AudioInit(const char *driver_name); -extern DECLSPEC void SDLCALL SDL_AudioQuit(void); -/*@}*/ - -/** - * This function fills the given character buffer with the name of the - * current audio driver, and returns a pointer to it if the audio driver has - * been initialized. It returns NULL if no driver has been initialized. - */ -extern DECLSPEC char * SDLCALL SDL_AudioDriverName(char *namebuf, int maxlen); - -/** - * This function opens the audio device with the desired parameters, and - * returns 0 if successful, placing the actual hardware parameters in the - * structure pointed to by 'obtained'. If 'obtained' is NULL, the audio - * data passed to the callback function will be guaranteed to be in the - * requested format, and will be automatically converted to the hardware - * audio format if necessary. This function returns -1 if it failed - * to open the audio device, or couldn't set up the audio thread. - * - * The audio device starts out playing silence when it's opened, and should - * be enabled for playing by calling SDL_PauseAudio(0) when you are ready - * for your audio callback function to be called. Since the audio driver - * may modify the requested size of the audio buffer, you should allocate - * any local mixing buffers after you open the audio device. - * - * @sa SDL_AudioSpec - */ -extern DECLSPEC int SDLCALL SDL_OpenAudio(SDL_AudioSpec *desired, SDL_AudioSpec *obtained); - -typedef enum { - SDL_AUDIO_STOPPED = 0, - SDL_AUDIO_PLAYING, - SDL_AUDIO_PAUSED -} SDL_audiostatus; - -/** Get the current audio state */ -extern DECLSPEC SDL_audiostatus SDLCALL SDL_GetAudioStatus(void); - -/** - * This function pauses and unpauses the audio callback processing. - * It should be called with a parameter of 0 after opening the audio - * device to start playing sound. This is so you can safely initialize - * data for your callback function after opening the audio device. - * Silence will be written to the audio device during the pause. - */ -extern DECLSPEC void SDLCALL SDL_PauseAudio(int pause_on); - -/** - * This function loads a WAVE from the data source, automatically freeing - * that source if 'freesrc' is non-zero. For example, to load a WAVE file, - * you could do: - * @code SDL_LoadWAV_RW(SDL_RWFromFile("sample.wav", "rb"), 1, ...); @endcode - * - * If this function succeeds, it returns the given SDL_AudioSpec, - * filled with the audio data format of the wave data, and sets - * 'audio_buf' to a malloc()'d buffer containing the audio data, - * and sets 'audio_len' to the length of that audio buffer, in bytes. - * You need to free the audio buffer with SDL_FreeWAV() when you are - * done with it. - * - * This function returns NULL and sets the SDL error message if the - * wave file cannot be opened, uses an unknown data format, or is - * corrupt. Currently raw and MS-ADPCM WAVE files are supported. - */ -extern DECLSPEC SDL_AudioSpec * SDLCALL SDL_LoadWAV_RW(SDL_RWops *src, int freesrc, SDL_AudioSpec *spec, Uint8 **audio_buf, Uint32 *audio_len); - -/** Compatibility convenience function -- loads a WAV from a file */ -#define SDL_LoadWAV(file, spec, audio_buf, audio_len) \ - SDL_LoadWAV_RW(SDL_RWFromFile(file, "rb"),1, spec,audio_buf,audio_len) - -/** - * This function frees data previously allocated with SDL_LoadWAV_RW() - */ -extern DECLSPEC void SDLCALL SDL_FreeWAV(Uint8 *audio_buf); - -/** - * This function takes a source format and rate and a destination format - * and rate, and initializes the 'cvt' structure with information needed - * by SDL_ConvertAudio() to convert a buffer of audio data from one format - * to the other. - * - * @return This function returns 0, or -1 if there was an error. - */ -extern DECLSPEC int SDLCALL SDL_BuildAudioCVT(SDL_AudioCVT *cvt, - Uint16 src_format, Uint8 src_channels, int src_rate, - Uint16 dst_format, Uint8 dst_channels, int dst_rate); - -/** - * Once you have initialized the 'cvt' structure using SDL_BuildAudioCVT(), - * created an audio buffer cvt->buf, and filled it with cvt->len bytes of - * audio data in the source format, this function will convert it in-place - * to the desired format. - * The data conversion may expand the size of the audio data, so the buffer - * cvt->buf should be allocated after the cvt structure is initialized by - * SDL_BuildAudioCVT(), and should be cvt->len*cvt->len_mult bytes long. - */ -extern DECLSPEC int SDLCALL SDL_ConvertAudio(SDL_AudioCVT *cvt); - - -#define SDL_MIX_MAXVOLUME 128 -/** - * This takes two audio buffers of the playing audio format and mixes - * them, performing addition, volume adjustment, and overflow clipping. - * The volume ranges from 0 - 128, and should be set to SDL_MIX_MAXVOLUME - * for full audio volume. Note this does not change hardware volume. - * This is provided for convenience -- you can mix your own audio data. - */ -extern DECLSPEC void SDLCALL SDL_MixAudio(Uint8 *dst, const Uint8 *src, Uint32 len, int volume); - -/** - * @name Audio Locks - * The lock manipulated by these functions protects the callback function. - * During a LockAudio/UnlockAudio pair, you can be guaranteed that the - * callback function is not running. Do not call these from the callback - * function or you will cause deadlock. - */ -/*@{*/ -extern DECLSPEC void SDLCALL SDL_LockAudio(void); -extern DECLSPEC void SDLCALL SDL_UnlockAudio(void); -/*@}*/ - -/** - * This function shuts down audio processing and closes the audio device. - */ -extern DECLSPEC void SDLCALL SDL_CloseAudio(void); - - -/* Ends C function definitions when using C++ */ -#ifdef __cplusplus -} -#endif -#include "close_code.h" - -#endif /* _SDL_audio_h */ diff --git a/dji_sdk_manifold_read_cam/include/sdl/SDL_byteorder.h b/dji_sdk_manifold_read_cam/include/sdl/SDL_byteorder.h deleted file mode 100644 index 47332c3..0000000 --- a/dji_sdk_manifold_read_cam/include/sdl/SDL_byteorder.h +++ /dev/null @@ -1,29 +0,0 @@ -/* - SDL - Simple DirectMedia Layer - Copyright (C) 1997-2012 Sam Lantinga - - This library is free software; you can redistribute it and/or - modify it under the terms of the GNU Lesser General Public - License as published by the Free Software Foundation; either - version 2.1 of the License, or (at your option) any later version. - - This library is distributed in the hope that it will be useful, - but WITHOUT ANY WARRANTY; without even the implied warranty of - MERCHANTABILITY or FITNESS FOR A PARTICULAR PURPOSE. See the GNU - Lesser General Public License for more details. - - You should have received a copy of the GNU Lesser General Public - License along with this library; if not, write to the Free Software - Foundation, Inc., 51 Franklin St, Fifth Floor, Boston, MA 02110-1301 USA - - Sam Lantinga - slouken@libsdl.org -*/ - -/** - * @file SDL_byteorder.h - * @deprecated Use SDL_endian.h instead - */ - -/* DEPRECATED */ -#include "SDL_endian.h" diff --git a/dji_sdk_manifold_read_cam/include/sdl/SDL_cdrom.h b/dji_sdk_manifold_read_cam/include/sdl/SDL_cdrom.h deleted file mode 100644 index febb19d..0000000 --- a/dji_sdk_manifold_read_cam/include/sdl/SDL_cdrom.h +++ /dev/null @@ -1,202 +0,0 @@ -/* - SDL - Simple DirectMedia Layer - Copyright (C) 1997-2012 Sam Lantinga - - This library is free software; you can redistribute it and/or - modify it under the terms of the GNU Lesser General Public - License as published by the Free Software Foundation; either - version 2.1 of the License, or (at your option) any later version. - - This library is distributed in the hope that it will be useful, - but WITHOUT ANY WARRANTY; without even the implied warranty of - MERCHANTABILITY or FITNESS FOR A PARTICULAR PURPOSE. See the GNU - Lesser General Public License for more details. - - You should have received a copy of the GNU Lesser General Public - License along with this library; if not, write to the Free Software - Foundation, Inc., 51 Franklin St, Fifth Floor, Boston, MA 02110-1301 USA - - Sam Lantinga - slouken@libsdl.org -*/ - -/** - * @file SDL_cdrom.h - * This is the CD-audio control API for Simple DirectMedia Layer - */ - -#ifndef _SDL_cdrom_h -#define _SDL_cdrom_h - -#include "SDL_stdinc.h" -#include "SDL_error.h" - -#include "begin_code.h" -/* Set up for C function definitions, even when using C++ */ -#ifdef __cplusplus -extern "C" { -#endif - -/** - * @file SDL_cdrom.h - * In order to use these functions, SDL_Init() must have been called - * with the SDL_INIT_CDROM flag. This causes SDL to scan the system - * for CD-ROM drives, and load appropriate drivers. - */ - -/** The maximum number of CD-ROM tracks on a disk */ -#define SDL_MAX_TRACKS 99 - -/** @name Track Types - * The types of CD-ROM track possible - */ -/*@{*/ -#define SDL_AUDIO_TRACK 0x00 -#define SDL_DATA_TRACK 0x04 -/*@}*/ - -/** The possible states which a CD-ROM drive can be in. */ -typedef enum { - CD_TRAYEMPTY, - CD_STOPPED, - CD_PLAYING, - CD_PAUSED, - CD_ERROR = -1 -} CDstatus; - -/** Given a status, returns true if there's a disk in the drive */ -#define CD_INDRIVE(status) ((int)(status) > 0) - -typedef struct SDL_CDtrack { - Uint8 id; /**< Track number */ - Uint8 type; /**< Data or audio track */ - Uint16 unused; - Uint32 length; /**< Length, in frames, of this track */ - Uint32 offset; /**< Offset, in frames, from start of disk */ -} SDL_CDtrack; - -/** This structure is only current as of the last call to SDL_CDStatus() */ -typedef struct SDL_CD { - int id; /**< Private drive identifier */ - CDstatus status; /**< Current drive status */ - - /** The rest of this structure is only valid if there's a CD in drive */ - /*@{*/ - int numtracks; /**< Number of tracks on disk */ - int cur_track; /**< Current track position */ - int cur_frame; /**< Current frame offset within current track */ - SDL_CDtrack track[SDL_MAX_TRACKS+1]; - /*@}*/ -} SDL_CD; - -/** @name Frames / MSF Conversion Functions - * Conversion functions from frames to Minute/Second/Frames and vice versa - */ -/*@{*/ -#define CD_FPS 75 -#define FRAMES_TO_MSF(f, M,S,F) { \ - int value = f; \ - *(F) = value%CD_FPS; \ - value /= CD_FPS; \ - *(S) = value%60; \ - value /= 60; \ - *(M) = value; \ -} -#define MSF_TO_FRAMES(M, S, F) ((M)*60*CD_FPS+(S)*CD_FPS+(F)) -/*@}*/ - -/* CD-audio API functions: */ - -/** - * Returns the number of CD-ROM drives on the system, or -1 if - * SDL_Init() has not been called with the SDL_INIT_CDROM flag. - */ -extern DECLSPEC int SDLCALL SDL_CDNumDrives(void); - -/** - * Returns a human-readable, system-dependent identifier for the CD-ROM. - * Example: - * - "/dev/cdrom" - * - "E:" - * - "/dev/disk/ide/1/master" - */ -extern DECLSPEC const char * SDLCALL SDL_CDName(int drive); - -/** - * Opens a CD-ROM drive for access. It returns a drive handle on success, - * or NULL if the drive was invalid or busy. This newly opened CD-ROM - * becomes the default CD used when other CD functions are passed a NULL - * CD-ROM handle. - * Drives are numbered starting with 0. Drive 0 is the system default CD-ROM. - */ -extern DECLSPEC SDL_CD * SDLCALL SDL_CDOpen(int drive); - -/** - * This function returns the current status of the given drive. - * If the drive has a CD in it, the table of contents of the CD and current - * play position of the CD will be stored in the SDL_CD structure. - */ -extern DECLSPEC CDstatus SDLCALL SDL_CDStatus(SDL_CD *cdrom); - -/** - * Play the given CD starting at 'start_track' and 'start_frame' for 'ntracks' - * tracks and 'nframes' frames. If both 'ntrack' and 'nframe' are 0, play - * until the end of the CD. This function will skip data tracks. - * This function should only be called after calling SDL_CDStatus() to - * get track information about the CD. - * For example: - * @code - * // Play entire CD: - * if ( CD_INDRIVE(SDL_CDStatus(cdrom)) ) - * SDL_CDPlayTracks(cdrom, 0, 0, 0, 0); - * // Play last track: - * if ( CD_INDRIVE(SDL_CDStatus(cdrom)) ) { - * SDL_CDPlayTracks(cdrom, cdrom->numtracks-1, 0, 0, 0); - * } - * // Play first and second track and 10 seconds of third track: - * if ( CD_INDRIVE(SDL_CDStatus(cdrom)) ) - * SDL_CDPlayTracks(cdrom, 0, 0, 2, 10); - * @endcode - * - * @return This function returns 0, or -1 if there was an error. - */ -extern DECLSPEC int SDLCALL SDL_CDPlayTracks(SDL_CD *cdrom, - int start_track, int start_frame, int ntracks, int nframes); - -/** - * Play the given CD starting at 'start' frame for 'length' frames. - * @return It returns 0, or -1 if there was an error. - */ -extern DECLSPEC int SDLCALL SDL_CDPlay(SDL_CD *cdrom, int start, int length); - -/** Pause play - * @return returns 0, or -1 on error - */ -extern DECLSPEC int SDLCALL SDL_CDPause(SDL_CD *cdrom); - -/** Resume play - * @return returns 0, or -1 on error - */ -extern DECLSPEC int SDLCALL SDL_CDResume(SDL_CD *cdrom); - -/** Stop play - * @return returns 0, or -1 on error - */ -extern DECLSPEC int SDLCALL SDL_CDStop(SDL_CD *cdrom); - -/** Eject CD-ROM - * @return returns 0, or -1 on error - */ -extern DECLSPEC int SDLCALL SDL_CDEject(SDL_CD *cdrom); - -/** Closes the handle for the CD-ROM drive */ -extern DECLSPEC void SDLCALL SDL_CDClose(SDL_CD *cdrom); - - -/* Ends C function definitions when using C++ */ -#ifdef __cplusplus -} -#endif -#include "close_code.h" - -#endif /* _SDL_video_h */ diff --git a/dji_sdk_manifold_read_cam/include/sdl/SDL_config.h b/dji_sdk_manifold_read_cam/include/sdl/SDL_config.h deleted file mode 100644 index 09ba38a..0000000 --- a/dji_sdk_manifold_read_cam/include/sdl/SDL_config.h +++ /dev/null @@ -1,45 +0,0 @@ -/* - SDL - Simple DirectMedia Layer - Copyright (C) 1997-2012 Sam Lantinga - - This library is free software; you can redistribute it and/or - modify it under the terms of the GNU Lesser General Public - License as published by the Free Software Foundation; either - version 2.1 of the License, or (at your option) any later version. - - This library is distributed in the hope that it will be useful, - but WITHOUT ANY WARRANTY; without even the implied warranty of - MERCHANTABILITY or FITNESS FOR A PARTICULAR PURPOSE. See the GNU - Lesser General Public License for more details. - - You should have received a copy of the GNU Lesser General Public - License along with this library; if not, write to the Free Software - Foundation, Inc., 51 Franklin St, Fifth Floor, Boston, MA 02110-1301 USA - - Sam Lantinga - slouken@libsdl.org -*/ - -#ifndef _SDL_config_h -#define _SDL_config_h - -#include "SDL_platform.h" - -/* Add any platform that doesn't build using the configure system */ -#if defined(__DREAMCAST__) -#include "SDL_config_dreamcast.h" -#elif defined(__MACOS__) -#include "SDL_config_macos.h" -#elif defined(__MACOSX__) -#include "SDL_config_macosx.h" -#elif defined(__SYMBIAN32__) -#include "SDL_config_symbian.h" /* must be before win32! */ -#elif defined(__WIN32__) -#include "SDL_config_win32.h" -#elif defined(__OS2__) -#include "SDL_config_os2.h" -#else -#include "SDL_config_minimal.h" -#endif /* platform config */ - -#endif /* _SDL_config_h */ diff --git a/dji_sdk_manifold_read_cam/include/sdl/SDL_config_dreamcast.h b/dji_sdk_manifold_read_cam/include/sdl/SDL_config_dreamcast.h deleted file mode 100644 index fb03098..0000000 --- a/dji_sdk_manifold_read_cam/include/sdl/SDL_config_dreamcast.h +++ /dev/null @@ -1,106 +0,0 @@ -/* - SDL - Simple DirectMedia Layer - Copyright (C) 1997-2012 Sam Lantinga - - This library is free software; you can redistribute it and/or - modify it under the terms of the GNU Lesser General Public - License as published by the Free Software Foundation; either - version 2.1 of the License, or (at your option) any later version. - - This library is distributed in the hope that it will be useful, - but WITHOUT ANY WARRANTY; without even the implied warranty of - MERCHANTABILITY or FITNESS FOR A PARTICULAR PURPOSE. See the GNU - Lesser General Public License for more details. - - You should have received a copy of the GNU Lesser General Public - License along with this library; if not, write to the Free Software - Foundation, Inc., 51 Franklin St, Fifth Floor, Boston, MA 02110-1301 USA - - Sam Lantinga - slouken@libsdl.org -*/ - -#ifndef _SDL_config_dreamcast_h -#define _SDL_config_dreamcast_h - -#include "SDL_platform.h" - -/* This is a set of defines to configure the SDL features */ - -typedef signed char int8_t; -typedef unsigned char uint8_t; -typedef signed short int16_t; -typedef unsigned short uint16_t; -typedef signed int int32_t; -typedef unsigned int uint32_t; -typedef signed long long int64_t; -typedef unsigned long long uint64_t; -typedef unsigned long uintptr_t; -#define SDL_HAS_64BIT_TYPE 1 - -/* Useful headers */ -#define HAVE_SYS_TYPES_H 1 -#define HAVE_STDIO_H 1 -#define STDC_HEADERS 1 -#define HAVE_STRING_H 1 -#define HAVE_CTYPE_H 1 - -/* C library functions */ -#define HAVE_MALLOC 1 -#define HAVE_CALLOC 1 -#define HAVE_REALLOC 1 -#define HAVE_FREE 1 -#define HAVE_ALLOCA 1 -#define HAVE_GETENV 1 -#define HAVE_PUTENV 1 -#define HAVE_QSORT 1 -#define HAVE_ABS 1 -#define HAVE_BCOPY 1 -#define HAVE_MEMSET 1 -#define HAVE_MEMCPY 1 -#define HAVE_MEMMOVE 1 -#define HAVE_MEMCMP 1 -#define HAVE_STRLEN 1 -#define HAVE_STRDUP 1 -#define HAVE_INDEX 1 -#define HAVE_RINDEX 1 -#define HAVE_STRCHR 1 -#define HAVE_STRRCHR 1 -#define HAVE_STRSTR 1 -#define HAVE_STRTOL 1 -#define HAVE_STRTOD 1 -#define HAVE_ATOI 1 -#define HAVE_ATOF 1 -#define HAVE_STRCMP 1 -#define HAVE_STRNCMP 1 -#define HAVE_STRICMP 1 -#define HAVE_STRCASECMP 1 -#define HAVE_SSCANF 1 -#define HAVE_SNPRINTF 1 -#define HAVE_VSNPRINTF 1 - -/* Enable various audio drivers */ -#define SDL_AUDIO_DRIVER_DC 1 -#define SDL_AUDIO_DRIVER_DISK 1 -#define SDL_AUDIO_DRIVER_DUMMY 1 - -/* Enable various cdrom drivers */ -#define SDL_CDROM_DC 1 - -/* Enable various input drivers */ -#define SDL_JOYSTICK_DC 1 - -/* Enable various shared object loading systems */ -#define SDL_LOADSO_DUMMY 1 - -/* Enable various threading systems */ -#define SDL_THREAD_DC 1 - -/* Enable various timer systems */ -#define SDL_TIMER_DC 1 - -/* Enable various video drivers */ -#define SDL_VIDEO_DRIVER_DC 1 -#define SDL_VIDEO_DRIVER_DUMMY 1 - -#endif /* _SDL_config_dreamcast_h */ diff --git a/dji_sdk_manifold_read_cam/include/sdl/SDL_config_macos.h b/dji_sdk_manifold_read_cam/include/sdl/SDL_config_macos.h deleted file mode 100644 index 4fe1715..0000000 --- a/dji_sdk_manifold_read_cam/include/sdl/SDL_config_macos.h +++ /dev/null @@ -1,112 +0,0 @@ -/* - SDL - Simple DirectMedia Layer - Copyright (C) 1997-2012 Sam Lantinga - - This library is free software; you can redistribute it and/or - modify it under the terms of the GNU Lesser General Public - License as published by the Free Software Foundation; either - version 2.1 of the License, or (at your option) any later version. - - This library is distributed in the hope that it will be useful, - but WITHOUT ANY WARRANTY; without even the implied warranty of - MERCHANTABILITY or FITNESS FOR A PARTICULAR PURPOSE. See the GNU - Lesser General Public License for more details. - - You should have received a copy of the GNU Lesser General Public - License along with this library; if not, write to the Free Software - Foundation, Inc., 51 Franklin St, Fifth Floor, Boston, MA 02110-1301 USA - - Sam Lantinga - slouken@libsdl.org -*/ - -#ifndef _SDL_config_macos_h -#define _SDL_config_macos_h - -#include "SDL_platform.h" - -/* This is a set of defines to configure the SDL features */ - -#include - -typedef SInt8 int8_t; -typedef UInt8 uint8_t; -typedef SInt16 int16_t; -typedef UInt16 uint16_t; -typedef SInt32 int32_t; -typedef UInt32 uint32_t; -typedef SInt64 int64_t; -typedef UInt64 uint64_t; -typedef unsigned long uintptr_t; - -#define SDL_HAS_64BIT_TYPE 1 - -/* Useful headers */ -#define HAVE_STDIO_H 1 -#define STDC_HEADERS 1 -#define HAVE_STRING_H 1 -#define HAVE_CTYPE_H 1 -#define HAVE_MATH_H 1 -#define HAVE_SIGNAL_H 1 - -/* C library functions */ -#define HAVE_MALLOC 1 -#define HAVE_CALLOC 1 -#define HAVE_REALLOC 1 -#define HAVE_FREE 1 -#define HAVE_ALLOCA 1 -#define HAVE_ABS 1 -#define HAVE_MEMSET 1 -#define HAVE_MEMCPY 1 -#define HAVE_MEMMOVE 1 -#define HAVE_MEMCMP 1 -#define HAVE_STRLEN 1 -#define HAVE_STRCHR 1 -#define HAVE_STRRCHR 1 -#define HAVE_STRSTR 1 -#define HAVE_ITOA 1 -#define HAVE_STRTOL 1 -#define HAVE_STRTOD 1 -#define HAVE_ATOI 1 -#define HAVE_ATOF 1 -#define HAVE_STRCMP 1 -#define HAVE_STRNCMP 1 -#define HAVE_SSCANF 1 - -/* Enable various audio drivers */ -#define SDL_AUDIO_DRIVER_SNDMGR 1 -#define SDL_AUDIO_DRIVER_DISK 1 -#define SDL_AUDIO_DRIVER_DUMMY 1 - -/* Enable various cdrom drivers */ -#if TARGET_API_MAC_CARBON -#define SDL_CDROM_DUMMY 1 -#else -#define SDL_CDROM_MACOS 1 -#endif - -/* Enable various input drivers */ -#if TARGET_API_MAC_CARBON -#define SDL_JOYSTICK_DUMMY 1 -#else -#define SDL_JOYSTICK_MACOS 1 -#endif - -/* Enable various shared object loading systems */ -#define SDL_LOADSO_MACOS 1 - -/* Enable various threading systems */ -#define SDL_THREADS_DISABLED 1 - -/* Enable various timer systems */ -#define SDL_TIMER_MACOS 1 - -/* Enable various video drivers */ -#define SDL_VIDEO_DRIVER_DUMMY 1 -#define SDL_VIDEO_DRIVER_DRAWSPROCKET 1 -#define SDL_VIDEO_DRIVER_TOOLBOX 1 - -/* Enable OpenGL support */ -#define SDL_VIDEO_OPENGL 1 - -#endif /* _SDL_config_macos_h */ diff --git a/dji_sdk_manifold_read_cam/include/sdl/SDL_config_macosx.h b/dji_sdk_manifold_read_cam/include/sdl/SDL_config_macosx.h deleted file mode 100644 index 84be617..0000000 --- a/dji_sdk_manifold_read_cam/include/sdl/SDL_config_macosx.h +++ /dev/null @@ -1,150 +0,0 @@ -/* - SDL - Simple DirectMedia Layer - Copyright (C) 1997-2012 Sam Lantinga - - This library is free software; you can redistribute it and/or - modify it under the terms of the GNU Lesser General Public - License as published by the Free Software Foundation; either - version 2.1 of the License, or (at your option) any later version. - - This library is distributed in the hope that it will be useful, - but WITHOUT ANY WARRANTY; without even the implied warranty of - MERCHANTABILITY or FITNESS FOR A PARTICULAR PURPOSE. See the GNU - Lesser General Public License for more details. - - You should have received a copy of the GNU Lesser General Public - License along with this library; if not, write to the Free Software - Foundation, Inc., 51 Franklin St, Fifth Floor, Boston, MA 02110-1301 USA - - Sam Lantinga - slouken@libsdl.org -*/ - -#ifndef _SDL_config_macosx_h -#define _SDL_config_macosx_h - -#include "SDL_platform.h" - -/* This gets us MAC_OS_X_VERSION_MIN_REQUIRED... */ -#include - -/* This is a set of defines to configure the SDL features */ - -#define SDL_HAS_64BIT_TYPE 1 - -/* Useful headers */ -/* If we specified an SDK or have a post-PowerPC chip, then alloca.h exists. */ -#if ( (MAC_OS_X_VERSION_MIN_REQUIRED >= 1030) || (!defined(__POWERPC__)) ) -#define HAVE_ALLOCA_H 1 -#endif -#define HAVE_SYS_TYPES_H 1 -#define HAVE_STDIO_H 1 -#define STDC_HEADERS 1 -#define HAVE_STRING_H 1 -#define HAVE_INTTYPES_H 1 -#define HAVE_STDINT_H 1 -#define HAVE_CTYPE_H 1 -#define HAVE_MATH_H 1 -#define HAVE_SIGNAL_H 1 - -/* C library functions */ -#define HAVE_MALLOC 1 -#define HAVE_CALLOC 1 -#define HAVE_REALLOC 1 -#define HAVE_FREE 1 -#define HAVE_ALLOCA 1 -#define HAVE_GETENV 1 -#define HAVE_PUTENV 1 -#define HAVE_UNSETENV 1 -#define HAVE_QSORT 1 -#define HAVE_ABS 1 -#define HAVE_BCOPY 1 -#define HAVE_MEMSET 1 -#define HAVE_MEMCPY 1 -#define HAVE_MEMMOVE 1 -#define HAVE_MEMCMP 1 -#define HAVE_STRLEN 1 -#define HAVE_STRLCPY 1 -#define HAVE_STRLCAT 1 -#define HAVE_STRDUP 1 -#define HAVE_STRCHR 1 -#define HAVE_STRRCHR 1 -#define HAVE_STRSTR 1 -#define HAVE_STRTOL 1 -#define HAVE_STRTOUL 1 -#define HAVE_STRTOLL 1 -#define HAVE_STRTOULL 1 -#define HAVE_STRTOD 1 -#define HAVE_ATOI 1 -#define HAVE_ATOF 1 -#define HAVE_STRCMP 1 -#define HAVE_STRNCMP 1 -#define HAVE_STRCASECMP 1 -#define HAVE_STRNCASECMP 1 -#define HAVE_SSCANF 1 -#define HAVE_SNPRINTF 1 -#define HAVE_VSNPRINTF 1 -#define HAVE_SIGACTION 1 -#define HAVE_SETJMP 1 -#define HAVE_NANOSLEEP 1 - -/* Enable various audio drivers */ -#define SDL_AUDIO_DRIVER_COREAUDIO 1 -#define SDL_AUDIO_DRIVER_DISK 1 -#define SDL_AUDIO_DRIVER_DUMMY 1 - -/* Enable various cdrom drivers */ -#define SDL_CDROM_MACOSX 1 - -/* Enable various input drivers */ -#define SDL_JOYSTICK_IOKIT 1 - -/* Enable various shared object loading systems */ -#ifdef __ppc__ -/* For Mac OS X 10.2 compatibility */ -#define SDL_LOADSO_DLCOMPAT 1 -#else -#define SDL_LOADSO_DLOPEN 1 -#endif - -/* Enable various threading systems */ -#define SDL_THREAD_PTHREAD 1 -#define SDL_THREAD_PTHREAD_RECURSIVE_MUTEX 1 - -/* Enable various timer systems */ -#define SDL_TIMER_UNIX 1 - -/* Enable various video drivers */ -#define SDL_VIDEO_DRIVER_DUMMY 1 -#if ((defined TARGET_API_MAC_CARBON) && (TARGET_API_MAC_CARBON)) -#define SDL_VIDEO_DRIVER_TOOLBOX 1 -#else -#define SDL_VIDEO_DRIVER_QUARTZ 1 -#endif -#define SDL_VIDEO_DRIVER_DGA 1 -#define SDL_VIDEO_DRIVER_X11 1 -#define SDL_VIDEO_DRIVER_X11_DGAMOUSE 1 -#define SDL_VIDEO_DRIVER_X11_DYNAMIC "/usr/X11R6/lib/libX11.6.dylib" -#define SDL_VIDEO_DRIVER_X11_DYNAMIC_XEXT "/usr/X11R6/lib/libXext.6.dylib" -#define SDL_VIDEO_DRIVER_X11_DYNAMIC_XRANDR "/usr/X11R6/lib/libXrandr.2.dylib" -#define SDL_VIDEO_DRIVER_X11_DYNAMIC_XRENDER "/usr/X11R6/lib/libXrender.1.dylib" -#define SDL_VIDEO_DRIVER_X11_VIDMODE 1 -#define SDL_VIDEO_DRIVER_X11_XINERAMA 1 -#define SDL_VIDEO_DRIVER_X11_XME 1 -#define SDL_VIDEO_DRIVER_X11_XRANDR 1 -#define SDL_VIDEO_DRIVER_X11_XV 1 - -/* Enable OpenGL support */ -#define SDL_VIDEO_OPENGL 1 -#define SDL_VIDEO_OPENGL_GLX 1 - -/* Disable screensaver */ -#define SDL_VIDEO_DISABLE_SCREENSAVER 1 - -/* Enable assembly routines */ -#define SDL_ASSEMBLY_ROUTINES 1 -#ifdef __ppc__ -#define SDL_ALTIVEC_BLITTERS 1 -#endif - -#endif /* _SDL_config_macosx_h */ diff --git a/dji_sdk_manifold_read_cam/include/sdl/SDL_config_minimal.h b/dji_sdk_manifold_read_cam/include/sdl/SDL_config_minimal.h deleted file mode 100644 index d10db7c..0000000 --- a/dji_sdk_manifold_read_cam/include/sdl/SDL_config_minimal.h +++ /dev/null @@ -1,62 +0,0 @@ -/* - SDL - Simple DirectMedia Layer - Copyright (C) 1997-2012 Sam Lantinga - - This library is free software; you can redistribute it and/or - modify it under the terms of the GNU Lesser General Public - License as published by the Free Software Foundation; either - version 2.1 of the License, or (at your option) any later version. - - This library is distributed in the hope that it will be useful, - but WITHOUT ANY WARRANTY; without even the implied warranty of - MERCHANTABILITY or FITNESS FOR A PARTICULAR PURPOSE. See the GNU - Lesser General Public License for more details. - - You should have received a copy of the GNU Lesser General Public - License along with this library; if not, write to the Free Software - Foundation, Inc., 51 Franklin St, Fifth Floor, Boston, MA 02110-1301 USA - - Sam Lantinga - slouken@libsdl.org -*/ - -#ifndef _SDL_config_minimal_h -#define _SDL_config_minimal_h - -#include "SDL_platform.h" - -/* This is the minimal configuration that can be used to build SDL */ - -#include - -typedef signed char int8_t; -typedef unsigned char uint8_t; -typedef signed short int16_t; -typedef unsigned short uint16_t; -typedef signed int int32_t; -typedef unsigned int uint32_t; -typedef unsigned int size_t; -typedef unsigned long uintptr_t; - -/* Enable the dummy audio driver (src/audio/dummy/\*.c) */ -#define SDL_AUDIO_DRIVER_DUMMY 1 - -/* Enable the stub cdrom driver (src/cdrom/dummy/\*.c) */ -#define SDL_CDROM_DISABLED 1 - -/* Enable the stub joystick driver (src/joystick/dummy/\*.c) */ -#define SDL_JOYSTICK_DISABLED 1 - -/* Enable the stub shared object loader (src/loadso/dummy/\*.c) */ -#define SDL_LOADSO_DISABLED 1 - -/* Enable the stub thread support (src/thread/generic/\*.c) */ -#define SDL_THREADS_DISABLED 1 - -/* Enable the stub timer support (src/timer/dummy/\*.c) */ -#define SDL_TIMERS_DISABLED 1 - -/* Enable the dummy video driver (src/video/dummy/\*.c) */ -#define SDL_VIDEO_DRIVER_DUMMY 1 - -#endif /* _SDL_config_minimal_h */ diff --git a/dji_sdk_manifold_read_cam/include/sdl/SDL_config_nds.h b/dji_sdk_manifold_read_cam/include/sdl/SDL_config_nds.h deleted file mode 100644 index cb4d61f..0000000 --- a/dji_sdk_manifold_read_cam/include/sdl/SDL_config_nds.h +++ /dev/null @@ -1,115 +0,0 @@ -/* - SDL - Simple DirectMedia Layer - Copyright (C) 1997-2012 Sam Lantinga - - This library is free software; you can redistribute it and/or - modify it under the terms of the GNU Lesser General Public - License as published by the Free Software Foundation; either - version 2.1 of the License, or (at your option) any later version. - - This library is distributed in the hope that it will be useful, - but WITHOUT ANY WARRANTY; without even the implied warranty of - MERCHANTABILITY or FITNESS FOR A PARTICULAR PURPOSE. See the GNU - Lesser General Public License for more details. - - You should have received a copy of the GNU Lesser General Public - License along with this library; if not, write to the Free Software - Foundation, Inc., 51 Franklin St, Fifth Floor, Boston, MA 02110-1301 USA - - Sam Lantinga - slouken@libsdl.org -*/ - -#ifndef _SDL_config_nds_h -#define _SDL_config_nds_h - -#include "SDL_platform.h" - -/* This is a set of defines to configure the SDL features */ - -/* General platform specific identifiers */ -#include "SDL_platform.h" - -/* C datatypes */ -#define SDL_HAS_64BIT_TYPE 1 - -/* Endianness */ -#define SDL_BYTEORDER 1234 - -/* Useful headers */ -#define HAVE_ALLOCA_H 1 -#define HAVE_SYS_TYPES_H 1 -#define HAVE_STDIO_H 1 -#define STDC_HEADERS 1 -#define HAVE_STDLIB_H 1 -#define HAVE_STDARG_H 1 -#define HAVE_MALLOC_H 1 -#define HAVE_STRING_H 1 -#define HAVE_INTTYPES_H 1 -#define HAVE_STDINT_H 1 -#define HAVE_CTYPE_H 1 -#define HAVE_MATH_H 1 -#define HAVE_ICONV_H 1 -#define HAVE_SIGNAL_H 1 - -/* C library functions */ -#define HAVE_MALLOC 1 -#define HAVE_CALLOC 1 -#define HAVE_REALLOC 1 -#define HAVE_FREE 1 -#define HAVE_ALLOCA 1 -#define HAVE_GETENV 1 -#define HAVE_PUTENV 1 -#define HAVE_UNSETENV 1 -#define HAVE_QSORT 1 -#define HAVE_ABS 1 -#define HAVE_BCOPY 1 -#define HAVE_MEMSET 1 -#define HAVE_MEMCPY 1 -#define HAVE_MEMMOVE 1 -#define HAVE_STRLEN 1 -#define HAVE_STRLCPY 1 -#define HAVE_STRLCAT 1 -#define HAVE_STRDUP 1 -#define HAVE_STRCHR 1 -#define HAVE_STRRCHR 1 -#define HAVE_STRSTR 1 -#define HAVE_STRTOL 1 -#define HAVE_STRTOUL 1 -#define HAVE_STRTOLL 1 -#define HAVE_STRTOULL 1 -#define HAVE_ATOI 1 -#define HAVE_ATOF 1 -#define HAVE_STRCMP 1 -#define HAVE_STRNCMP 1 -#define HAVE_STRCASECMP 1 -#define HAVE_STRNCASECMP 1 -#define HAVE_SSCANF 1 -#define HAVE_SNPRINTF 1 -#define HAVE_VSNPRINTF 1 -#define HAVE_SETJMP 1 - -/* Enable various audio drivers */ -#define SDL_AUDIO_DRIVER_NDS 1 -#define SDL_AUDIO_DRIVER_DUMMY 1 - -/* Enable the stub cdrom driver (src/cdrom/dummy/\*.c) */ -#define SDL_CDROM_DISABLED 1 - -/* Enable various input drivers */ -#define SDL_JOYSTICK_NDS 1 - -/* Enable the stub shared object loader (src/loadso/dummy/\*.c) */ -#define SDL_LOADSO_DISABLED 1 - -/* Enable the stub thread support (src/thread/generic/\*.c) */ -#define SDL_THREADS_DISABLED 1 - -/* Enable various timer systems */ -#define SDL_TIMER_NDS 1 - -/* Enable various video drivers */ -#define SDL_VIDEO_DRIVER_NDS 1 -#define SDL_VIDEO_DRIVER_DUMMY 1 - -#endif /* _SDL_config_nds_h */ diff --git a/dji_sdk_manifold_read_cam/include/sdl/SDL_config_os2.h b/dji_sdk_manifold_read_cam/include/sdl/SDL_config_os2.h deleted file mode 100644 index 42edd20..0000000 --- a/dji_sdk_manifold_read_cam/include/sdl/SDL_config_os2.h +++ /dev/null @@ -1,141 +0,0 @@ -/* - SDL - Simple DirectMedia Layer - Copyright (C) 1997-2012 Sam Lantinga - - This library is free software; you can redistribute it and/or - modify it under the terms of the GNU Lesser General Public - License as published by the Free Software Foundation; either - version 2.1 of the License, or (at your option) any later version. - - This library is distributed in the hope that it will be useful, - but WITHOUT ANY WARRANTY; without even the implied warranty of - MERCHANTABILITY or FITNESS FOR A PARTICULAR PURPOSE. See the GNU - Lesser General Public License for more details. - - You should have received a copy of the GNU Lesser General Public - License along with this library; if not, write to the Free Software - Foundation, Inc., 51 Franklin St, Fifth Floor, Boston, MA 02110-1301 USA - - Sam Lantinga - slouken@libsdl.org -*/ - -#ifndef _SDL_config_os2_h -#define _SDL_config_os2_h - -#include "SDL_platform.h" - -/* This is a set of defines to configure the SDL features */ - -typedef signed char int8_t; -typedef unsigned char uint8_t; -typedef signed short int16_t; -typedef unsigned short uint16_t; -typedef signed int int32_t; -typedef unsigned int uint32_t; -typedef unsigned int size_t; -typedef unsigned long uintptr_t; -typedef signed long long int64_t; -typedef unsigned long long uint64_t; - -#define SDL_HAS_64BIT_TYPE 1 - -/* Use Watcom's LIBC */ -#define HAVE_LIBC 1 - -/* Useful headers */ -#define HAVE_SYS_TYPES_H 1 -#define HAVE_STDIO_H 1 -#define STDC_HEADERS 1 -#define HAVE_STDLIB_H 1 -#define HAVE_STDARG_H 1 -#define HAVE_MALLOC_H 1 -#define HAVE_MEMORY_H 1 -#define HAVE_STRING_H 1 -#define HAVE_STRINGS_H 1 -#define HAVE_INTTYPES_H 1 -#define HAVE_STDINT_H 1 -#define HAVE_CTYPE_H 1 -#define HAVE_MATH_H 1 -#define HAVE_SIGNAL_H 1 - -/* C library functions */ -#define HAVE_MALLOC 1 -#define HAVE_CALLOC 1 -#define HAVE_REALLOC 1 -#define HAVE_FREE 1 -#define HAVE_ALLOCA 1 -#define HAVE_GETENV 1 -#define HAVE_PUTENV 1 -#define HAVE_UNSETENV 1 -#define HAVE_QSORT 1 -#define HAVE_ABS 1 -#define HAVE_BCOPY 1 -#define HAVE_MEMSET 1 -#define HAVE_MEMCPY 1 -#define HAVE_MEMMOVE 1 -#define HAVE_MEMCMP 1 -#define HAVE_STRLEN 1 -#define HAVE_STRLCPY 1 -#define HAVE_STRLCAT 1 -#define HAVE_STRDUP 1 -#define HAVE__STRREV 1 -#define HAVE__STRUPR 1 -#define HAVE__STRLWR 1 -#define HAVE_INDEX 1 -#define HAVE_RINDEX 1 -#define HAVE_STRCHR 1 -#define HAVE_STRRCHR 1 -#define HAVE_STRSTR 1 -#define HAVE_ITOA 1 -#define HAVE__LTOA 1 -#define HAVE__UITOA 1 -#define HAVE__ULTOA 1 -#define HAVE_STRTOL 1 -#define HAVE__I64TOA 1 -#define HAVE__UI64TOA 1 -#define HAVE_STRTOLL 1 -#define HAVE_STRTOD 1 -#define HAVE_ATOI 1 -#define HAVE_ATOF 1 -#define HAVE_STRCMP 1 -#define HAVE_STRNCMP 1 -#define HAVE_STRICMP 1 -#define HAVE_STRCASECMP 1 -#define HAVE_SSCANF 1 -#define HAVE_SNPRINTF 1 -#define HAVE_VSNPRINTF 1 -#define HAVE_SETJMP 1 -#define HAVE_CLOCK_GETTIME 1 - -/* Enable various audio drivers */ -#define SDL_AUDIO_DRIVER_DART 1 -#define SDL_AUDIO_DRIVER_DISK 1 -#define SDL_AUDIO_DRIVER_DUMMY 1 - -/* Enable various cdrom drivers */ -#define SDL_CDROM_OS2 1 - -/* Enable various input drivers */ -#define SDL_JOYSTICK_OS2 1 - -/* Enable various shared object loading systems */ -#define SDL_LOADSO_OS2 1 - -/* Enable various threading systems */ -#define SDL_THREAD_OS2 1 - -/* Enable various timer systems */ -#define SDL_TIMER_OS2 1 - -/* Enable various video drivers */ -#define SDL_VIDEO_DRIVER_DUMMY 1 -#define SDL_VIDEO_DRIVER_OS2FS 1 - -/* Enable OpenGL support */ -/* Nothing here yet for OS/2... :( */ - -/* Enable assembly routines where available */ -#define SDL_ASSEMBLY_ROUTINES 1 - -#endif /* _SDL_config_os2_h */ diff --git a/dji_sdk_manifold_read_cam/include/sdl/SDL_config_symbian.h b/dji_sdk_manifold_read_cam/include/sdl/SDL_config_symbian.h deleted file mode 100644 index e917ac6..0000000 --- a/dji_sdk_manifold_read_cam/include/sdl/SDL_config_symbian.h +++ /dev/null @@ -1,146 +0,0 @@ -/* - SDL - Simple DirectMedia Layer - Copyright (C) 1997-2012 Sam Lantinga - - This library is free software; you can redistribute it and/or - modify it under the terms of the GNU Lesser General Public - License as published by the Free Software Foundation; either - version 2.1 of the License, or (at your option) any later version. - - This library is distributed in the hope that it will be useful, - but WITHOUT ANY WARRANTY; without even the implied warranty of - MERCHANTABILITY or FITNESS FOR A PARTICULAR PURPOSE. See the GNU - Lesser General Public License for more details. - - You should have received a copy of the GNU Lesser General Public - License along with this library; if not, write to the Free Software - Foundation, Inc., 51 Franklin St, Fifth Floor, Boston, MA 02110-1301 USA - - Sam Lantinga - slouken@libsdl.org -*/ - -/* - -Symbian version Markus Mertama - -*/ - - -#ifndef _SDL_CONFIG_SYMBIAN_H -#define _SDL_CONFIG_SYMBIAN_H - -#include "SDL_platform.h" - -/* This is the minimal configuration that can be used to build SDL */ - - -#include -#include - - -#ifdef __GCCE__ -#define SYMBIAN32_GCCE -#endif - -#ifndef _SIZE_T_DEFINED -typedef unsigned int size_t; -#endif - -#ifndef _INTPTR_T_DECLARED -typedef unsigned int uintptr_t; -#endif - -#ifndef _INT8_T_DECLARED -typedef signed char int8_t; -#endif - -#ifndef _UINT8_T_DECLARED -typedef unsigned char uint8_t; -#endif - -#ifndef _INT16_T_DECLARED -typedef signed short int16_t; -#endif - -#ifndef _UINT16_T_DECLARED -typedef unsigned short uint16_t; -#endif - -#ifndef _INT32_T_DECLARED -typedef signed int int32_t; -#endif - -#ifndef _UINT32_T_DECLARED -typedef unsigned int uint32_t; -#endif - -#ifndef _INT64_T_DECLARED -typedef signed long long int64_t; -#endif - -#ifndef _UINT64_T_DECLARED -typedef unsigned long long uint64_t; -#endif - -#define SDL_AUDIO_DRIVER_EPOCAUDIO 1 - - -/* Enable the stub cdrom driver (src/cdrom/dummy/\*.c) */ -#define SDL_CDROM_DISABLED 1 - -/* Enable the stub joystick driver (src/joystick/dummy/\*.c) */ -#define SDL_JOYSTICK_DISABLED 1 - -/* Enable the stub shared object loader (src/loadso/dummy/\*.c) */ -#define SDL_LOADSO_DISABLED 1 - -#define SDL_THREAD_SYMBIAN 1 - -#define SDL_VIDEO_DRIVER_EPOC 1 - -#define SDL_VIDEO_OPENGL 0 - -#define SDL_HAS_64BIT_TYPE 1 - -#define HAVE_LIBC 1 -#define HAVE_STDIO_H 1 -#define STDC_HEADERS 1 -#define HAVE_STRING_H 1 -#define HAVE_CTYPE_H 1 -#define HAVE_MATH_H 1 - -#define HAVE_MALLOC 1 -#define HAVE_CALLOC 1 -#define HAVE_REALLOC 1 -#define HAVE_FREE 1 -/*#define HAVE_ALLOCA 1*/ -#define HAVE_QSORT 1 -#define HAVE_ABS 1 -#define HAVE_MEMSET 1 -#define HAVE_MEMCPY 1 -#define HAVE_MEMMOVE 1 -#define HAVE_MEMCMP 1 -#define HAVE_STRLEN 1 -#define HAVE__STRUPR 1 -#define HAVE_STRCHR 1 -#define HAVE_STRRCHR 1 -#define HAVE_STRSTR 1 -#define HAVE_ITOA 1 -#define HAVE_STRTOL 1 -#define HAVE_STRTOUL 1 -#define HAVE_STRTOLL 1 -#define HAVE_STRTOD 1 -#define HAVE_ATOI 1 -#define HAVE_ATOF 1 -#define HAVE_STRCMP 1 -#define HAVE_STRNCMP 1 -/*#define HAVE__STRICMP 1*/ -#define HAVE__STRNICMP 1 -#define HAVE_SSCANF 1 -#define HAVE_STDARG_H 1 -#define HAVE_STDDEF_H 1 - - - -#endif /* _SDL_CONFIG_SYMBIAN_H */ diff --git a/dji_sdk_manifold_read_cam/include/sdl/SDL_config_win32.h b/dji_sdk_manifold_read_cam/include/sdl/SDL_config_win32.h deleted file mode 100644 index da2c15d..0000000 --- a/dji_sdk_manifold_read_cam/include/sdl/SDL_config_win32.h +++ /dev/null @@ -1,183 +0,0 @@ -/* - SDL - Simple DirectMedia Layer - Copyright (C) 1997-2012 Sam Lantinga - - This library is free software; you can redistribute it and/or - modify it under the terms of the GNU Lesser General Public - License as published by the Free Software Foundation; either - version 2.1 of the License, or (at your option) any later version. - - This library is distributed in the hope that it will be useful, - but WITHOUT ANY WARRANTY; without even the implied warranty of - MERCHANTABILITY or FITNESS FOR A PARTICULAR PURPOSE. See the GNU - Lesser General Public License for more details. - - You should have received a copy of the GNU Lesser General Public - License along with this library; if not, write to the Free Software - Foundation, Inc., 51 Franklin St, Fifth Floor, Boston, MA 02110-1301 USA - - Sam Lantinga - slouken@libsdl.org -*/ - -#ifndef _SDL_config_win32_h -#define _SDL_config_win32_h - -#include "SDL_platform.h" - -/* This is a set of defines to configure the SDL features */ - -#if defined(__GNUC__) || defined(__DMC__) -#define HAVE_STDINT_H 1 -#elif defined(_MSC_VER) -typedef signed __int8 int8_t; -typedef unsigned __int8 uint8_t; -typedef signed __int16 int16_t; -typedef unsigned __int16 uint16_t; -typedef signed __int32 int32_t; -typedef unsigned __int32 uint32_t; -typedef signed __int64 int64_t; -typedef unsigned __int64 uint64_t; -#ifndef _UINTPTR_T_DEFINED -#ifdef _WIN64 -typedef unsigned __int64 uintptr_t; -#else -typedef unsigned int uintptr_t; -#endif -#define _UINTPTR_T_DEFINED -#endif -/* Older Visual C++ headers don't have the Win64-compatible typedefs... */ -#if ((_MSC_VER <= 1200) && (!defined(DWORD_PTR))) -#define DWORD_PTR DWORD -#endif -#if ((_MSC_VER <= 1200) && (!defined(LONG_PTR))) -#define LONG_PTR LONG -#endif -#else /* !__GNUC__ && !_MSC_VER */ -typedef signed char int8_t; -typedef unsigned char uint8_t; -typedef signed short int16_t; -typedef unsigned short uint16_t; -typedef signed int int32_t; -typedef unsigned int uint32_t; -typedef signed long long int64_t; -typedef unsigned long long uint64_t; -#ifndef _SIZE_T_DEFINED_ -#define _SIZE_T_DEFINED_ -typedef unsigned int size_t; -#endif -typedef unsigned int uintptr_t; -#endif /* __GNUC__ || _MSC_VER */ -#define SDL_HAS_64BIT_TYPE 1 - -/* Enabled for SDL 1.2 (binary compatibility) */ -#define HAVE_LIBC 1 -#ifdef HAVE_LIBC -/* Useful headers */ -#define HAVE_STDIO_H 1 -#define STDC_HEADERS 1 -#define HAVE_STRING_H 1 -#define HAVE_CTYPE_H 1 -#define HAVE_MATH_H 1 -#ifndef _WIN32_WCE -#define HAVE_SIGNAL_H 1 -#endif - -/* C library functions */ -#define HAVE_MALLOC 1 -#define HAVE_CALLOC 1 -#define HAVE_REALLOC 1 -#define HAVE_FREE 1 -#define HAVE_ALLOCA 1 -#define HAVE_QSORT 1 -#define HAVE_ABS 1 -#define HAVE_MEMSET 1 -#define HAVE_MEMCPY 1 -#define HAVE_MEMMOVE 1 -#define HAVE_MEMCMP 1 -#define HAVE_STRLEN 1 -#define HAVE__STRREV 1 -#define HAVE__STRUPR 1 -#define HAVE__STRLWR 1 -#define HAVE_STRCHR 1 -#define HAVE_STRRCHR 1 -#define HAVE_STRSTR 1 -#define HAVE_ITOA 1 -#define HAVE__LTOA 1 -#define HAVE__ULTOA 1 -#define HAVE_STRTOL 1 -#define HAVE_STRTOUL 1 -#define HAVE_STRTOLL 1 -#define HAVE_STRTOD 1 -#define HAVE_ATOI 1 -#define HAVE_ATOF 1 -#define HAVE_STRCMP 1 -#define HAVE_STRNCMP 1 -#define HAVE__STRICMP 1 -#define HAVE__STRNICMP 1 -#define HAVE_SSCANF 1 -#else -#define HAVE_STDARG_H 1 -#define HAVE_STDDEF_H 1 -#endif - -/* Enable various audio drivers */ -#ifndef _WIN32_WCE -#define SDL_AUDIO_DRIVER_DSOUND 1 -#endif -#define SDL_AUDIO_DRIVER_WAVEOUT 1 -#define SDL_AUDIO_DRIVER_DISK 1 -#define SDL_AUDIO_DRIVER_DUMMY 1 - -/* Enable various cdrom drivers */ -#ifdef _WIN32_WCE -#define SDL_CDROM_DISABLED 1 -#else -#define SDL_CDROM_WIN32 1 -#endif - -/* Enable various input drivers */ -#ifdef _WIN32_WCE -#define SDL_JOYSTICK_DISABLED 1 -#else -#define SDL_JOYSTICK_WINMM 1 -#endif - -/* Enable various shared object loading systems */ -#define SDL_LOADSO_WIN32 1 - -/* Enable various threading systems */ -#define SDL_THREAD_WIN32 1 - -/* Enable various timer systems */ -#ifdef _WIN32_WCE -#define SDL_TIMER_WINCE 1 -#else -#define SDL_TIMER_WIN32 1 -#endif - -/* Enable various video drivers */ -#ifdef _WIN32_WCE -#define SDL_VIDEO_DRIVER_GAPI 1 -#endif -#ifndef _WIN32_WCE -#define SDL_VIDEO_DRIVER_DDRAW 1 -#endif -#define SDL_VIDEO_DRIVER_DUMMY 1 -#define SDL_VIDEO_DRIVER_WINDIB 1 - -/* Enable OpenGL support */ -#ifndef _WIN32_WCE -#define SDL_VIDEO_OPENGL 1 -#define SDL_VIDEO_OPENGL_WGL 1 -#endif - -/* Disable screensaver */ -#define SDL_VIDEO_DISABLE_SCREENSAVER 1 - -/* Enable assembly routines (Win64 doesn't have inline asm) */ -#ifndef _WIN64 -#define SDL_ASSEMBLY_ROUTINES 1 -#endif - -#endif /* _SDL_config_win32_h */ diff --git a/dji_sdk_manifold_read_cam/include/sdl/SDL_copying.h b/dji_sdk_manifold_read_cam/include/sdl/SDL_copying.h deleted file mode 100644 index b5b64f2..0000000 --- a/dji_sdk_manifold_read_cam/include/sdl/SDL_copying.h +++ /dev/null @@ -1,22 +0,0 @@ -/* - SDL - Simple DirectMedia Layer - Copyright (C) 1997-2012 Sam Lantinga - - This library is free software; you can redistribute it and/or - modify it under the terms of the GNU Lesser General Public - License as published by the Free Software Foundation; either - version 2.1 of the License, or (at your option) any later version. - - This library is distributed in the hope that it will be useful, - but WITHOUT ANY WARRANTY; without even the implied warranty of - MERCHANTABILITY or FITNESS FOR A PARTICULAR PURPOSE. See the GNU - Lesser General Public License for more details. - - You should have received a copy of the GNU Lesser General Public - License along with this library; if not, write to the Free Software - Foundation, Inc., 51 Franklin St, Fifth Floor, Boston, MA 02110-1301 USA - - Sam Lantinga - slouken@libsdl.org -*/ - diff --git a/dji_sdk_manifold_read_cam/include/sdl/SDL_cpuinfo.h b/dji_sdk_manifold_read_cam/include/sdl/SDL_cpuinfo.h deleted file mode 100644 index 4200d6d..0000000 --- a/dji_sdk_manifold_read_cam/include/sdl/SDL_cpuinfo.h +++ /dev/null @@ -1,69 +0,0 @@ -/* - SDL - Simple DirectMedia Layer - Copyright (C) 1997-2012 Sam Lantinga - - This library is free software; you can redistribute it and/or - modify it under the terms of the GNU Lesser General Public - License as published by the Free Software Foundation; either - version 2.1 of the License, or (at your option) any later version. - - This library is distributed in the hope that it will be useful, - but WITHOUT ANY WARRANTY; without even the implied warranty of - MERCHANTABILITY or FITNESS FOR A PARTICULAR PURPOSE. See the GNU - Lesser General Public License for more details. - - You should have received a copy of the GNU Lesser General Public - License along with this library; if not, write to the Free Software - Foundation, Inc., 51 Franklin St, Fifth Floor, Boston, MA 02110-1301 USA - - Sam Lantinga - slouken@libsdl.org -*/ - -/** - * @file SDL_cpuinfo.h - * CPU feature detection for SDL - */ - -#ifndef _SDL_cpuinfo_h -#define _SDL_cpuinfo_h - -#include "SDL_stdinc.h" - -#include "begin_code.h" -/* Set up for C function definitions, even when using C++ */ -#ifdef __cplusplus -extern "C" { -#endif - -/** This function returns true if the CPU has the RDTSC instruction */ -extern DECLSPEC SDL_bool SDLCALL SDL_HasRDTSC(void); - -/** This function returns true if the CPU has MMX features */ -extern DECLSPEC SDL_bool SDLCALL SDL_HasMMX(void); - -/** This function returns true if the CPU has MMX Ext. features */ -extern DECLSPEC SDL_bool SDLCALL SDL_HasMMXExt(void); - -/** This function returns true if the CPU has 3DNow features */ -extern DECLSPEC SDL_bool SDLCALL SDL_Has3DNow(void); - -/** This function returns true if the CPU has 3DNow! Ext. features */ -extern DECLSPEC SDL_bool SDLCALL SDL_Has3DNowExt(void); - -/** This function returns true if the CPU has SSE features */ -extern DECLSPEC SDL_bool SDLCALL SDL_HasSSE(void); - -/** This function returns true if the CPU has SSE2 features */ -extern DECLSPEC SDL_bool SDLCALL SDL_HasSSE2(void); - -/** This function returns true if the CPU has AltiVec features */ -extern DECLSPEC SDL_bool SDLCALL SDL_HasAltiVec(void); - -/* Ends C function definitions when using C++ */ -#ifdef __cplusplus -} -#endif -#include "close_code.h" - -#endif /* _SDL_cpuinfo_h */ diff --git a/dji_sdk_manifold_read_cam/include/sdl/SDL_endian.h b/dji_sdk_manifold_read_cam/include/sdl/SDL_endian.h deleted file mode 100644 index fd9fc86..0000000 --- a/dji_sdk_manifold_read_cam/include/sdl/SDL_endian.h +++ /dev/null @@ -1,214 +0,0 @@ -/* - SDL - Simple DirectMedia Layer - Copyright (C) 1997-2012 Sam Lantinga - - This library is free software; you can redistribute it and/or - modify it under the terms of the GNU Lesser General Public - License as published by the Free Software Foundation; either - version 2.1 of the License, or (at your option) any later version. - - This library is distributed in the hope that it will be useful, - but WITHOUT ANY WARRANTY; without even the implied warranty of - MERCHANTABILITY or FITNESS FOR A PARTICULAR PURPOSE. See the GNU - Lesser General Public License for more details. - - You should have received a copy of the GNU Lesser General Public - License along with this library; if not, write to the Free Software - Foundation, Inc., 51 Franklin St, Fifth Floor, Boston, MA 02110-1301 USA - - Sam Lantinga - slouken@libsdl.org -*/ - -/** - * @file SDL_endian.h - * Functions for reading and writing endian-specific values - */ - -#ifndef _SDL_endian_h -#define _SDL_endian_h - -#include "SDL_stdinc.h" - -/** @name SDL_ENDIANs - * The two types of endianness - */ -/*@{*/ -#define SDL_LIL_ENDIAN 1234 -#define SDL_BIG_ENDIAN 4321 -/*@}*/ - -#ifndef SDL_BYTEORDER /* Not defined in SDL_config.h? */ -#ifdef __linux__ -#include -#define SDL_BYTEORDER __BYTE_ORDER -#else /* __linux __ */ -#if defined(__hppa__) || \ - defined(__m68k__) || defined(mc68000) || defined(_M_M68K) || \ - (defined(__MIPS__) && defined(__MISPEB__)) || \ - defined(__ppc__) || defined(__POWERPC__) || defined(_M_PPC) || \ - defined(__sparc__) -#define SDL_BYTEORDER SDL_BIG_ENDIAN -#else -#define SDL_BYTEORDER SDL_LIL_ENDIAN -#endif -#endif /* __linux __ */ -#endif /* !SDL_BYTEORDER */ - - -#include "begin_code.h" -/* Set up for C function definitions, even when using C++ */ -#ifdef __cplusplus -extern "C" { -#endif - -/** - * @name SDL_Swap Functions - * Use inline functions for compilers that support them, and static - * functions for those that do not. Because these functions become - * static for compilers that do not support inline functions, this - * header should only be included in files that actually use them. - */ -/*@{*/ -#if defined(__GNUC__) && defined(__i386__) && \ - !(__GNUC__ == 2 && __GNUC_MINOR__ <= 95 /* broken gcc version */) -static __inline__ Uint16 SDL_Swap16(Uint16 x) -{ - __asm__("xchgb %b0,%h0" : "=q" (x) : "0" (x)); - return x; -} -#elif defined(__GNUC__) && defined(__x86_64__) -static __inline__ Uint16 SDL_Swap16(Uint16 x) -{ - __asm__("xchgb %b0,%h0" : "=Q" (x) : "0" (x)); - return x; -} -#elif defined(__GNUC__) && (defined(__powerpc__) || defined(__ppc__)) -static __inline__ Uint16 SDL_Swap16(Uint16 x) -{ - Uint16 result; - - __asm__("rlwimi %0,%2,8,16,23" : "=&r" (result) : "0" (x >> 8), "r" (x)); - return result; -} -#elif defined(__GNUC__) && (defined(__m68k__) && !defined(__mcoldfire__)) -static __inline__ Uint16 SDL_Swap16(Uint16 x) -{ - __asm__("rorw #8,%0" : "=d" (x) : "0" (x) : "cc"); - return x; -} -#else -static __inline__ Uint16 SDL_Swap16(Uint16 x) { - return SDL_static_cast(Uint16, ((x<<8)|(x>>8))); -} -#endif - -#if defined(__GNUC__) && defined(__i386__) && \ - !(__GNUC__ == 2 && __GNUC_MINOR__ <= 95 /* broken gcc version */) -static __inline__ Uint32 SDL_Swap32(Uint32 x) -{ - __asm__("bswap %0" : "=r" (x) : "0" (x)); - return x; -} -#elif defined(__GNUC__) && defined(__x86_64__) -static __inline__ Uint32 SDL_Swap32(Uint32 x) -{ - __asm__("bswapl %0" : "=r" (x) : "0" (x)); - return x; -} -#elif defined(__GNUC__) && (defined(__powerpc__) || defined(__ppc__)) -static __inline__ Uint32 SDL_Swap32(Uint32 x) -{ - Uint32 result; - - __asm__("rlwimi %0,%2,24,16,23" : "=&r" (result) : "0" (x>>24), "r" (x)); - __asm__("rlwimi %0,%2,8,8,15" : "=&r" (result) : "0" (result), "r" (x)); - __asm__("rlwimi %0,%2,24,0,7" : "=&r" (result) : "0" (result), "r" (x)); - return result; -} -#elif defined(__GNUC__) && (defined(__m68k__) && !defined(__mcoldfire__)) -static __inline__ Uint32 SDL_Swap32(Uint32 x) -{ - __asm__("rorw #8,%0\n\tswap %0\n\trorw #8,%0" : "=d" (x) : "0" (x) : "cc"); - return x; -} -#else -static __inline__ Uint32 SDL_Swap32(Uint32 x) { - return SDL_static_cast(Uint32, ((x<<24)|((x<<8)&0x00FF0000)|((x>>8)&0x0000FF00)|(x>>24))); -} -#endif - -#ifdef SDL_HAS_64BIT_TYPE -#if defined(__GNUC__) && defined(__i386__) && \ - !(__GNUC__ == 2 && __GNUC_MINOR__ <= 95 /* broken gcc version */) -static __inline__ Uint64 SDL_Swap64(Uint64 x) -{ - union { - struct { Uint32 a,b; } s; - Uint64 u; - } v; - v.u = x; - __asm__("bswapl %0 ; bswapl %1 ; xchgl %0,%1" - : "=r" (v.s.a), "=r" (v.s.b) - : "0" (v.s.a), "1" (v.s.b)); - return v.u; -} -#elif defined(__GNUC__) && defined(__x86_64__) -static __inline__ Uint64 SDL_Swap64(Uint64 x) -{ - __asm__("bswapq %0" : "=r" (x) : "0" (x)); - return x; -} -#else -static __inline__ Uint64 SDL_Swap64(Uint64 x) -{ - Uint32 hi, lo; - - /* Separate into high and low 32-bit values and swap them */ - lo = SDL_static_cast(Uint32, x & 0xFFFFFFFF); - x >>= 32; - hi = SDL_static_cast(Uint32, x & 0xFFFFFFFF); - x = SDL_Swap32(lo); - x <<= 32; - x |= SDL_Swap32(hi); - return (x); -} -#endif -#else -/* This is mainly to keep compilers from complaining in SDL code. - * If there is no real 64-bit datatype, then compilers will complain about - * the fake 64-bit datatype that SDL provides when it compiles user code. - */ -#define SDL_Swap64(X) (X) -#endif /* SDL_HAS_64BIT_TYPE */ -/*@}*/ - -/** - * @name SDL_SwapLE and SDL_SwapBE Functions - * Byteswap item from the specified endianness to the native endianness - */ -/*@{*/ -#if SDL_BYTEORDER == SDL_LIL_ENDIAN -#define SDL_SwapLE16(X) (X) -#define SDL_SwapLE32(X) (X) -#define SDL_SwapLE64(X) (X) -#define SDL_SwapBE16(X) SDL_Swap16(X) -#define SDL_SwapBE32(X) SDL_Swap32(X) -#define SDL_SwapBE64(X) SDL_Swap64(X) -#else -#define SDL_SwapLE16(X) SDL_Swap16(X) -#define SDL_SwapLE32(X) SDL_Swap32(X) -#define SDL_SwapLE64(X) SDL_Swap64(X) -#define SDL_SwapBE16(X) (X) -#define SDL_SwapBE32(X) (X) -#define SDL_SwapBE64(X) (X) -#endif -/*@}*/ - -/* Ends C function definitions when using C++ */ -#ifdef __cplusplus -} -#endif -#include "close_code.h" - -#endif /* _SDL_endian_h */ diff --git a/dji_sdk_manifold_read_cam/include/sdl/SDL_error.h b/dji_sdk_manifold_read_cam/include/sdl/SDL_error.h deleted file mode 100644 index 4e1cce3..0000000 --- a/dji_sdk_manifold_read_cam/include/sdl/SDL_error.h +++ /dev/null @@ -1,72 +0,0 @@ -/* - SDL - Simple DirectMedia Layer - Copyright (C) 1997-2012 Sam Lantinga - - This library is free software; you can redistribute it and/or - modify it under the terms of the GNU Lesser General Public - License as published by the Free Software Foundation; either - version 2.1 of the License, or (at your option) any later version. - - This library is distributed in the hope that it will be useful, - but WITHOUT ANY WARRANTY; without even the implied warranty of - MERCHANTABILITY or FITNESS FOR A PARTICULAR PURPOSE. See the GNU - Lesser General Public License for more details. - - You should have received a copy of the GNU Lesser General Public - License along with this library; if not, write to the Free Software - Foundation, Inc., 51 Franklin St, Fifth Floor, Boston, MA 02110-1301 USA - - Sam Lantinga - slouken@libsdl.org -*/ - -/** - * @file SDL_error.h - * Simple error message routines for SDL - */ - -#ifndef _SDL_error_h -#define _SDL_error_h - -#include "SDL_stdinc.h" - -#include "begin_code.h" -/* Set up for C function definitions, even when using C++ */ -#ifdef __cplusplus -extern "C" { -#endif - -/** - * @name Public functions - */ -/*@{*/ -extern DECLSPEC void SDLCALL SDL_SetError(const char *fmt, ...); -extern DECLSPEC char * SDLCALL SDL_GetError(void); -extern DECLSPEC void SDLCALL SDL_ClearError(void); -/*@}*/ - -/** - * @name Private functions - * @internal Private error message function - used internally - */ -/*@{*/ -#define SDL_OutOfMemory() SDL_Error(SDL_ENOMEM) -#define SDL_Unsupported() SDL_Error(SDL_UNSUPPORTED) -typedef enum { - SDL_ENOMEM, - SDL_EFREAD, - SDL_EFWRITE, - SDL_EFSEEK, - SDL_UNSUPPORTED, - SDL_LASTERROR -} SDL_errorcode; -extern DECLSPEC void SDLCALL SDL_Error(SDL_errorcode code); -/*@}*/ - -/* Ends C function definitions when using C++ */ -#ifdef __cplusplus -} -#endif -#include "close_code.h" - -#endif /* _SDL_error_h */ diff --git a/dji_sdk_manifold_read_cam/include/sdl/SDL_events.h b/dji_sdk_manifold_read_cam/include/sdl/SDL_events.h deleted file mode 100644 index 94b4202..0000000 --- a/dji_sdk_manifold_read_cam/include/sdl/SDL_events.h +++ /dev/null @@ -1,356 +0,0 @@ -/* - SDL - Simple DirectMedia Layer - Copyright (C) 1997-2012 Sam Lantinga - - This library is free software; you can redistribute it and/or - modify it under the terms of the GNU Lesser General Public - License as published by the Free Software Foundation; either - version 2.1 of the License, or (at your option) any later version. - - This library is distributed in the hope that it will be useful, - but WITHOUT ANY WARRANTY; without even the implied warranty of - MERCHANTABILITY or FITNESS FOR A PARTICULAR PURPOSE. See the GNU - Lesser General Public License for more details. - - You should have received a copy of the GNU Lesser General Public - License along with this library; if not, write to the Free Software - Foundation, Inc., 51 Franklin St, Fifth Floor, Boston, MA 02110-1301 USA - - Sam Lantinga - slouken@libsdl.org -*/ - -/** - * @file SDL_events.h - * Include file for SDL event handling - */ - -#ifndef _SDL_events_h -#define _SDL_events_h - -#include "SDL_stdinc.h" -#include "SDL_error.h" -#include "SDL_active.h" -#include "SDL_keyboard.h" -#include "SDL_mouse.h" -#include "SDL_joystick.h" -#include "SDL_quit.h" - -#include "begin_code.h" -/* Set up for C function definitions, even when using C++ */ -#ifdef __cplusplus -extern "C" { -#endif - -/** @name General keyboard/mouse state definitions */ -/*@{*/ -#define SDL_RELEASED 0 -#define SDL_PRESSED 1 -/*@}*/ - -/** Event enumerations */ -typedef enum { - SDL_NOEVENT = 0, /**< Unused (do not remove) */ - SDL_ACTIVEEVENT, /**< Application loses/gains visibility */ - SDL_KEYDOWN, /**< Keys pressed */ - SDL_KEYUP, /**< Keys released */ - SDL_MOUSEMOTION, /**< Mouse moved */ - SDL_MOUSEBUTTONDOWN, /**< Mouse button pressed */ - SDL_MOUSEBUTTONUP, /**< Mouse button released */ - SDL_JOYAXISMOTION, /**< Joystick axis motion */ - SDL_JOYBALLMOTION, /**< Joystick trackball motion */ - SDL_JOYHATMOTION, /**< Joystick hat position change */ - SDL_JOYBUTTONDOWN, /**< Joystick button pressed */ - SDL_JOYBUTTONUP, /**< Joystick button released */ - SDL_QUIT, /**< User-requested quit */ - SDL_SYSWMEVENT, /**< System specific event */ - SDL_EVENT_RESERVEDA, /**< Reserved for future use.. */ - SDL_EVENT_RESERVEDB, /**< Reserved for future use.. */ - SDL_VIDEORESIZE, /**< User resized video mode */ - SDL_VIDEOEXPOSE, /**< Screen needs to be redrawn */ - SDL_EVENT_RESERVED2, /**< Reserved for future use.. */ - SDL_EVENT_RESERVED3, /**< Reserved for future use.. */ - SDL_EVENT_RESERVED4, /**< Reserved for future use.. */ - SDL_EVENT_RESERVED5, /**< Reserved for future use.. */ - SDL_EVENT_RESERVED6, /**< Reserved for future use.. */ - SDL_EVENT_RESERVED7, /**< Reserved for future use.. */ - /** Events SDL_USEREVENT through SDL_MAXEVENTS-1 are for your use */ - SDL_USEREVENT = 24, - /** This last event is only for bounding internal arrays - * It is the number of bits in the event mask datatype -- Uint32 - */ - SDL_NUMEVENTS = 32 -} SDL_EventType; - -/** @name Predefined event masks */ -/*@{*/ -#define SDL_EVENTMASK(X) (1<<(X)) -typedef enum { - SDL_ACTIVEEVENTMASK = SDL_EVENTMASK(SDL_ACTIVEEVENT), - SDL_KEYDOWNMASK = SDL_EVENTMASK(SDL_KEYDOWN), - SDL_KEYUPMASK = SDL_EVENTMASK(SDL_KEYUP), - SDL_KEYEVENTMASK = SDL_EVENTMASK(SDL_KEYDOWN)| - SDL_EVENTMASK(SDL_KEYUP), - SDL_MOUSEMOTIONMASK = SDL_EVENTMASK(SDL_MOUSEMOTION), - SDL_MOUSEBUTTONDOWNMASK = SDL_EVENTMASK(SDL_MOUSEBUTTONDOWN), - SDL_MOUSEBUTTONUPMASK = SDL_EVENTMASK(SDL_MOUSEBUTTONUP), - SDL_MOUSEEVENTMASK = SDL_EVENTMASK(SDL_MOUSEMOTION)| - SDL_EVENTMASK(SDL_MOUSEBUTTONDOWN)| - SDL_EVENTMASK(SDL_MOUSEBUTTONUP), - SDL_JOYAXISMOTIONMASK = SDL_EVENTMASK(SDL_JOYAXISMOTION), - SDL_JOYBALLMOTIONMASK = SDL_EVENTMASK(SDL_JOYBALLMOTION), - SDL_JOYHATMOTIONMASK = SDL_EVENTMASK(SDL_JOYHATMOTION), - SDL_JOYBUTTONDOWNMASK = SDL_EVENTMASK(SDL_JOYBUTTONDOWN), - SDL_JOYBUTTONUPMASK = SDL_EVENTMASK(SDL_JOYBUTTONUP), - SDL_JOYEVENTMASK = SDL_EVENTMASK(SDL_JOYAXISMOTION)| - SDL_EVENTMASK(SDL_JOYBALLMOTION)| - SDL_EVENTMASK(SDL_JOYHATMOTION)| - SDL_EVENTMASK(SDL_JOYBUTTONDOWN)| - SDL_EVENTMASK(SDL_JOYBUTTONUP), - SDL_VIDEORESIZEMASK = SDL_EVENTMASK(SDL_VIDEORESIZE), - SDL_VIDEOEXPOSEMASK = SDL_EVENTMASK(SDL_VIDEOEXPOSE), - SDL_QUITMASK = SDL_EVENTMASK(SDL_QUIT), - SDL_SYSWMEVENTMASK = SDL_EVENTMASK(SDL_SYSWMEVENT) -} SDL_EventMask ; -#define SDL_ALLEVENTS 0xFFFFFFFF -/*@}*/ - -/** Application visibility event structure */ -typedef struct SDL_ActiveEvent { - Uint8 type; /**< SDL_ACTIVEEVENT */ - Uint8 gain; /**< Whether given states were gained or lost (1/0) */ - Uint8 state; /**< A mask of the focus states */ -} SDL_ActiveEvent; - -/** Keyboard event structure */ -typedef struct SDL_KeyboardEvent { - Uint8 type; /**< SDL_KEYDOWN or SDL_KEYUP */ - Uint8 which; /**< The keyboard device index */ - Uint8 state; /**< SDL_PRESSED or SDL_RELEASED */ - SDL_keysym keysym; -} SDL_KeyboardEvent; - -/** Mouse motion event structure */ -typedef struct SDL_MouseMotionEvent { - Uint8 type; /**< SDL_MOUSEMOTION */ - Uint8 which; /**< The mouse device index */ - Uint8 state; /**< The current button state */ - Uint16 x, y; /**< The X/Y coordinates of the mouse */ - Sint16 xrel; /**< The relative motion in the X direction */ - Sint16 yrel; /**< The relative motion in the Y direction */ -} SDL_MouseMotionEvent; - -/** Mouse button event structure */ -typedef struct SDL_MouseButtonEvent { - Uint8 type; /**< SDL_MOUSEBUTTONDOWN or SDL_MOUSEBUTTONUP */ - Uint8 which; /**< The mouse device index */ - Uint8 button; /**< The mouse button index */ - Uint8 state; /**< SDL_PRESSED or SDL_RELEASED */ - Uint16 x, y; /**< The X/Y coordinates of the mouse at press time */ -} SDL_MouseButtonEvent; - -/** Joystick axis motion event structure */ -typedef struct SDL_JoyAxisEvent { - Uint8 type; /**< SDL_JOYAXISMOTION */ - Uint8 which; /**< The joystick device index */ - Uint8 axis; /**< The joystick axis index */ - Sint16 value; /**< The axis value (range: -32768 to 32767) */ -} SDL_JoyAxisEvent; - -/** Joystick trackball motion event structure */ -typedef struct SDL_JoyBallEvent { - Uint8 type; /**< SDL_JOYBALLMOTION */ - Uint8 which; /**< The joystick device index */ - Uint8 ball; /**< The joystick trackball index */ - Sint16 xrel; /**< The relative motion in the X direction */ - Sint16 yrel; /**< The relative motion in the Y direction */ -} SDL_JoyBallEvent; - -/** Joystick hat position change event structure */ -typedef struct SDL_JoyHatEvent { - Uint8 type; /**< SDL_JOYHATMOTION */ - Uint8 which; /**< The joystick device index */ - Uint8 hat; /**< The joystick hat index */ - Uint8 value; /**< The hat position value: - * SDL_HAT_LEFTUP SDL_HAT_UP SDL_HAT_RIGHTUP - * SDL_HAT_LEFT SDL_HAT_CENTERED SDL_HAT_RIGHT - * SDL_HAT_LEFTDOWN SDL_HAT_DOWN SDL_HAT_RIGHTDOWN - * Note that zero means the POV is centered. - */ -} SDL_JoyHatEvent; - -/** Joystick button event structure */ -typedef struct SDL_JoyButtonEvent { - Uint8 type; /**< SDL_JOYBUTTONDOWN or SDL_JOYBUTTONUP */ - Uint8 which; /**< The joystick device index */ - Uint8 button; /**< The joystick button index */ - Uint8 state; /**< SDL_PRESSED or SDL_RELEASED */ -} SDL_JoyButtonEvent; - -/** The "window resized" event - * When you get this event, you are responsible for setting a new video - * mode with the new width and height. - */ -typedef struct SDL_ResizeEvent { - Uint8 type; /**< SDL_VIDEORESIZE */ - int w; /**< New width */ - int h; /**< New height */ -} SDL_ResizeEvent; - -/** The "screen redraw" event */ -typedef struct SDL_ExposeEvent { - Uint8 type; /**< SDL_VIDEOEXPOSE */ -} SDL_ExposeEvent; - -/** The "quit requested" event */ -typedef struct SDL_QuitEvent { - Uint8 type; /**< SDL_QUIT */ -} SDL_QuitEvent; - -/** A user-defined event type */ -typedef struct SDL_UserEvent { - Uint8 type; /**< SDL_USEREVENT through SDL_NUMEVENTS-1 */ - int code; /**< User defined event code */ - void *data1; /**< User defined data pointer */ - void *data2; /**< User defined data pointer */ -} SDL_UserEvent; - -/** If you want to use this event, you should include SDL_syswm.h */ -struct SDL_SysWMmsg; -typedef struct SDL_SysWMmsg SDL_SysWMmsg; -typedef struct SDL_SysWMEvent { - Uint8 type; - SDL_SysWMmsg *msg; -} SDL_SysWMEvent; - -/** General event structure */ -typedef union SDL_Event { - Uint8 type; - SDL_ActiveEvent active; - SDL_KeyboardEvent key; - SDL_MouseMotionEvent motion; - SDL_MouseButtonEvent button; - SDL_JoyAxisEvent jaxis; - SDL_JoyBallEvent jball; - SDL_JoyHatEvent jhat; - SDL_JoyButtonEvent jbutton; - SDL_ResizeEvent resize; - SDL_ExposeEvent expose; - SDL_QuitEvent quit; - SDL_UserEvent user; - SDL_SysWMEvent syswm; -} SDL_Event; - - -/* Function prototypes */ - -/** Pumps the event loop, gathering events from the input devices. - * This function updates the event queue and internal input device state. - * This should only be run in the thread that sets the video mode. - */ -extern DECLSPEC void SDLCALL SDL_PumpEvents(void); - -typedef enum { - SDL_ADDEVENT, - SDL_PEEKEVENT, - SDL_GETEVENT -} SDL_eventaction; - -/** - * Checks the event queue for messages and optionally returns them. - * - * If 'action' is SDL_ADDEVENT, up to 'numevents' events will be added to - * the back of the event queue. - * If 'action' is SDL_PEEKEVENT, up to 'numevents' events at the front - * of the event queue, matching 'mask', will be returned and will not - * be removed from the queue. - * If 'action' is SDL_GETEVENT, up to 'numevents' events at the front - * of the event queue, matching 'mask', will be returned and will be - * removed from the queue. - * - * @return - * This function returns the number of events actually stored, or -1 - * if there was an error. - * - * This function is thread-safe. - */ -extern DECLSPEC int SDLCALL SDL_PeepEvents(SDL_Event *events, int numevents, - SDL_eventaction action, Uint32 mask); - -/** Polls for currently pending events, and returns 1 if there are any pending - * events, or 0 if there are none available. If 'event' is not NULL, the next - * event is removed from the queue and stored in that area. - */ -extern DECLSPEC int SDLCALL SDL_PollEvent(SDL_Event *event); - -/** Waits indefinitely for the next available event, returning 1, or 0 if there - * was an error while waiting for events. If 'event' is not NULL, the next - * event is removed from the queue and stored in that area. - */ -extern DECLSPEC int SDLCALL SDL_WaitEvent(SDL_Event *event); - -/** Add an event to the event queue. - * This function returns 0 on success, or -1 if the event queue was full - * or there was some other error. - */ -extern DECLSPEC int SDLCALL SDL_PushEvent(SDL_Event *event); - -/** @name Event Filtering */ -/*@{*/ -typedef int (SDLCALL *SDL_EventFilter)(const SDL_Event *event); -/** - * This function sets up a filter to process all events before they - * change internal state and are posted to the internal event queue. - * - * The filter is protypted as: - * @code typedef int (SDLCALL *SDL_EventFilter)(const SDL_Event *event); @endcode - * - * If the filter returns 1, then the event will be added to the internal queue. - * If it returns 0, then the event will be dropped from the queue, but the - * internal state will still be updated. This allows selective filtering of - * dynamically arriving events. - * - * @warning Be very careful of what you do in the event filter function, as - * it may run in a different thread! - * - * There is one caveat when dealing with the SDL_QUITEVENT event type. The - * event filter is only called when the window manager desires to close the - * application window. If the event filter returns 1, then the window will - * be closed, otherwise the window will remain open if possible. - * If the quit event is generated by an interrupt signal, it will bypass the - * internal queue and be delivered to the application at the next event poll. - */ -extern DECLSPEC void SDLCALL SDL_SetEventFilter(SDL_EventFilter filter); - -/** - * Return the current event filter - can be used to "chain" filters. - * If there is no event filter set, this function returns NULL. - */ -extern DECLSPEC SDL_EventFilter SDLCALL SDL_GetEventFilter(void); -/*@}*/ - -/** @name Event State */ -/*@{*/ -#define SDL_QUERY -1 -#define SDL_IGNORE 0 -#define SDL_DISABLE 0 -#define SDL_ENABLE 1 -/*@}*/ - -/** -* This function allows you to set the state of processing certain events. -* If 'state' is set to SDL_IGNORE, that event will be automatically dropped -* from the event queue and will not event be filtered. -* If 'state' is set to SDL_ENABLE, that event will be processed normally. -* If 'state' is set to SDL_QUERY, SDL_EventState() will return the -* current processing state of the specified event. -*/ -extern DECLSPEC Uint8 SDLCALL SDL_EventState(Uint8 type, int state); - -/* Ends C function definitions when using C++ */ -#ifdef __cplusplus -} -#endif -#include "close_code.h" - -#endif /* _SDL_events_h */ diff --git a/dji_sdk_manifold_read_cam/include/sdl/SDL_getenv.h b/dji_sdk_manifold_read_cam/include/sdl/SDL_getenv.h deleted file mode 100644 index bea6300..0000000 --- a/dji_sdk_manifold_read_cam/include/sdl/SDL_getenv.h +++ /dev/null @@ -1,28 +0,0 @@ -/* - SDL - Simple DirectMedia Layer - Copyright (C) 1997-2012 Sam Lantinga - - This library is free software; you can redistribute it and/or - modify it under the terms of the GNU Lesser General Public - License as published by the Free Software Foundation; either - version 2.1 of the License, or (at your option) any later version. - - This library is distributed in the hope that it will be useful, - but WITHOUT ANY WARRANTY; without even the implied warranty of - MERCHANTABILITY or FITNESS FOR A PARTICULAR PURPOSE. See the GNU - Lesser General Public License for more details. - - You should have received a copy of the GNU Lesser General Public - License along with this library; if not, write to the Free Software - Foundation, Inc., 51 Franklin St, Fifth Floor, Boston, MA 02110-1301 USA - - Sam Lantinga - slouken@libsdl.org -*/ - -/** @file SDL_getenv.h - * @deprecated Use SDL_stdinc.h instead - */ - -/* DEPRECATED */ -#include "SDL_stdinc.h" diff --git a/dji_sdk_manifold_read_cam/include/sdl/SDL_joystick.h b/dji_sdk_manifold_read_cam/include/sdl/SDL_joystick.h deleted file mode 100644 index 708d1a9..0000000 --- a/dji_sdk_manifold_read_cam/include/sdl/SDL_joystick.h +++ /dev/null @@ -1,187 +0,0 @@ -/* - SDL - Simple DirectMedia Layer - Copyright (C) 1997-2012 Sam Lantinga - - This library is free software; you can redistribute it and/or - modify it under the terms of the GNU Lesser General Public - License as published by the Free Software Foundation; either - version 2.1 of the License, or (at your option) any later version. - - This library is distributed in the hope that it will be useful, - but WITHOUT ANY WARRANTY; without even the implied warranty of - MERCHANTABILITY or FITNESS FOR A PARTICULAR PURPOSE. See the GNU - Lesser General Public License for more details. - - You should have received a copy of the GNU Lesser General Public - License along with this library; if not, write to the Free Software - Foundation, Inc., 51 Franklin St, Fifth Floor, Boston, MA 02110-1301 USA - - Sam Lantinga - slouken@libsdl.org -*/ - -/** @file SDL_joystick.h - * Include file for SDL joystick event handling - */ - -#ifndef _SDL_joystick_h -#define _SDL_joystick_h - -#include "SDL_stdinc.h" -#include "SDL_error.h" - -#include "begin_code.h" -/* Set up for C function definitions, even when using C++ */ -#ifdef __cplusplus -extern "C" { -#endif - -/** @file SDL_joystick.h - * @note In order to use these functions, SDL_Init() must have been called - * with the SDL_INIT_JOYSTICK flag. This causes SDL to scan the system - * for joysticks, and load appropriate drivers. - */ - -/** The joystick structure used to identify an SDL joystick */ -struct _SDL_Joystick; -typedef struct _SDL_Joystick SDL_Joystick; - -/* Function prototypes */ -/** - * Count the number of joysticks attached to the system - */ -extern DECLSPEC int SDLCALL SDL_NumJoysticks(void); - -/** - * Get the implementation dependent name of a joystick. - * - * This can be called before any joysticks are opened. - * If no name can be found, this function returns NULL. - */ -extern DECLSPEC const char * SDLCALL SDL_JoystickName(int device_index); - -/** - * Open a joystick for use. - * - * @param[in] device_index - * The index passed as an argument refers to - * the N'th joystick on the system. This index is the value which will - * identify this joystick in future joystick events. - * - * @return This function returns a joystick identifier, or NULL if an error occurred. - */ -extern DECLSPEC SDL_Joystick * SDLCALL SDL_JoystickOpen(int device_index); - -/** - * Returns 1 if the joystick has been opened, or 0 if it has not. - */ -extern DECLSPEC int SDLCALL SDL_JoystickOpened(int device_index); - -/** - * Get the device index of an opened joystick. - */ -extern DECLSPEC int SDLCALL SDL_JoystickIndex(SDL_Joystick *joystick); - -/** - * Get the number of general axis controls on a joystick - */ -extern DECLSPEC int SDLCALL SDL_JoystickNumAxes(SDL_Joystick *joystick); - -/** - * Get the number of trackballs on a joystick - * - * Joystick trackballs have only relative motion events associated - * with them and their state cannot be polled. - */ -extern DECLSPEC int SDLCALL SDL_JoystickNumBalls(SDL_Joystick *joystick); - -/** - * Get the number of POV hats on a joystick - */ -extern DECLSPEC int SDLCALL SDL_JoystickNumHats(SDL_Joystick *joystick); - -/** - * Get the number of buttons on a joystick - */ -extern DECLSPEC int SDLCALL SDL_JoystickNumButtons(SDL_Joystick *joystick); - -/** - * Update the current state of the open joysticks. - * - * This is called automatically by the event loop if any joystick - * events are enabled. - */ -extern DECLSPEC void SDLCALL SDL_JoystickUpdate(void); - -/** - * Enable/disable joystick event polling. - * - * If joystick events are disabled, you must call SDL_JoystickUpdate() - * yourself and check the state of the joystick when you want joystick - * information. - * - * @param[in] state The state can be one of SDL_QUERY, SDL_ENABLE or SDL_IGNORE. - */ -extern DECLSPEC int SDLCALL SDL_JoystickEventState(int state); - -/** - * Get the current state of an axis control on a joystick - * - * @param[in] axis The axis indices start at index 0. - * - * @return The state is a value ranging from -32768 to 32767. - */ -extern DECLSPEC Sint16 SDLCALL SDL_JoystickGetAxis(SDL_Joystick *joystick, int axis); - -/** - * @name Hat Positions - * The return value of SDL_JoystickGetHat() is one of the following positions: - */ -/*@{*/ -#define SDL_HAT_CENTERED 0x00 -#define SDL_HAT_UP 0x01 -#define SDL_HAT_RIGHT 0x02 -#define SDL_HAT_DOWN 0x04 -#define SDL_HAT_LEFT 0x08 -#define SDL_HAT_RIGHTUP (SDL_HAT_RIGHT|SDL_HAT_UP) -#define SDL_HAT_RIGHTDOWN (SDL_HAT_RIGHT|SDL_HAT_DOWN) -#define SDL_HAT_LEFTUP (SDL_HAT_LEFT|SDL_HAT_UP) -#define SDL_HAT_LEFTDOWN (SDL_HAT_LEFT|SDL_HAT_DOWN) -/*@}*/ - -/** - * Get the current state of a POV hat on a joystick - * - * @param[in] hat The hat indices start at index 0. - */ -extern DECLSPEC Uint8 SDLCALL SDL_JoystickGetHat(SDL_Joystick *joystick, int hat); - -/** - * Get the ball axis change since the last poll - * - * @param[in] ball The ball indices start at index 0. - * - * @return This returns 0, or -1 if you passed it invalid parameters. - */ -extern DECLSPEC int SDLCALL SDL_JoystickGetBall(SDL_Joystick *joystick, int ball, int *dx, int *dy); - -/** - * Get the current state of a button on a joystick - * - * @param[in] button The button indices start at index 0. - */ -extern DECLSPEC Uint8 SDLCALL SDL_JoystickGetButton(SDL_Joystick *joystick, int button); - -/** - * Close a joystick previously opened with SDL_JoystickOpen() - */ -extern DECLSPEC void SDLCALL SDL_JoystickClose(SDL_Joystick *joystick); - - -/* Ends C function definitions when using C++ */ -#ifdef __cplusplus -} -#endif -#include "close_code.h" - -#endif /* _SDL_joystick_h */ diff --git a/dji_sdk_manifold_read_cam/include/sdl/SDL_keyboard.h b/dji_sdk_manifold_read_cam/include/sdl/SDL_keyboard.h deleted file mode 100644 index 9d7129c..0000000 --- a/dji_sdk_manifold_read_cam/include/sdl/SDL_keyboard.h +++ /dev/null @@ -1,135 +0,0 @@ -/* - SDL - Simple DirectMedia Layer - Copyright (C) 1997-2012 Sam Lantinga - - This library is free software; you can redistribute it and/or - modify it under the terms of the GNU Lesser General Public - License as published by the Free Software Foundation; either - version 2.1 of the License, or (at your option) any later version. - - This library is distributed in the hope that it will be useful, - but WITHOUT ANY WARRANTY; without even the implied warranty of - MERCHANTABILITY or FITNESS FOR A PARTICULAR PURPOSE. See the GNU - Lesser General Public License for more details. - - You should have received a copy of the GNU Lesser General Public - License along with this library; if not, write to the Free Software - Foundation, Inc., 51 Franklin St, Fifth Floor, Boston, MA 02110-1301 USA - - Sam Lantinga - slouken@libsdl.org -*/ - -/** @file SDL_keyboard.h - * Include file for SDL keyboard event handling - */ - -#ifndef _SDL_keyboard_h -#define _SDL_keyboard_h - -#include "SDL_stdinc.h" -#include "SDL_error.h" -#include "SDL_keysym.h" - -#include "begin_code.h" -/* Set up for C function definitions, even when using C++ */ -#ifdef __cplusplus -extern "C" { -#endif - -/** Keysym structure - * - * - The scancode is hardware dependent, and should not be used by general - * applications. If no hardware scancode is available, it will be 0. - * - * - The 'unicode' translated character is only available when character - * translation is enabled by the SDL_EnableUNICODE() API. If non-zero, - * this is a UNICODE character corresponding to the keypress. If the - * high 9 bits of the character are 0, then this maps to the equivalent - * ASCII character: - * @code - * char ch; - * if ( (keysym.unicode & 0xFF80) == 0 ) { - * ch = keysym.unicode & 0x7F; - * } else { - * An international character.. - * } - * @endcode - */ -typedef struct SDL_keysym { - Uint8 scancode; /**< hardware specific scancode */ - SDLKey sym; /**< SDL virtual keysym */ - SDLMod mod; /**< current key modifiers */ - Uint16 unicode; /**< translated character */ -} SDL_keysym; - -/** This is the mask which refers to all hotkey bindings */ -#define SDL_ALL_HOTKEYS 0xFFFFFFFF - -/* Function prototypes */ -/** - * Enable/Disable UNICODE translation of keyboard input. - * - * This translation has some overhead, so translation defaults off. - * - * @param[in] enable - * If 'enable' is 1, translation is enabled. - * If 'enable' is 0, translation is disabled. - * If 'enable' is -1, the translation state is not changed. - * - * @return It returns the previous state of keyboard translation. - */ -extern DECLSPEC int SDLCALL SDL_EnableUNICODE(int enable); - -#define SDL_DEFAULT_REPEAT_DELAY 500 -#define SDL_DEFAULT_REPEAT_INTERVAL 30 -/** - * Enable/Disable keyboard repeat. Keyboard repeat defaults to off. - * - * @param[in] delay - * 'delay' is the initial delay in ms between the time when a key is - * pressed, and keyboard repeat begins. - * - * @param[in] interval - * 'interval' is the time in ms between keyboard repeat events. - * - * If 'delay' is set to 0, keyboard repeat is disabled. - */ -extern DECLSPEC int SDLCALL SDL_EnableKeyRepeat(int delay, int interval); -extern DECLSPEC void SDLCALL SDL_GetKeyRepeat(int *delay, int *interval); - -/** - * Get a snapshot of the current state of the keyboard. - * Returns an array of keystates, indexed by the SDLK_* syms. - * Usage: - * @code - * Uint8 *keystate = SDL_GetKeyState(NULL); - * if ( keystate[SDLK_RETURN] ) //... \ is pressed. - * @endcode - */ -extern DECLSPEC Uint8 * SDLCALL SDL_GetKeyState(int *numkeys); - -/** - * Get the current key modifier state - */ -extern DECLSPEC SDLMod SDLCALL SDL_GetModState(void); - -/** - * Set the current key modifier state. - * This does not change the keyboard state, only the key modifier flags. - */ -extern DECLSPEC void SDLCALL SDL_SetModState(SDLMod modstate); - -/** - * Get the name of an SDL virtual keysym - */ -extern DECLSPEC char * SDLCALL SDL_GetKeyName(SDLKey key); - - -/* Ends C function definitions when using C++ */ -#ifdef __cplusplus -} -#endif -#include "close_code.h" - -#endif /* _SDL_keyboard_h */ diff --git a/dji_sdk_manifold_read_cam/include/sdl/SDL_keysym.h b/dji_sdk_manifold_read_cam/include/sdl/SDL_keysym.h deleted file mode 100644 index f2ad12b..0000000 --- a/dji_sdk_manifold_read_cam/include/sdl/SDL_keysym.h +++ /dev/null @@ -1,326 +0,0 @@ -/* - SDL - Simple DirectMedia Layer - Copyright (C) 1997-2012 Sam Lantinga - - This library is free software; you can redistribute it and/or - modify it under the terms of the GNU Lesser General Public - License as published by the Free Software Foundation; either - version 2.1 of the License, or (at your option) any later version. - - This library is distributed in the hope that it will be useful, - but WITHOUT ANY WARRANTY; without even the implied warranty of - MERCHANTABILITY or FITNESS FOR A PARTICULAR PURPOSE. See the GNU - Lesser General Public License for more details. - - You should have received a copy of the GNU Lesser General Public - License along with this library; if not, write to the Free Software - Foundation, Inc., 51 Franklin St, Fifth Floor, Boston, MA 02110-1301 USA - - Sam Lantinga - slouken@libsdl.org -*/ - -#ifndef _SDL_keysym_h -#define _SDL_keysym_h - -/** What we really want is a mapping of every raw key on the keyboard. - * To support international keyboards, we use the range 0xA1 - 0xFF - * as international virtual keycodes. We'll follow in the footsteps of X11... - * @brief The names of the keys - */ -typedef enum { - /** @name ASCII mapped keysyms - * The keyboard syms have been cleverly chosen to map to ASCII - */ - /*@{*/ - SDLK_UNKNOWN = 0, - SDLK_FIRST = 0, - SDLK_BACKSPACE = 8, - SDLK_TAB = 9, - SDLK_CLEAR = 12, - SDLK_RETURN = 13, - SDLK_PAUSE = 19, - SDLK_ESCAPE = 27, - SDLK_SPACE = 32, - SDLK_EXCLAIM = 33, - SDLK_QUOTEDBL = 34, - SDLK_HASH = 35, - SDLK_DOLLAR = 36, - SDLK_AMPERSAND = 38, - SDLK_QUOTE = 39, - SDLK_LEFTPAREN = 40, - SDLK_RIGHTPAREN = 41, - SDLK_ASTERISK = 42, - SDLK_PLUS = 43, - SDLK_COMMA = 44, - SDLK_MINUS = 45, - SDLK_PERIOD = 46, - SDLK_SLASH = 47, - SDLK_0 = 48, - SDLK_1 = 49, - SDLK_2 = 50, - SDLK_3 = 51, - SDLK_4 = 52, - SDLK_5 = 53, - SDLK_6 = 54, - SDLK_7 = 55, - SDLK_8 = 56, - SDLK_9 = 57, - SDLK_COLON = 58, - SDLK_SEMICOLON = 59, - SDLK_LESS = 60, - SDLK_EQUALS = 61, - SDLK_GREATER = 62, - SDLK_QUESTION = 63, - SDLK_AT = 64, - /* - Skip uppercase letters - */ - SDLK_LEFTBRACKET = 91, - SDLK_BACKSLASH = 92, - SDLK_RIGHTBRACKET = 93, - SDLK_CARET = 94, - SDLK_UNDERSCORE = 95, - SDLK_BACKQUOTE = 96, - SDLK_a = 97, - SDLK_b = 98, - SDLK_c = 99, - SDLK_d = 100, - SDLK_e = 101, - SDLK_f = 102, - SDLK_g = 103, - SDLK_h = 104, - SDLK_i = 105, - SDLK_j = 106, - SDLK_k = 107, - SDLK_l = 108, - SDLK_m = 109, - SDLK_n = 110, - SDLK_o = 111, - SDLK_p = 112, - SDLK_q = 113, - SDLK_r = 114, - SDLK_s = 115, - SDLK_t = 116, - SDLK_u = 117, - SDLK_v = 118, - SDLK_w = 119, - SDLK_x = 120, - SDLK_y = 121, - SDLK_z = 122, - SDLK_DELETE = 127, - /* End of ASCII mapped keysyms */ - /*@}*/ - - /** @name International keyboard syms */ - /*@{*/ - SDLK_WORLD_0 = 160, /* 0xA0 */ - SDLK_WORLD_1 = 161, - SDLK_WORLD_2 = 162, - SDLK_WORLD_3 = 163, - SDLK_WORLD_4 = 164, - SDLK_WORLD_5 = 165, - SDLK_WORLD_6 = 166, - SDLK_WORLD_7 = 167, - SDLK_WORLD_8 = 168, - SDLK_WORLD_9 = 169, - SDLK_WORLD_10 = 170, - SDLK_WORLD_11 = 171, - SDLK_WORLD_12 = 172, - SDLK_WORLD_13 = 173, - SDLK_WORLD_14 = 174, - SDLK_WORLD_15 = 175, - SDLK_WORLD_16 = 176, - SDLK_WORLD_17 = 177, - SDLK_WORLD_18 = 178, - SDLK_WORLD_19 = 179, - SDLK_WORLD_20 = 180, - SDLK_WORLD_21 = 181, - SDLK_WORLD_22 = 182, - SDLK_WORLD_23 = 183, - SDLK_WORLD_24 = 184, - SDLK_WORLD_25 = 185, - SDLK_WORLD_26 = 186, - SDLK_WORLD_27 = 187, - SDLK_WORLD_28 = 188, - SDLK_WORLD_29 = 189, - SDLK_WORLD_30 = 190, - SDLK_WORLD_31 = 191, - SDLK_WORLD_32 = 192, - SDLK_WORLD_33 = 193, - SDLK_WORLD_34 = 194, - SDLK_WORLD_35 = 195, - SDLK_WORLD_36 = 196, - SDLK_WORLD_37 = 197, - SDLK_WORLD_38 = 198, - SDLK_WORLD_39 = 199, - SDLK_WORLD_40 = 200, - SDLK_WORLD_41 = 201, - SDLK_WORLD_42 = 202, - SDLK_WORLD_43 = 203, - SDLK_WORLD_44 = 204, - SDLK_WORLD_45 = 205, - SDLK_WORLD_46 = 206, - SDLK_WORLD_47 = 207, - SDLK_WORLD_48 = 208, - SDLK_WORLD_49 = 209, - SDLK_WORLD_50 = 210, - SDLK_WORLD_51 = 211, - SDLK_WORLD_52 = 212, - SDLK_WORLD_53 = 213, - SDLK_WORLD_54 = 214, - SDLK_WORLD_55 = 215, - SDLK_WORLD_56 = 216, - SDLK_WORLD_57 = 217, - SDLK_WORLD_58 = 218, - SDLK_WORLD_59 = 219, - SDLK_WORLD_60 = 220, - SDLK_WORLD_61 = 221, - SDLK_WORLD_62 = 222, - SDLK_WORLD_63 = 223, - SDLK_WORLD_64 = 224, - SDLK_WORLD_65 = 225, - SDLK_WORLD_66 = 226, - SDLK_WORLD_67 = 227, - SDLK_WORLD_68 = 228, - SDLK_WORLD_69 = 229, - SDLK_WORLD_70 = 230, - SDLK_WORLD_71 = 231, - SDLK_WORLD_72 = 232, - SDLK_WORLD_73 = 233, - SDLK_WORLD_74 = 234, - SDLK_WORLD_75 = 235, - SDLK_WORLD_76 = 236, - SDLK_WORLD_77 = 237, - SDLK_WORLD_78 = 238, - SDLK_WORLD_79 = 239, - SDLK_WORLD_80 = 240, - SDLK_WORLD_81 = 241, - SDLK_WORLD_82 = 242, - SDLK_WORLD_83 = 243, - SDLK_WORLD_84 = 244, - SDLK_WORLD_85 = 245, - SDLK_WORLD_86 = 246, - SDLK_WORLD_87 = 247, - SDLK_WORLD_88 = 248, - SDLK_WORLD_89 = 249, - SDLK_WORLD_90 = 250, - SDLK_WORLD_91 = 251, - SDLK_WORLD_92 = 252, - SDLK_WORLD_93 = 253, - SDLK_WORLD_94 = 254, - SDLK_WORLD_95 = 255, /* 0xFF */ - /*@}*/ - - /** @name Numeric keypad */ - /*@{*/ - SDLK_KP0 = 256, - SDLK_KP1 = 257, - SDLK_KP2 = 258, - SDLK_KP3 = 259, - SDLK_KP4 = 260, - SDLK_KP5 = 261, - SDLK_KP6 = 262, - SDLK_KP7 = 263, - SDLK_KP8 = 264, - SDLK_KP9 = 265, - SDLK_KP_PERIOD = 266, - SDLK_KP_DIVIDE = 267, - SDLK_KP_MULTIPLY = 268, - SDLK_KP_MINUS = 269, - SDLK_KP_PLUS = 270, - SDLK_KP_ENTER = 271, - SDLK_KP_EQUALS = 272, - /*@}*/ - - /** @name Arrows + Home/End pad */ - /*@{*/ - SDLK_UP = 273, - SDLK_DOWN = 274, - SDLK_RIGHT = 275, - SDLK_LEFT = 276, - SDLK_INSERT = 277, - SDLK_HOME = 278, - SDLK_END = 279, - SDLK_PAGEUP = 280, - SDLK_PAGEDOWN = 281, - /*@}*/ - - /** @name Function keys */ - /*@{*/ - SDLK_F1 = 282, - SDLK_F2 = 283, - SDLK_F3 = 284, - SDLK_F4 = 285, - SDLK_F5 = 286, - SDLK_F6 = 287, - SDLK_F7 = 288, - SDLK_F8 = 289, - SDLK_F9 = 290, - SDLK_F10 = 291, - SDLK_F11 = 292, - SDLK_F12 = 293, - SDLK_F13 = 294, - SDLK_F14 = 295, - SDLK_F15 = 296, - /*@}*/ - - /** @name Key state modifier keys */ - /*@{*/ - SDLK_NUMLOCK = 300, - SDLK_CAPSLOCK = 301, - SDLK_SCROLLOCK = 302, - SDLK_RSHIFT = 303, - SDLK_LSHIFT = 304, - SDLK_RCTRL = 305, - SDLK_LCTRL = 306, - SDLK_RALT = 307, - SDLK_LALT = 308, - SDLK_RMETA = 309, - SDLK_LMETA = 310, - SDLK_LSUPER = 311, /**< Left "Windows" key */ - SDLK_RSUPER = 312, /**< Right "Windows" key */ - SDLK_MODE = 313, /**< "Alt Gr" key */ - SDLK_COMPOSE = 314, /**< Multi-key compose key */ - /*@}*/ - - /** @name Miscellaneous function keys */ - /*@{*/ - SDLK_HELP = 315, - SDLK_PRINT = 316, - SDLK_SYSREQ = 317, - SDLK_BREAK = 318, - SDLK_MENU = 319, - SDLK_POWER = 320, /**< Power Macintosh power key */ - SDLK_EURO = 321, /**< Some european keyboards */ - SDLK_UNDO = 322, /**< Atari keyboard has Undo */ - /*@}*/ - - /* Add any other keys here */ - - SDLK_LAST -} SDLKey; - -/** Enumeration of valid key mods (possibly OR'd together) */ -typedef enum { - KMOD_NONE = 0x0000, - KMOD_LSHIFT= 0x0001, - KMOD_RSHIFT= 0x0002, - KMOD_LCTRL = 0x0040, - KMOD_RCTRL = 0x0080, - KMOD_LALT = 0x0100, - KMOD_RALT = 0x0200, - KMOD_LMETA = 0x0400, - KMOD_RMETA = 0x0800, - KMOD_NUM = 0x1000, - KMOD_CAPS = 0x2000, - KMOD_MODE = 0x4000, - KMOD_RESERVED = 0x8000 -} SDLMod; - -#define KMOD_CTRL (KMOD_LCTRL|KMOD_RCTRL) -#define KMOD_SHIFT (KMOD_LSHIFT|KMOD_RSHIFT) -#define KMOD_ALT (KMOD_LALT|KMOD_RALT) -#define KMOD_META (KMOD_LMETA|KMOD_RMETA) - -#endif /* _SDL_keysym_h */ diff --git a/dji_sdk_manifold_read_cam/include/sdl/SDL_loadso.h b/dji_sdk_manifold_read_cam/include/sdl/SDL_loadso.h deleted file mode 100644 index 0c5e536..0000000 --- a/dji_sdk_manifold_read_cam/include/sdl/SDL_loadso.h +++ /dev/null @@ -1,78 +0,0 @@ -/* - SDL - Simple DirectMedia Layer - Copyright (C) 1997-2012 Sam Lantinga - - This library is free software; you can redistribute it and/or - modify it under the terms of the GNU Lesser General Public - License as published by the Free Software Foundation; either - version 2.1 of the License, or (at your option) any later version. - - This library is distributed in the hope that it will be useful, - but WITHOUT ANY WARRANTY; without even the implied warranty of - MERCHANTABILITY or FITNESS FOR A PARTICULAR PURPOSE. See the GNU - Lesser General Public License for more details. - - You should have received a copy of the GNU Lesser General Public - License along with this library; if not, write to the Free Software - Foundation, Inc., 51 Franklin St, Fifth Floor, Boston, MA 02110-1301 USA - - Sam Lantinga - slouken@libsdl.org -*/ - -/** @file SDL_loadso.h - * System dependent library loading routines - */ - -/** @file SDL_loadso.h - * Some things to keep in mind: - * - These functions only work on C function names. Other languages may - * have name mangling and intrinsic language support that varies from - * compiler to compiler. - * - Make sure you declare your function pointers with the same calling - * convention as the actual library function. Your code will crash - * mysteriously if you do not do this. - * - Avoid namespace collisions. If you load a symbol from the library, - * it is not defined whether or not it goes into the global symbol - * namespace for the application. If it does and it conflicts with - * symbols in your code or other shared libraries, you will not get - * the results you expect. :) - */ - - -#ifndef _SDL_loadso_h -#define _SDL_loadso_h - -#include "SDL_stdinc.h" -#include "SDL_error.h" - -#include "begin_code.h" -/* Set up for C function definitions, even when using C++ */ -#ifdef __cplusplus -extern "C" { -#endif - -/** - * This function dynamically loads a shared object and returns a pointer - * to the object handle (or NULL if there was an error). - * The 'sofile' parameter is a system dependent name of the object file. - */ -extern DECLSPEC void * SDLCALL SDL_LoadObject(const char *sofile); - -/** - * Given an object handle, this function looks up the address of the - * named function in the shared object and returns it. This address - * is no longer valid after calling SDL_UnloadObject(). - */ -extern DECLSPEC void * SDLCALL SDL_LoadFunction(void *handle, const char *name); - -/** Unload a shared object from memory */ -extern DECLSPEC void SDLCALL SDL_UnloadObject(void *handle); - -/* Ends C function definitions when using C++ */ -#ifdef __cplusplus -} -#endif -#include "close_code.h" - -#endif /* _SDL_loadso_h */ diff --git a/dji_sdk_manifold_read_cam/include/sdl/SDL_main.h b/dji_sdk_manifold_read_cam/include/sdl/SDL_main.h deleted file mode 100644 index ab50ef1..0000000 --- a/dji_sdk_manifold_read_cam/include/sdl/SDL_main.h +++ /dev/null @@ -1,106 +0,0 @@ -/* - SDL - Simple DirectMedia Layer - Copyright (C) 1997-2012 Sam Lantinga - - This library is free software; you can redistribute it and/or - modify it under the terms of the GNU Lesser General Public - License as published by the Free Software Foundation; either - version 2.1 of the License, or (at your option) any later version. - - This library is distributed in the hope that it will be useful, - but WITHOUT ANY WARRANTY; without even the implied warranty of - MERCHANTABILITY or FITNESS FOR A PARTICULAR PURPOSE. See the GNU - Lesser General Public License for more details. - - You should have received a copy of the GNU Lesser General Public - License along with this library; if not, write to the Free Software - Foundation, Inc., 51 Franklin St, Fifth Floor, Boston, MA 02110-1301 USA - - Sam Lantinga - slouken@libsdl.org -*/ - -#ifndef _SDL_main_h -#define _SDL_main_h - -#include "SDL_stdinc.h" - -/** @file SDL_main.h - * Redefine main() on Win32 and MacOS so that it is called by winmain.c - */ - -#if defined(__WIN32__) || \ - (defined(__MWERKS__) && !defined(__BEOS__)) || \ - defined(__MACOS__) || defined(__MACOSX__) || \ - defined(__SYMBIAN32__) || defined(QWS) - -#ifdef __cplusplus -#define C_LINKAGE "C" -#else -#define C_LINKAGE -#endif /* __cplusplus */ - -/** The application's main() function must be called with C linkage, - * and should be declared like this: - * @code - * #ifdef __cplusplus - * extern "C" - * #endif - * int main(int argc, char *argv[]) - * { - * } - * @endcode - */ -#define main SDL_main - -/** The prototype for the application's main() function */ -extern C_LINKAGE int SDL_main(int argc, char *argv[]); - - -/** @name From the SDL library code -- needed for registering the app on Win32 */ -/*@{*/ -#ifdef __WIN32__ - -#include "begin_code.h" -#ifdef __cplusplus -extern "C" { -#endif - -/** This should be called from your WinMain() function, if any */ -extern DECLSPEC void SDLCALL SDL_SetModuleHandle(void *hInst); -/** This can also be called, but is no longer necessary */ -extern DECLSPEC int SDLCALL SDL_RegisterApp(char *name, Uint32 style, void *hInst); -/** This can also be called, but is no longer necessary (SDL_Quit calls it) */ -extern DECLSPEC void SDLCALL SDL_UnregisterApp(void); -#ifdef __cplusplus -} -#endif -#include "close_code.h" -#endif -/*@}*/ - -/** @name From the SDL library code -- needed for registering QuickDraw on MacOS */ -/*@{*/ -#if defined(__MACOS__) - -#include "begin_code.h" -#ifdef __cplusplus -extern "C" { -#endif - -/** Forward declaration so we don't need to include QuickDraw.h */ -struct QDGlobals; - -/** This should be called from your main() function, if any */ -extern DECLSPEC void SDLCALL SDL_InitQuickDraw(struct QDGlobals *the_qd); - -#ifdef __cplusplus -} -#endif -#include "close_code.h" -#endif -/*@}*/ - -#endif /* Need to redefine main()? */ - -#endif /* _SDL_main_h */ diff --git a/dji_sdk_manifold_read_cam/include/sdl/SDL_mouse.h b/dji_sdk_manifold_read_cam/include/sdl/SDL_mouse.h deleted file mode 100644 index 7c563b9..0000000 --- a/dji_sdk_manifold_read_cam/include/sdl/SDL_mouse.h +++ /dev/null @@ -1,143 +0,0 @@ -/* - SDL - Simple DirectMedia Layer - Copyright (C) 1997-2012 Sam Lantinga - - This library is free software; you can redistribute it and/or - modify it under the terms of the GNU Lesser General Public - License as published by the Free Software Foundation; either - version 2.1 of the License, or (at your option) any later version. - - This library is distributed in the hope that it will be useful, - but WITHOUT ANY WARRANTY; without even the implied warranty of - MERCHANTABILITY or FITNESS FOR A PARTICULAR PURPOSE. See the GNU - Lesser General Public License for more details. - - You should have received a copy of the GNU Lesser General Public - License along with this library; if not, write to the Free Software - Foundation, Inc., 51 Franklin St, Fifth Floor, Boston, MA 02110-1301 USA - - Sam Lantinga - slouken@libsdl.org -*/ - -/** @file SDL_mouse.h - * Include file for SDL mouse event handling - */ - -#ifndef _SDL_mouse_h -#define _SDL_mouse_h - -#include "SDL_stdinc.h" -#include "SDL_error.h" -#include "SDL_video.h" - -#include "begin_code.h" -/* Set up for C function definitions, even when using C++ */ -#ifdef __cplusplus -extern "C" { -#endif - -typedef struct WMcursor WMcursor; /**< Implementation dependent */ -typedef struct SDL_Cursor { - SDL_Rect area; /**< The area of the mouse cursor */ - Sint16 hot_x, hot_y; /**< The "tip" of the cursor */ - Uint8 *data; /**< B/W cursor data */ - Uint8 *mask; /**< B/W cursor mask */ - Uint8 *save[2]; /**< Place to save cursor area */ - WMcursor *wm_cursor; /**< Window-manager cursor */ -} SDL_Cursor; - -/* Function prototypes */ -/** - * Retrieve the current state of the mouse. - * The current button state is returned as a button bitmask, which can - * be tested using the SDL_BUTTON(X) macros, and x and y are set to the - * current mouse cursor position. You can pass NULL for either x or y. - */ -extern DECLSPEC Uint8 SDLCALL SDL_GetMouseState(int *x, int *y); - -/** - * Retrieve the current state of the mouse. - * The current button state is returned as a button bitmask, which can - * be tested using the SDL_BUTTON(X) macros, and x and y are set to the - * mouse deltas since the last call to SDL_GetRelativeMouseState(). - */ -extern DECLSPEC Uint8 SDLCALL SDL_GetRelativeMouseState(int *x, int *y); - -/** - * Set the position of the mouse cursor (generates a mouse motion event) - */ -extern DECLSPEC void SDLCALL SDL_WarpMouse(Uint16 x, Uint16 y); - -/** - * Create a cursor using the specified data and mask (in MSB format). - * The cursor width must be a multiple of 8 bits. - * - * The cursor is created in black and white according to the following: - * data mask resulting pixel on screen - * 0 1 White - * 1 1 Black - * 0 0 Transparent - * 1 0 Inverted color if possible, black if not. - * - * Cursors created with this function must be freed with SDL_FreeCursor(). - */ -extern DECLSPEC SDL_Cursor * SDLCALL SDL_CreateCursor - (Uint8 *data, Uint8 *mask, int w, int h, int hot_x, int hot_y); - -/** - * Set the currently active cursor to the specified one. - * If the cursor is currently visible, the change will be immediately - * represented on the display. - */ -extern DECLSPEC void SDLCALL SDL_SetCursor(SDL_Cursor *cursor); - -/** - * Returns the currently active cursor. - */ -extern DECLSPEC SDL_Cursor * SDLCALL SDL_GetCursor(void); - -/** - * Deallocates a cursor created with SDL_CreateCursor(). - */ -extern DECLSPEC void SDLCALL SDL_FreeCursor(SDL_Cursor *cursor); - -/** - * Toggle whether or not the cursor is shown on the screen. - * The cursor start off displayed, but can be turned off. - * SDL_ShowCursor() returns 1 if the cursor was being displayed - * before the call, or 0 if it was not. You can query the current - * state by passing a 'toggle' value of -1. - */ -extern DECLSPEC int SDLCALL SDL_ShowCursor(int toggle); - -/*@{*/ -/** Used as a mask when testing buttons in buttonstate - * Button 1: Left mouse button - * Button 2: Middle mouse button - * Button 3: Right mouse button - * Button 4: Mouse wheel up (may also be a real button) - * Button 5: Mouse wheel down (may also be a real button) - */ -#define SDL_BUTTON(X) (1 << ((X)-1)) -#define SDL_BUTTON_LEFT 1 -#define SDL_BUTTON_MIDDLE 2 -#define SDL_BUTTON_RIGHT 3 -#define SDL_BUTTON_WHEELUP 4 -#define SDL_BUTTON_WHEELDOWN 5 -#define SDL_BUTTON_X1 6 -#define SDL_BUTTON_X2 7 -#define SDL_BUTTON_LMASK SDL_BUTTON(SDL_BUTTON_LEFT) -#define SDL_BUTTON_MMASK SDL_BUTTON(SDL_BUTTON_MIDDLE) -#define SDL_BUTTON_RMASK SDL_BUTTON(SDL_BUTTON_RIGHT) -#define SDL_BUTTON_X1MASK SDL_BUTTON(SDL_BUTTON_X1) -#define SDL_BUTTON_X2MASK SDL_BUTTON(SDL_BUTTON_X2) -/*@}*/ - -/* Ends C function definitions when using C++ */ -#ifdef __cplusplus -} -#endif -#include "close_code.h" - -#endif /* _SDL_mouse_h */ diff --git a/dji_sdk_manifold_read_cam/include/sdl/SDL_mutex.h b/dji_sdk_manifold_read_cam/include/sdl/SDL_mutex.h deleted file mode 100644 index c8da9b1..0000000 --- a/dji_sdk_manifold_read_cam/include/sdl/SDL_mutex.h +++ /dev/null @@ -1,177 +0,0 @@ -/* - SDL - Simple DirectMedia Layer - Copyright (C) 1997-2012 Sam Lantinga - - This library is free software; you can redistribute it and/or - modify it under the terms of the GNU Lesser General Public - License as published by the Free Software Foundation; either - version 2.1 of the License, or (at your option) any later version. - - This library is distributed in the hope that it will be useful, - but WITHOUT ANY WARRANTY; without even the implied warranty of - MERCHANTABILITY or FITNESS FOR A PARTICULAR PURPOSE. See the GNU - Lesser General Public License for more details. - - You should have received a copy of the GNU Lesser General Public - License along with this library; if not, write to the Free Software - Foundation, Inc., 51 Franklin St, Fifth Floor, Boston, MA 02110-1301 USA - - Sam Lantinga - slouken@libsdl.org -*/ - -#ifndef _SDL_mutex_h -#define _SDL_mutex_h - -/** @file SDL_mutex.h - * Functions to provide thread synchronization primitives - * - * @note These are independent of the other SDL routines. - */ - -#include "SDL_stdinc.h" -#include "SDL_error.h" - -#include "begin_code.h" -/* Set up for C function definitions, even when using C++ */ -#ifdef __cplusplus -extern "C" { -#endif - -/** Synchronization functions which can time out return this value - * if they time out. - */ -#define SDL_MUTEX_TIMEDOUT 1 - -/** This is the timeout value which corresponds to never time out */ -#define SDL_MUTEX_MAXWAIT (~(Uint32)0) - - -/* * * * * * * * * * * * * * * * * * * * * * * * * * * * * * * * */ -/** @name Mutex functions */ /*@{*/ -/* * * * * * * * * * * * * * * * * * * * * * * * * * * * * * * * */ - -/** The SDL mutex structure, defined in SDL_mutex.c */ -struct SDL_mutex; -typedef struct SDL_mutex SDL_mutex; - -/** Create a mutex, initialized unlocked */ -extern DECLSPEC SDL_mutex * SDLCALL SDL_CreateMutex(void); - -#define SDL_LockMutex(m) SDL_mutexP(m) -/** Lock the mutex - * @return 0, or -1 on error - */ -extern DECLSPEC int SDLCALL SDL_mutexP(SDL_mutex *mutex); - -#define SDL_UnlockMutex(m) SDL_mutexV(m) -/** Unlock the mutex - * @return 0, or -1 on error - * - * It is an error to unlock a mutex that has not been locked by - * the current thread, and doing so results in undefined behavior. - */ -extern DECLSPEC int SDLCALL SDL_mutexV(SDL_mutex *mutex); - -/** Destroy a mutex */ -extern DECLSPEC void SDLCALL SDL_DestroyMutex(SDL_mutex *mutex); - -/*@}*/ - -/* * * * * * * * * * * * * * * * * * * * * * * * * * * * * * * * */ -/** @name Semaphore functions */ /*@{*/ -/* * * * * * * * * * * * * * * * * * * * * * * * * * * * * * * * */ - -/** The SDL semaphore structure, defined in SDL_sem.c */ -struct SDL_semaphore; -typedef struct SDL_semaphore SDL_sem; - -/** Create a semaphore, initialized with value, returns NULL on failure. */ -extern DECLSPEC SDL_sem * SDLCALL SDL_CreateSemaphore(Uint32 initial_value); - -/** Destroy a semaphore */ -extern DECLSPEC void SDLCALL SDL_DestroySemaphore(SDL_sem *sem); - -/** - * This function suspends the calling thread until the semaphore pointed - * to by sem has a positive count. It then atomically decreases the semaphore - * count. - */ -extern DECLSPEC int SDLCALL SDL_SemWait(SDL_sem *sem); - -/** Non-blocking variant of SDL_SemWait(). - * @return 0 if the wait succeeds, - * SDL_MUTEX_TIMEDOUT if the wait would block, and -1 on error. - */ -extern DECLSPEC int SDLCALL SDL_SemTryWait(SDL_sem *sem); - -/** Variant of SDL_SemWait() with a timeout in milliseconds, returns 0 if - * the wait succeeds, SDL_MUTEX_TIMEDOUT if the wait does not succeed in - * the allotted time, and -1 on error. - * - * On some platforms this function is implemented by looping with a delay - * of 1 ms, and so should be avoided if possible. - */ -extern DECLSPEC int SDLCALL SDL_SemWaitTimeout(SDL_sem *sem, Uint32 ms); - -/** Atomically increases the semaphore's count (not blocking). - * @return 0, or -1 on error. - */ -extern DECLSPEC int SDLCALL SDL_SemPost(SDL_sem *sem); - -/** Returns the current count of the semaphore */ -extern DECLSPEC Uint32 SDLCALL SDL_SemValue(SDL_sem *sem); - -/*@}*/ - -/* * * * * * * * * * * * * * * * * * * * * * * * * * * * * * * * */ -/** @name Condition_variable_functions */ /*@{*/ -/* * * * * * * * * * * * * * * * * * * * * * * * * * * * * * * * */ - -/*@{*/ -/** The SDL condition variable structure, defined in SDL_cond.c */ -struct SDL_cond; -typedef struct SDL_cond SDL_cond; -/*@}*/ - -/** Create a condition variable */ -extern DECLSPEC SDL_cond * SDLCALL SDL_CreateCond(void); - -/** Destroy a condition variable */ -extern DECLSPEC void SDLCALL SDL_DestroyCond(SDL_cond *cond); - -/** Restart one of the threads that are waiting on the condition variable, - * @return 0 or -1 on error. - */ -extern DECLSPEC int SDLCALL SDL_CondSignal(SDL_cond *cond); - -/** Restart all threads that are waiting on the condition variable, - * @return 0 or -1 on error. - */ -extern DECLSPEC int SDLCALL SDL_CondBroadcast(SDL_cond *cond); - -/** Wait on the condition variable, unlocking the provided mutex. - * The mutex must be locked before entering this function! - * The mutex is re-locked once the condition variable is signaled. - * @return 0 when it is signaled, or -1 on error. - */ -extern DECLSPEC int SDLCALL SDL_CondWait(SDL_cond *cond, SDL_mutex *mut); - -/** Waits for at most 'ms' milliseconds, and returns 0 if the condition - * variable is signaled, SDL_MUTEX_TIMEDOUT if the condition is not - * signaled in the allotted time, and -1 on error. - * On some platforms this function is implemented by looping with a delay - * of 1 ms, and so should be avoided if possible. - */ -extern DECLSPEC int SDLCALL SDL_CondWaitTimeout(SDL_cond *cond, SDL_mutex *mutex, Uint32 ms); - -/*@}*/ - -/* Ends C function definitions when using C++ */ -#ifdef __cplusplus -} -#endif -#include "close_code.h" - -#endif /* _SDL_mutex_h */ - diff --git a/dji_sdk_manifold_read_cam/include/sdl/SDL_name.h b/dji_sdk_manifold_read_cam/include/sdl/SDL_name.h deleted file mode 100644 index 511619a..0000000 --- a/dji_sdk_manifold_read_cam/include/sdl/SDL_name.h +++ /dev/null @@ -1,11 +0,0 @@ - -#ifndef _SDLname_h_ -#define _SDLname_h_ - -#if defined(__STDC__) || defined(__cplusplus) -#define NeedFunctionPrototypes 1 -#endif - -#define SDL_NAME(X) SDL_##X - -#endif /* _SDLname_h_ */ diff --git a/dji_sdk_manifold_read_cam/include/sdl/SDL_opengl.h b/dji_sdk_manifold_read_cam/include/sdl/SDL_opengl.h deleted file mode 100644 index 3d791d6..0000000 --- a/dji_sdk_manifold_read_cam/include/sdl/SDL_opengl.h +++ /dev/null @@ -1,6570 +0,0 @@ -/* - SDL - Simple DirectMedia Layer - Copyright (C) 1997-2012 Sam Lantinga - - This library is free software; you can redistribute it and/or - modify it under the terms of the GNU Lesser General Public - License as published by the Free Software Foundation; either - version 2.1 of the License, or (at your option) any later version. - - This library is distributed in the hope that it will be useful, - but WITHOUT ANY WARRANTY; without even the implied warranty of - MERCHANTABILITY or FITNESS FOR A PARTICULAR PURPOSE. See the GNU - Lesser General Public License for more details. - - You should have received a copy of the GNU Lesser General Public - License along with this library; if not, write to the Free Software - Foundation, Inc., 51 Franklin St, Fifth Floor, Boston, MA 02110-1301 USA - - Sam Lantinga - slouken@libsdl.org -*/ - -/** @file SDL_opengl.h - * This is a simple file to encapsulate the OpenGL API headers - */ - -#include "SDL_config.h" - -#ifdef __WIN32__ -#define WIN32_LEAN_AND_MEAN -#ifndef NOMINMAX -#define NOMINMAX /* Don't defined min() and max() */ -#endif -#include -#endif -#ifndef NO_SDL_GLEXT -#define __glext_h_ /* Don't let gl.h include glext.h */ -#endif -#if defined(__MACOSX__) -#include /* Header File For The OpenGL Library */ -#include /* Header File For The GLU Library */ -#elif defined(__MACOS__) -#include /* Header File For The OpenGL Library */ -#include /* Header File For The GLU Library */ -#else -#include /* Header File For The OpenGL Library */ -#include /* Header File For The GLU Library */ -#endif -#ifndef NO_SDL_GLEXT -#undef __glext_h_ -#endif - -/** @name GLext.h - * This file taken from "GLext.h" from the Jeff Molofee OpenGL tutorials. - * It is included here because glext.h is not available on some systems. - * If you don't want this version included, simply define "NO_SDL_GLEXT" - */ -/*@{*/ -#ifndef NO_SDL_GLEXT -#if !defined(__glext_h_) && !defined(GL_GLEXT_LEGACY) -#define __glext_h_ - -#ifdef __cplusplus -extern "C" { -#endif - -/* -** License Applicability. Except to the extent portions of this file are -** made subject to an alternative license as permitted in the SGI Free -** Software License B, Version 1.1 (the "License"), the contents of this -** file are subject only to the provisions of the License. You may not use -** this file except in compliance with the License. You may obtain a copy -** of the License at Silicon Graphics, Inc., attn: Legal Services, 1600 -** Amphitheatre Parkway, Mountain View, CA 94043-1351, or at: -** -** http://oss.sgi.com/projects/FreeB -** -** Note that, as provided in the License, the Software is distributed on an -** "AS IS" basis, with ALL EXPRESS AND IMPLIED WARRANTIES AND CONDITIONS -** DISCLAIMED, INCLUDING, WITHOUT LIMITATION, ANY IMPLIED WARRANTIES AND -** CONDITIONS OF MERCHANTABILITY, SATISFACTORY QUALITY, FITNESS FOR A -** PARTICULAR PURPOSE, AND NON-INFRINGEMENT. -** -** Original Code. The Original Code is: OpenGL Sample Implementation, -** Version 1.2.1, released January 26, 2000, developed by Silicon Graphics, -** Inc. The Original Code is Copyright (c) 1991-2004 Silicon Graphics, Inc. -** Copyright in any portions created by third parties is as indicated -** elsewhere herein. All Rights Reserved. -** -** Additional Notice Provisions: This software was created using the -** OpenGL(R) version 1.2.1 Sample Implementation published by SGI, but has -** not been independently verified as being compliant with the OpenGL(R) -** version 1.2.1 Specification. -*/ - -#if defined(_WIN32) && !defined(APIENTRY) && !defined(__CYGWIN__) && !defined(__SCITECH_SNAP__) -#define WIN32_LEAN_AND_MEAN 1 -#include -#endif - -#ifndef APIENTRY -#define APIENTRY -#endif -#ifndef APIENTRYP -#define APIENTRYP APIENTRY * -#endif -#ifndef GLAPI -#define GLAPI extern -#endif - -/*************************************************************/ - -/* Header file version number, required by OpenGL ABI for Linux */ -/* glext.h last updated 2005/06/20 */ -/* Current version at http://oss.sgi.com/projects/ogl-sample/registry/ */ -#define GL_GLEXT_VERSION 29 - -#ifndef GL_VERSION_1_2 -#define GL_UNSIGNED_BYTE_3_3_2 0x8032 -#define GL_UNSIGNED_SHORT_4_4_4_4 0x8033 -#define GL_UNSIGNED_SHORT_5_5_5_1 0x8034 -#define GL_UNSIGNED_INT_8_8_8_8 0x8035 -#define GL_UNSIGNED_INT_10_10_10_2 0x8036 -#define GL_RESCALE_NORMAL 0x803A -#define GL_TEXTURE_BINDING_3D 0x806A -#define GL_PACK_SKIP_IMAGES 0x806B -#define GL_PACK_IMAGE_HEIGHT 0x806C -#define GL_UNPACK_SKIP_IMAGES 0x806D -#define GL_UNPACK_IMAGE_HEIGHT 0x806E -#define GL_TEXTURE_3D 0x806F -#define GL_PROXY_TEXTURE_3D 0x8070 -#define GL_TEXTURE_DEPTH 0x8071 -#define GL_TEXTURE_WRAP_R 0x8072 -#define GL_MAX_3D_TEXTURE_SIZE 0x8073 -#define GL_UNSIGNED_BYTE_2_3_3_REV 0x8362 -#define GL_UNSIGNED_SHORT_5_6_5 0x8363 -#define GL_UNSIGNED_SHORT_5_6_5_REV 0x8364 -#define GL_UNSIGNED_SHORT_4_4_4_4_REV 0x8365 -#define GL_UNSIGNED_SHORT_1_5_5_5_REV 0x8366 -#define GL_UNSIGNED_INT_8_8_8_8_REV 0x8367 -#define GL_UNSIGNED_INT_2_10_10_10_REV 0x8368 -#define GL_BGR 0x80E0 -#define GL_BGRA 0x80E1 -#define GL_MAX_ELEMENTS_VERTICES 0x80E8 -#define GL_MAX_ELEMENTS_INDICES 0x80E9 -#define GL_CLAMP_TO_EDGE 0x812F -#define GL_TEXTURE_MIN_LOD 0x813A -#define GL_TEXTURE_MAX_LOD 0x813B -#define GL_TEXTURE_BASE_LEVEL 0x813C -#define GL_TEXTURE_MAX_LEVEL 0x813D -#define GL_LIGHT_MODEL_COLOR_CONTROL 0x81F8 -#define GL_SINGLE_COLOR 0x81F9 -#define GL_SEPARATE_SPECULAR_COLOR 0x81FA -#define GL_SMOOTH_POINT_SIZE_RANGE 0x0B12 -#define GL_SMOOTH_POINT_SIZE_GRANULARITY 0x0B13 -#define GL_SMOOTH_LINE_WIDTH_RANGE 0x0B22 -#define GL_SMOOTH_LINE_WIDTH_GRANULARITY 0x0B23 -#define GL_ALIASED_POINT_SIZE_RANGE 0x846D -#define GL_ALIASED_LINE_WIDTH_RANGE 0x846E -#endif - -#ifndef GL_ARB_imaging -#define GL_CONSTANT_COLOR 0x8001 -#define GL_ONE_MINUS_CONSTANT_COLOR 0x8002 -#define GL_CONSTANT_ALPHA 0x8003 -#define GL_ONE_MINUS_CONSTANT_ALPHA 0x8004 -#define GL_BLEND_COLOR 0x8005 -#define GL_FUNC_ADD 0x8006 -#define GL_MIN 0x8007 -#define GL_MAX 0x8008 -#define GL_BLEND_EQUATION 0x8009 -#define GL_FUNC_SUBTRACT 0x800A -#define GL_FUNC_REVERSE_SUBTRACT 0x800B -#define GL_CONVOLUTION_1D 0x8010 -#define GL_CONVOLUTION_2D 0x8011 -#define GL_SEPARABLE_2D 0x8012 -#define GL_CONVOLUTION_BORDER_MODE 0x8013 -#define GL_CONVOLUTION_FILTER_SCALE 0x8014 -#define GL_CONVOLUTION_FILTER_BIAS 0x8015 -#define GL_REDUCE 0x8016 -#define GL_CONVOLUTION_FORMAT 0x8017 -#define GL_CONVOLUTION_WIDTH 0x8018 -#define GL_CONVOLUTION_HEIGHT 0x8019 -#define GL_MAX_CONVOLUTION_WIDTH 0x801A -#define GL_MAX_CONVOLUTION_HEIGHT 0x801B -#define GL_POST_CONVOLUTION_RED_SCALE 0x801C -#define GL_POST_CONVOLUTION_GREEN_SCALE 0x801D -#define GL_POST_CONVOLUTION_BLUE_SCALE 0x801E -#define GL_POST_CONVOLUTION_ALPHA_SCALE 0x801F -#define GL_POST_CONVOLUTION_RED_BIAS 0x8020 -#define GL_POST_CONVOLUTION_GREEN_BIAS 0x8021 -#define GL_POST_CONVOLUTION_BLUE_BIAS 0x8022 -#define GL_POST_CONVOLUTION_ALPHA_BIAS 0x8023 -#define GL_HISTOGRAM 0x8024 -#define GL_PROXY_HISTOGRAM 0x8025 -#define GL_HISTOGRAM_WIDTH 0x8026 -#define GL_HISTOGRAM_FORMAT 0x8027 -#define GL_HISTOGRAM_RED_SIZE 0x8028 -#define GL_HISTOGRAM_GREEN_SIZE 0x8029 -#define GL_HISTOGRAM_BLUE_SIZE 0x802A -#define GL_HISTOGRAM_ALPHA_SIZE 0x802B -#define GL_HISTOGRAM_LUMINANCE_SIZE 0x802C -#define GL_HISTOGRAM_SINK 0x802D -#define GL_MINMAX 0x802E -#define GL_MINMAX_FORMAT 0x802F -#define GL_MINMAX_SINK 0x8030 -#define GL_TABLE_TOO_LARGE 0x8031 -#define GL_COLOR_MATRIX 0x80B1 -#define GL_COLOR_MATRIX_STACK_DEPTH 0x80B2 -#define GL_MAX_COLOR_MATRIX_STACK_DEPTH 0x80B3 -#define GL_POST_COLOR_MATRIX_RED_SCALE 0x80B4 -#define GL_POST_COLOR_MATRIX_GREEN_SCALE 0x80B5 -#define GL_POST_COLOR_MATRIX_BLUE_SCALE 0x80B6 -#define GL_POST_COLOR_MATRIX_ALPHA_SCALE 0x80B7 -#define GL_POST_COLOR_MATRIX_RED_BIAS 0x80B8 -#define GL_POST_COLOR_MATRIX_GREEN_BIAS 0x80B9 -#define GL_POST_COLOR_MATRIX_BLUE_BIAS 0x80BA -#define GL_POST_COLOR_MATRIX_ALPHA_BIAS 0x80BB -#define GL_COLOR_TABLE 0x80D0 -#define GL_POST_CONVOLUTION_COLOR_TABLE 0x80D1 -#define GL_POST_COLOR_MATRIX_COLOR_TABLE 0x80D2 -#define GL_PROXY_COLOR_TABLE 0x80D3 -#define GL_PROXY_POST_CONVOLUTION_COLOR_TABLE 0x80D4 -#define GL_PROXY_POST_COLOR_MATRIX_COLOR_TABLE 0x80D5 -#define GL_COLOR_TABLE_SCALE 0x80D6 -#define GL_COLOR_TABLE_BIAS 0x80D7 -#define GL_COLOR_TABLE_FORMAT 0x80D8 -#define GL_COLOR_TABLE_WIDTH 0x80D9 -#define GL_COLOR_TABLE_RED_SIZE 0x80DA -#define GL_COLOR_TABLE_GREEN_SIZE 0x80DB -#define GL_COLOR_TABLE_BLUE_SIZE 0x80DC -#define GL_COLOR_TABLE_ALPHA_SIZE 0x80DD -#define GL_COLOR_TABLE_LUMINANCE_SIZE 0x80DE -#define GL_COLOR_TABLE_INTENSITY_SIZE 0x80DF -#define GL_CONSTANT_BORDER 0x8151 -#define GL_REPLICATE_BORDER 0x8153 -#define GL_CONVOLUTION_BORDER_COLOR 0x8154 -#endif - -#ifndef GL_VERSION_1_3 -#define GL_TEXTURE0 0x84C0 -#define GL_TEXTURE1 0x84C1 -#define GL_TEXTURE2 0x84C2 -#define GL_TEXTURE3 0x84C3 -#define GL_TEXTURE4 0x84C4 -#define GL_TEXTURE5 0x84C5 -#define GL_TEXTURE6 0x84C6 -#define GL_TEXTURE7 0x84C7 -#define GL_TEXTURE8 0x84C8 -#define GL_TEXTURE9 0x84C9 -#define GL_TEXTURE10 0x84CA -#define GL_TEXTURE11 0x84CB -#define GL_TEXTURE12 0x84CC -#define GL_TEXTURE13 0x84CD -#define GL_TEXTURE14 0x84CE -#define GL_TEXTURE15 0x84CF -#define GL_TEXTURE16 0x84D0 -#define GL_TEXTURE17 0x84D1 -#define GL_TEXTURE18 0x84D2 -#define GL_TEXTURE19 0x84D3 -#define GL_TEXTURE20 0x84D4 -#define GL_TEXTURE21 0x84D5 -#define GL_TEXTURE22 0x84D6 -#define GL_TEXTURE23 0x84D7 -#define GL_TEXTURE24 0x84D8 -#define GL_TEXTURE25 0x84D9 -#define GL_TEXTURE26 0x84DA -#define GL_TEXTURE27 0x84DB -#define GL_TEXTURE28 0x84DC -#define GL_TEXTURE29 0x84DD -#define GL_TEXTURE30 0x84DE -#define GL_TEXTURE31 0x84DF -#define GL_ACTIVE_TEXTURE 0x84E0 -#define GL_CLIENT_ACTIVE_TEXTURE 0x84E1 -#define GL_MAX_TEXTURE_UNITS 0x84E2 -#define GL_TRANSPOSE_MODELVIEW_MATRIX 0x84E3 -#define GL_TRANSPOSE_PROJECTION_MATRIX 0x84E4 -#define GL_TRANSPOSE_TEXTURE_MATRIX 0x84E5 -#define GL_TRANSPOSE_COLOR_MATRIX 0x84E6 -#define GL_MULTISAMPLE 0x809D -#define GL_SAMPLE_ALPHA_TO_COVERAGE 0x809E -#define GL_SAMPLE_ALPHA_TO_ONE 0x809F -#define GL_SAMPLE_COVERAGE 0x80A0 -#define GL_SAMPLE_BUFFERS 0x80A8 -#define GL_SAMPLES 0x80A9 -#define GL_SAMPLE_COVERAGE_VALUE 0x80AA -#define GL_SAMPLE_COVERAGE_INVERT 0x80AB -#define GL_MULTISAMPLE_BIT 0x20000000 -#define GL_NORMAL_MAP 0x8511 -#define GL_REFLECTION_MAP 0x8512 -#define GL_TEXTURE_CUBE_MAP 0x8513 -#define GL_TEXTURE_BINDING_CUBE_MAP 0x8514 -#define GL_TEXTURE_CUBE_MAP_POSITIVE_X 0x8515 -#define GL_TEXTURE_CUBE_MAP_NEGATIVE_X 0x8516 -#define GL_TEXTURE_CUBE_MAP_POSITIVE_Y 0x8517 -#define GL_TEXTURE_CUBE_MAP_NEGATIVE_Y 0x8518 -#define GL_TEXTURE_CUBE_MAP_POSITIVE_Z 0x8519 -#define GL_TEXTURE_CUBE_MAP_NEGATIVE_Z 0x851A -#define GL_PROXY_TEXTURE_CUBE_MAP 0x851B -#define GL_MAX_CUBE_MAP_TEXTURE_SIZE 0x851C -#define GL_COMPRESSED_ALPHA 0x84E9 -#define GL_COMPRESSED_LUMINANCE 0x84EA -#define GL_COMPRESSED_LUMINANCE_ALPHA 0x84EB -#define GL_COMPRESSED_INTENSITY 0x84EC -#define GL_COMPRESSED_RGB 0x84ED -#define GL_COMPRESSED_RGBA 0x84EE -#define GL_TEXTURE_COMPRESSION_HINT 0x84EF -#define GL_TEXTURE_COMPRESSED_IMAGE_SIZE 0x86A0 -#define GL_TEXTURE_COMPRESSED 0x86A1 -#define GL_NUM_COMPRESSED_TEXTURE_FORMATS 0x86A2 -#define GL_COMPRESSED_TEXTURE_FORMATS 0x86A3 -#define GL_CLAMP_TO_BORDER 0x812D -#define GL_COMBINE 0x8570 -#define GL_COMBINE_RGB 0x8571 -#define GL_COMBINE_ALPHA 0x8572 -#define GL_SOURCE0_RGB 0x8580 -#define GL_SOURCE1_RGB 0x8581 -#define GL_SOURCE2_RGB 0x8582 -#define GL_SOURCE0_ALPHA 0x8588 -#define GL_SOURCE1_ALPHA 0x8589 -#define GL_SOURCE2_ALPHA 0x858A -#define GL_OPERAND0_RGB 0x8590 -#define GL_OPERAND1_RGB 0x8591 -#define GL_OPERAND2_RGB 0x8592 -#define GL_OPERAND0_ALPHA 0x8598 -#define GL_OPERAND1_ALPHA 0x8599 -#define GL_OPERAND2_ALPHA 0x859A -#define GL_RGB_SCALE 0x8573 -#define GL_ADD_SIGNED 0x8574 -#define GL_INTERPOLATE 0x8575 -#define GL_SUBTRACT 0x84E7 -#define GL_CONSTANT 0x8576 -#define GL_PRIMARY_COLOR 0x8577 -#define GL_PREVIOUS 0x8578 -#define GL_DOT3_RGB 0x86AE -#define GL_DOT3_RGBA 0x86AF -#endif - -#ifndef GL_VERSION_1_4 -#define GL_BLEND_DST_RGB 0x80C8 -#define GL_BLEND_SRC_RGB 0x80C9 -#define GL_BLEND_DST_ALPHA 0x80CA -#define GL_BLEND_SRC_ALPHA 0x80CB -#define GL_POINT_SIZE_MIN 0x8126 -#define GL_POINT_SIZE_MAX 0x8127 -#define GL_POINT_FADE_THRESHOLD_SIZE 0x8128 -#define GL_POINT_DISTANCE_ATTENUATION 0x8129 -#define GL_GENERATE_MIPMAP 0x8191 -#define GL_GENERATE_MIPMAP_HINT 0x8192 -#define GL_DEPTH_COMPONENT16 0x81A5 -#define GL_DEPTH_COMPONENT24 0x81A6 -#define GL_DEPTH_COMPONENT32 0x81A7 -#define GL_MIRRORED_REPEAT 0x8370 -#define GL_FOG_COORDINATE_SOURCE 0x8450 -#define GL_FOG_COORDINATE 0x8451 -#define GL_FRAGMENT_DEPTH 0x8452 -#define GL_CURRENT_FOG_COORDINATE 0x8453 -#define GL_FOG_COORDINATE_ARRAY_TYPE 0x8454 -#define GL_FOG_COORDINATE_ARRAY_STRIDE 0x8455 -#define GL_FOG_COORDINATE_ARRAY_POINTER 0x8456 -#define GL_FOG_COORDINATE_ARRAY 0x8457 -#define GL_COLOR_SUM 0x8458 -#define GL_CURRENT_SECONDARY_COLOR 0x8459 -#define GL_SECONDARY_COLOR_ARRAY_SIZE 0x845A -#define GL_SECONDARY_COLOR_ARRAY_TYPE 0x845B -#define GL_SECONDARY_COLOR_ARRAY_STRIDE 0x845C -#define GL_SECONDARY_COLOR_ARRAY_POINTER 0x845D -#define GL_SECONDARY_COLOR_ARRAY 0x845E -#define GL_MAX_TEXTURE_LOD_BIAS 0x84FD -#define GL_TEXTURE_FILTER_CONTROL 0x8500 -#define GL_TEXTURE_LOD_BIAS 0x8501 -#define GL_INCR_WRAP 0x8507 -#define GL_DECR_WRAP 0x8508 -#define GL_TEXTURE_DEPTH_SIZE 0x884A -#define GL_DEPTH_TEXTURE_MODE 0x884B -#define GL_TEXTURE_COMPARE_MODE 0x884C -#define GL_TEXTURE_COMPARE_FUNC 0x884D -#define GL_COMPARE_R_TO_TEXTURE 0x884E -#endif - -#ifndef GL_VERSION_1_5 -#define GL_BUFFER_SIZE 0x8764 -#define GL_BUFFER_USAGE 0x8765 -#define GL_QUERY_COUNTER_BITS 0x8864 -#define GL_CURRENT_QUERY 0x8865 -#define GL_QUERY_RESULT 0x8866 -#define GL_QUERY_RESULT_AVAILABLE 0x8867 -#define GL_ARRAY_BUFFER 0x8892 -#define GL_ELEMENT_ARRAY_BUFFER 0x8893 -#define GL_ARRAY_BUFFER_BINDING 0x8894 -#define GL_ELEMENT_ARRAY_BUFFER_BINDING 0x8895 -#define GL_VERTEX_ARRAY_BUFFER_BINDING 0x8896 -#define GL_NORMAL_ARRAY_BUFFER_BINDING 0x8897 -#define GL_COLOR_ARRAY_BUFFER_BINDING 0x8898 -#define GL_INDEX_ARRAY_BUFFER_BINDING 0x8899 -#define GL_TEXTURE_COORD_ARRAY_BUFFER_BINDING 0x889A -#define GL_EDGE_FLAG_ARRAY_BUFFER_BINDING 0x889B -#define GL_SECONDARY_COLOR_ARRAY_BUFFER_BINDING 0x889C -#define GL_FOG_COORDINATE_ARRAY_BUFFER_BINDING 0x889D -#define GL_WEIGHT_ARRAY_BUFFER_BINDING 0x889E -#define GL_VERTEX_ATTRIB_ARRAY_BUFFER_BINDING 0x889F -#define GL_READ_ONLY 0x88B8 -#define GL_WRITE_ONLY 0x88B9 -#define GL_READ_WRITE 0x88BA -#define GL_BUFFER_ACCESS 0x88BB -#define GL_BUFFER_MAPPED 0x88BC -#define GL_BUFFER_MAP_POINTER 0x88BD -#define GL_STREAM_DRAW 0x88E0 -#define GL_STREAM_READ 0x88E1 -#define GL_STREAM_COPY 0x88E2 -#define GL_STATIC_DRAW 0x88E4 -#define GL_STATIC_READ 0x88E5 -#define GL_STATIC_COPY 0x88E6 -#define GL_DYNAMIC_DRAW 0x88E8 -#define GL_DYNAMIC_READ 0x88E9 -#define GL_DYNAMIC_COPY 0x88EA -#define GL_SAMPLES_PASSED 0x8914 -#define GL_FOG_COORD_SRC GL_FOG_COORDINATE_SOURCE -#define GL_FOG_COORD GL_FOG_COORDINATE -#define GL_CURRENT_FOG_COORD GL_CURRENT_FOG_COORDINATE -#define GL_FOG_COORD_ARRAY_TYPE GL_FOG_COORDINATE_ARRAY_TYPE -#define GL_FOG_COORD_ARRAY_STRIDE GL_FOG_COORDINATE_ARRAY_STRIDE -#define GL_FOG_COORD_ARRAY_POINTER GL_FOG_COORDINATE_ARRAY_POINTER -#define GL_FOG_COORD_ARRAY GL_FOG_COORDINATE_ARRAY -#define GL_FOG_COORD_ARRAY_BUFFER_BINDING GL_FOG_COORDINATE_ARRAY_BUFFER_BINDING -#define GL_SRC0_RGB GL_SOURCE0_RGB -#define GL_SRC1_RGB GL_SOURCE1_RGB -#define GL_SRC2_RGB GL_SOURCE2_RGB -#define GL_SRC0_ALPHA GL_SOURCE0_ALPHA -#define GL_SRC1_ALPHA GL_SOURCE1_ALPHA -#define GL_SRC2_ALPHA GL_SOURCE2_ALPHA -#endif - -#ifndef GL_VERSION_2_0 -#define GL_BLEND_EQUATION_RGB GL_BLEND_EQUATION -#define GL_VERTEX_ATTRIB_ARRAY_ENABLED 0x8622 -#define GL_VERTEX_ATTRIB_ARRAY_SIZE 0x8623 -#define GL_VERTEX_ATTRIB_ARRAY_STRIDE 0x8624 -#define GL_VERTEX_ATTRIB_ARRAY_TYPE 0x8625 -#define GL_CURRENT_VERTEX_ATTRIB 0x8626 -#define GL_VERTEX_PROGRAM_POINT_SIZE 0x8642 -#define GL_VERTEX_PROGRAM_TWO_SIDE 0x8643 -#define GL_VERTEX_ATTRIB_ARRAY_POINTER 0x8645 -#define GL_STENCIL_BACK_FUNC 0x8800 -#define GL_STENCIL_BACK_FAIL 0x8801 -#define GL_STENCIL_BACK_PASS_DEPTH_FAIL 0x8802 -#define GL_STENCIL_BACK_PASS_DEPTH_PASS 0x8803 -#define GL_MAX_DRAW_BUFFERS 0x8824 -#define GL_DRAW_BUFFER0 0x8825 -#define GL_DRAW_BUFFER1 0x8826 -#define GL_DRAW_BUFFER2 0x8827 -#define GL_DRAW_BUFFER3 0x8828 -#define GL_DRAW_BUFFER4 0x8829 -#define GL_DRAW_BUFFER5 0x882A -#define GL_DRAW_BUFFER6 0x882B -#define GL_DRAW_BUFFER7 0x882C -#define GL_DRAW_BUFFER8 0x882D -#define GL_DRAW_BUFFER9 0x882E -#define GL_DRAW_BUFFER10 0x882F -#define GL_DRAW_BUFFER11 0x8830 -#define GL_DRAW_BUFFER12 0x8831 -#define GL_DRAW_BUFFER13 0x8832 -#define GL_DRAW_BUFFER14 0x8833 -#define GL_DRAW_BUFFER15 0x8834 -#define GL_BLEND_EQUATION_ALPHA 0x883D -#define GL_POINT_SPRITE 0x8861 -#define GL_COORD_REPLACE 0x8862 -#define GL_MAX_VERTEX_ATTRIBS 0x8869 -#define GL_VERTEX_ATTRIB_ARRAY_NORMALIZED 0x886A -#define GL_MAX_TEXTURE_COORDS 0x8871 -#define GL_MAX_TEXTURE_IMAGE_UNITS 0x8872 -#define GL_FRAGMENT_SHADER 0x8B30 -#define GL_VERTEX_SHADER 0x8B31 -#define GL_MAX_FRAGMENT_UNIFORM_COMPONENTS 0x8B49 -#define GL_MAX_VERTEX_UNIFORM_COMPONENTS 0x8B4A -#define GL_MAX_VARYING_FLOATS 0x8B4B -#define GL_MAX_VERTEX_TEXTURE_IMAGE_UNITS 0x8B4C -#define GL_MAX_COMBINED_TEXTURE_IMAGE_UNITS 0x8B4D -#define GL_SHADER_TYPE 0x8B4F -#define GL_FLOAT_VEC2 0x8B50 -#define GL_FLOAT_VEC3 0x8B51 -#define GL_FLOAT_VEC4 0x8B52 -#define GL_INT_VEC2 0x8B53 -#define GL_INT_VEC3 0x8B54 -#define GL_INT_VEC4 0x8B55 -#define GL_BOOL 0x8B56 -#define GL_BOOL_VEC2 0x8B57 -#define GL_BOOL_VEC3 0x8B58 -#define GL_BOOL_VEC4 0x8B59 -#define GL_FLOAT_MAT2 0x8B5A -#define GL_FLOAT_MAT3 0x8B5B -#define GL_FLOAT_MAT4 0x8B5C -#define GL_SAMPLER_1D 0x8B5D -#define GL_SAMPLER_2D 0x8B5E -#define GL_SAMPLER_3D 0x8B5F -#define GL_SAMPLER_CUBE 0x8B60 -#define GL_SAMPLER_1D_SHADOW 0x8B61 -#define GL_SAMPLER_2D_SHADOW 0x8B62 -#define GL_DELETE_STATUS 0x8B80 -#define GL_COMPILE_STATUS 0x8B81 -#define GL_LINK_STATUS 0x8B82 -#define GL_VALIDATE_STATUS 0x8B83 -#define GL_INFO_LOG_LENGTH 0x8B84 -#define GL_ATTACHED_SHADERS 0x8B85 -#define GL_ACTIVE_UNIFORMS 0x8B86 -#define GL_ACTIVE_UNIFORM_MAX_LENGTH 0x8B87 -#define GL_SHADER_SOURCE_LENGTH 0x8B88 -#define GL_ACTIVE_ATTRIBUTES 0x8B89 -#define GL_ACTIVE_ATTRIBUTE_MAX_LENGTH 0x8B8A -#define GL_FRAGMENT_SHADER_DERIVATIVE_HINT 0x8B8B -#define GL_SHADING_LANGUAGE_VERSION 0x8B8C -#define GL_CURRENT_PROGRAM 0x8B8D -#define GL_POINT_SPRITE_COORD_ORIGIN 0x8CA0 -#define GL_LOWER_LEFT 0x8CA1 -#define GL_UPPER_LEFT 0x8CA2 -#define GL_STENCIL_BACK_REF 0x8CA3 -#define GL_STENCIL_BACK_VALUE_MASK 0x8CA4 -#define GL_STENCIL_BACK_WRITEMASK 0x8CA5 -#endif - -#ifndef GL_ARB_multitexture -#define GL_TEXTURE0_ARB 0x84C0 -#define GL_TEXTURE1_ARB 0x84C1 -#define GL_TEXTURE2_ARB 0x84C2 -#define GL_TEXTURE3_ARB 0x84C3 -#define GL_TEXTURE4_ARB 0x84C4 -#define GL_TEXTURE5_ARB 0x84C5 -#define GL_TEXTURE6_ARB 0x84C6 -#define GL_TEXTURE7_ARB 0x84C7 -#define GL_TEXTURE8_ARB 0x84C8 -#define GL_TEXTURE9_ARB 0x84C9 -#define GL_TEXTURE10_ARB 0x84CA -#define GL_TEXTURE11_ARB 0x84CB -#define GL_TEXTURE12_ARB 0x84CC -#define GL_TEXTURE13_ARB 0x84CD -#define GL_TEXTURE14_ARB 0x84CE -#define GL_TEXTURE15_ARB 0x84CF -#define GL_TEXTURE16_ARB 0x84D0 -#define GL_TEXTURE17_ARB 0x84D1 -#define GL_TEXTURE18_ARB 0x84D2 -#define GL_TEXTURE19_ARB 0x84D3 -#define GL_TEXTURE20_ARB 0x84D4 -#define GL_TEXTURE21_ARB 0x84D5 -#define GL_TEXTURE22_ARB 0x84D6 -#define GL_TEXTURE23_ARB 0x84D7 -#define GL_TEXTURE24_ARB 0x84D8 -#define GL_TEXTURE25_ARB 0x84D9 -#define GL_TEXTURE26_ARB 0x84DA -#define GL_TEXTURE27_ARB 0x84DB -#define GL_TEXTURE28_ARB 0x84DC -#define GL_TEXTURE29_ARB 0x84DD -#define GL_TEXTURE30_ARB 0x84DE -#define GL_TEXTURE31_ARB 0x84DF -#define GL_ACTIVE_TEXTURE_ARB 0x84E0 -#define GL_CLIENT_ACTIVE_TEXTURE_ARB 0x84E1 -#define GL_MAX_TEXTURE_UNITS_ARB 0x84E2 -#endif - -#ifndef GL_ARB_transpose_matrix -#define GL_TRANSPOSE_MODELVIEW_MATRIX_ARB 0x84E3 -#define GL_TRANSPOSE_PROJECTION_MATRIX_ARB 0x84E4 -#define GL_TRANSPOSE_TEXTURE_MATRIX_ARB 0x84E5 -#define GL_TRANSPOSE_COLOR_MATRIX_ARB 0x84E6 -#endif - -#ifndef GL_ARB_multisample -#define GL_MULTISAMPLE_ARB 0x809D -#define GL_SAMPLE_ALPHA_TO_COVERAGE_ARB 0x809E -#define GL_SAMPLE_ALPHA_TO_ONE_ARB 0x809F -#define GL_SAMPLE_COVERAGE_ARB 0x80A0 -#define GL_SAMPLE_BUFFERS_ARB 0x80A8 -#define GL_SAMPLES_ARB 0x80A9 -#define GL_SAMPLE_COVERAGE_VALUE_ARB 0x80AA -#define GL_SAMPLE_COVERAGE_INVERT_ARB 0x80AB -#define GL_MULTISAMPLE_BIT_ARB 0x20000000 -#endif - -#ifndef GL_ARB_texture_env_add -#endif - -#ifndef GL_ARB_texture_cube_map -#define GL_NORMAL_MAP_ARB 0x8511 -#define GL_REFLECTION_MAP_ARB 0x8512 -#define GL_TEXTURE_CUBE_MAP_ARB 0x8513 -#define GL_TEXTURE_BINDING_CUBE_MAP_ARB 0x8514 -#define GL_TEXTURE_CUBE_MAP_POSITIVE_X_ARB 0x8515 -#define GL_TEXTURE_CUBE_MAP_NEGATIVE_X_ARB 0x8516 -#define GL_TEXTURE_CUBE_MAP_POSITIVE_Y_ARB 0x8517 -#define GL_TEXTURE_CUBE_MAP_NEGATIVE_Y_ARB 0x8518 -#define GL_TEXTURE_CUBE_MAP_POSITIVE_Z_ARB 0x8519 -#define GL_TEXTURE_CUBE_MAP_NEGATIVE_Z_ARB 0x851A -#define GL_PROXY_TEXTURE_CUBE_MAP_ARB 0x851B -#define GL_MAX_CUBE_MAP_TEXTURE_SIZE_ARB 0x851C -#endif - -#ifndef GL_ARB_texture_compression -#define GL_COMPRESSED_ALPHA_ARB 0x84E9 -#define GL_COMPRESSED_LUMINANCE_ARB 0x84EA -#define GL_COMPRESSED_LUMINANCE_ALPHA_ARB 0x84EB -#define GL_COMPRESSED_INTENSITY_ARB 0x84EC -#define GL_COMPRESSED_RGB_ARB 0x84ED -#define GL_COMPRESSED_RGBA_ARB 0x84EE -#define GL_TEXTURE_COMPRESSION_HINT_ARB 0x84EF -#define GL_TEXTURE_COMPRESSED_IMAGE_SIZE_ARB 0x86A0 -#define GL_TEXTURE_COMPRESSED_ARB 0x86A1 -#define GL_NUM_COMPRESSED_TEXTURE_FORMATS_ARB 0x86A2 -#define GL_COMPRESSED_TEXTURE_FORMATS_ARB 0x86A3 -#endif - -#ifndef GL_ARB_texture_border_clamp -#define GL_CLAMP_TO_BORDER_ARB 0x812D -#endif - -#ifndef GL_ARB_point_parameters -#define GL_POINT_SIZE_MIN_ARB 0x8126 -#define GL_POINT_SIZE_MAX_ARB 0x8127 -#define GL_POINT_FADE_THRESHOLD_SIZE_ARB 0x8128 -#define GL_POINT_DISTANCE_ATTENUATION_ARB 0x8129 -#endif - -#ifndef GL_ARB_vertex_blend -#define GL_MAX_VERTEX_UNITS_ARB 0x86A4 -#define GL_ACTIVE_VERTEX_UNITS_ARB 0x86A5 -#define GL_WEIGHT_SUM_UNITY_ARB 0x86A6 -#define GL_VERTEX_BLEND_ARB 0x86A7 -#define GL_CURRENT_WEIGHT_ARB 0x86A8 -#define GL_WEIGHT_ARRAY_TYPE_ARB 0x86A9 -#define GL_WEIGHT_ARRAY_STRIDE_ARB 0x86AA -#define GL_WEIGHT_ARRAY_SIZE_ARB 0x86AB -#define GL_WEIGHT_ARRAY_POINTER_ARB 0x86AC -#define GL_WEIGHT_ARRAY_ARB 0x86AD -#define GL_MODELVIEW0_ARB 0x1700 -#define GL_MODELVIEW1_ARB 0x850A -#define GL_MODELVIEW2_ARB 0x8722 -#define GL_MODELVIEW3_ARB 0x8723 -#define GL_MODELVIEW4_ARB 0x8724 -#define GL_MODELVIEW5_ARB 0x8725 -#define GL_MODELVIEW6_ARB 0x8726 -#define GL_MODELVIEW7_ARB 0x8727 -#define GL_MODELVIEW8_ARB 0x8728 -#define GL_MODELVIEW9_ARB 0x8729 -#define GL_MODELVIEW10_ARB 0x872A -#define GL_MODELVIEW11_ARB 0x872B -#define GL_MODELVIEW12_ARB 0x872C -#define GL_MODELVIEW13_ARB 0x872D -#define GL_MODELVIEW14_ARB 0x872E -#define GL_MODELVIEW15_ARB 0x872F -#define GL_MODELVIEW16_ARB 0x8730 -#define GL_MODELVIEW17_ARB 0x8731 -#define GL_MODELVIEW18_ARB 0x8732 -#define GL_MODELVIEW19_ARB 0x8733 -#define GL_MODELVIEW20_ARB 0x8734 -#define GL_MODELVIEW21_ARB 0x8735 -#define GL_MODELVIEW22_ARB 0x8736 -#define GL_MODELVIEW23_ARB 0x8737 -#define GL_MODELVIEW24_ARB 0x8738 -#define GL_MODELVIEW25_ARB 0x8739 -#define GL_MODELVIEW26_ARB 0x873A -#define GL_MODELVIEW27_ARB 0x873B -#define GL_MODELVIEW28_ARB 0x873C -#define GL_MODELVIEW29_ARB 0x873D -#define GL_MODELVIEW30_ARB 0x873E -#define GL_MODELVIEW31_ARB 0x873F -#endif - -#ifndef GL_ARB_matrix_palette -#define GL_MATRIX_PALETTE_ARB 0x8840 -#define GL_MAX_MATRIX_PALETTE_STACK_DEPTH_ARB 0x8841 -#define GL_MAX_PALETTE_MATRICES_ARB 0x8842 -#define GL_CURRENT_PALETTE_MATRIX_ARB 0x8843 -#define GL_MATRIX_INDEX_ARRAY_ARB 0x8844 -#define GL_CURRENT_MATRIX_INDEX_ARB 0x8845 -#define GL_MATRIX_INDEX_ARRAY_SIZE_ARB 0x8846 -#define GL_MATRIX_INDEX_ARRAY_TYPE_ARB 0x8847 -#define GL_MATRIX_INDEX_ARRAY_STRIDE_ARB 0x8848 -#define GL_MATRIX_INDEX_ARRAY_POINTER_ARB 0x8849 -#endif - -#ifndef GL_ARB_texture_env_combine -#define GL_COMBINE_ARB 0x8570 -#define GL_COMBINE_RGB_ARB 0x8571 -#define GL_COMBINE_ALPHA_ARB 0x8572 -#define GL_SOURCE0_RGB_ARB 0x8580 -#define GL_SOURCE1_RGB_ARB 0x8581 -#define GL_SOURCE2_RGB_ARB 0x8582 -#define GL_SOURCE0_ALPHA_ARB 0x8588 -#define GL_SOURCE1_ALPHA_ARB 0x8589 -#define GL_SOURCE2_ALPHA_ARB 0x858A -#define GL_OPERAND0_RGB_ARB 0x8590 -#define GL_OPERAND1_RGB_ARB 0x8591 -#define GL_OPERAND2_RGB_ARB 0x8592 -#define GL_OPERAND0_ALPHA_ARB 0x8598 -#define GL_OPERAND1_ALPHA_ARB 0x8599 -#define GL_OPERAND2_ALPHA_ARB 0x859A -#define GL_RGB_SCALE_ARB 0x8573 -#define GL_ADD_SIGNED_ARB 0x8574 -#define GL_INTERPOLATE_ARB 0x8575 -#define GL_SUBTRACT_ARB 0x84E7 -#define GL_CONSTANT_ARB 0x8576 -#define GL_PRIMARY_COLOR_ARB 0x8577 -#define GL_PREVIOUS_ARB 0x8578 -#endif - -#ifndef GL_ARB_texture_env_crossbar -#endif - -#ifndef GL_ARB_texture_env_dot3 -#define GL_DOT3_RGB_ARB 0x86AE -#define GL_DOT3_RGBA_ARB 0x86AF -#endif - -#ifndef GL_ARB_texture_mirrored_repeat -#define GL_MIRRORED_REPEAT_ARB 0x8370 -#endif - -#ifndef GL_ARB_depth_texture -#define GL_DEPTH_COMPONENT16_ARB 0x81A5 -#define GL_DEPTH_COMPONENT24_ARB 0x81A6 -#define GL_DEPTH_COMPONENT32_ARB 0x81A7 -#define GL_TEXTURE_DEPTH_SIZE_ARB 0x884A -#define GL_DEPTH_TEXTURE_MODE_ARB 0x884B -#endif - -#ifndef GL_ARB_shadow -#define GL_TEXTURE_COMPARE_MODE_ARB 0x884C -#define GL_TEXTURE_COMPARE_FUNC_ARB 0x884D -#define GL_COMPARE_R_TO_TEXTURE_ARB 0x884E -#endif - -#ifndef GL_ARB_shadow_ambient -#define GL_TEXTURE_COMPARE_FAIL_VALUE_ARB 0x80BF -#endif - -#ifndef GL_ARB_window_pos -#endif - -#ifndef GL_ARB_vertex_program -#define GL_COLOR_SUM_ARB 0x8458 -#define GL_VERTEX_PROGRAM_ARB 0x8620 -#define GL_VERTEX_ATTRIB_ARRAY_ENABLED_ARB 0x8622 -#define GL_VERTEX_ATTRIB_ARRAY_SIZE_ARB 0x8623 -#define GL_VERTEX_ATTRIB_ARRAY_STRIDE_ARB 0x8624 -#define GL_VERTEX_ATTRIB_ARRAY_TYPE_ARB 0x8625 -#define GL_CURRENT_VERTEX_ATTRIB_ARB 0x8626 -#define GL_PROGRAM_LENGTH_ARB 0x8627 -#define GL_PROGRAM_STRING_ARB 0x8628 -#define GL_MAX_PROGRAM_MATRIX_STACK_DEPTH_ARB 0x862E -#define GL_MAX_PROGRAM_MATRICES_ARB 0x862F -#define GL_CURRENT_MATRIX_STACK_DEPTH_ARB 0x8640 -#define GL_CURRENT_MATRIX_ARB 0x8641 -#define GL_VERTEX_PROGRAM_POINT_SIZE_ARB 0x8642 -#define GL_VERTEX_PROGRAM_TWO_SIDE_ARB 0x8643 -#define GL_VERTEX_ATTRIB_ARRAY_POINTER_ARB 0x8645 -#define GL_PROGRAM_ERROR_POSITION_ARB 0x864B -#define GL_PROGRAM_BINDING_ARB 0x8677 -#define GL_MAX_VERTEX_ATTRIBS_ARB 0x8869 -#define GL_VERTEX_ATTRIB_ARRAY_NORMALIZED_ARB 0x886A -#define GL_PROGRAM_ERROR_STRING_ARB 0x8874 -#define GL_PROGRAM_FORMAT_ASCII_ARB 0x8875 -#define GL_PROGRAM_FORMAT_ARB 0x8876 -#define GL_PROGRAM_INSTRUCTIONS_ARB 0x88A0 -#define GL_MAX_PROGRAM_INSTRUCTIONS_ARB 0x88A1 -#define GL_PROGRAM_NATIVE_INSTRUCTIONS_ARB 0x88A2 -#define GL_MAX_PROGRAM_NATIVE_INSTRUCTIONS_ARB 0x88A3 -#define GL_PROGRAM_TEMPORARIES_ARB 0x88A4 -#define GL_MAX_PROGRAM_TEMPORARIES_ARB 0x88A5 -#define GL_PROGRAM_NATIVE_TEMPORARIES_ARB 0x88A6 -#define GL_MAX_PROGRAM_NATIVE_TEMPORARIES_ARB 0x88A7 -#define GL_PROGRAM_PARAMETERS_ARB 0x88A8 -#define GL_MAX_PROGRAM_PARAMETERS_ARB 0x88A9 -#define GL_PROGRAM_NATIVE_PARAMETERS_ARB 0x88AA -#define GL_MAX_PROGRAM_NATIVE_PARAMETERS_ARB 0x88AB -#define GL_PROGRAM_ATTRIBS_ARB 0x88AC -#define GL_MAX_PROGRAM_ATTRIBS_ARB 0x88AD -#define GL_PROGRAM_NATIVE_ATTRIBS_ARB 0x88AE -#define GL_MAX_PROGRAM_NATIVE_ATTRIBS_ARB 0x88AF -#define GL_PROGRAM_ADDRESS_REGISTERS_ARB 0x88B0 -#define GL_MAX_PROGRAM_ADDRESS_REGISTERS_ARB 0x88B1 -#define GL_PROGRAM_NATIVE_ADDRESS_REGISTERS_ARB 0x88B2 -#define GL_MAX_PROGRAM_NATIVE_ADDRESS_REGISTERS_ARB 0x88B3 -#define GL_MAX_PROGRAM_LOCAL_PARAMETERS_ARB 0x88B4 -#define GL_MAX_PROGRAM_ENV_PARAMETERS_ARB 0x88B5 -#define GL_PROGRAM_UNDER_NATIVE_LIMITS_ARB 0x88B6 -#define GL_TRANSPOSE_CURRENT_MATRIX_ARB 0x88B7 -#define GL_MATRIX0_ARB 0x88C0 -#define GL_MATRIX1_ARB 0x88C1 -#define GL_MATRIX2_ARB 0x88C2 -#define GL_MATRIX3_ARB 0x88C3 -#define GL_MATRIX4_ARB 0x88C4 -#define GL_MATRIX5_ARB 0x88C5 -#define GL_MATRIX6_ARB 0x88C6 -#define GL_MATRIX7_ARB 0x88C7 -#define GL_MATRIX8_ARB 0x88C8 -#define GL_MATRIX9_ARB 0x88C9 -#define GL_MATRIX10_ARB 0x88CA -#define GL_MATRIX11_ARB 0x88CB -#define GL_MATRIX12_ARB 0x88CC -#define GL_MATRIX13_ARB 0x88CD -#define GL_MATRIX14_ARB 0x88CE -#define GL_MATRIX15_ARB 0x88CF -#define GL_MATRIX16_ARB 0x88D0 -#define GL_MATRIX17_ARB 0x88D1 -#define GL_MATRIX18_ARB 0x88D2 -#define GL_MATRIX19_ARB 0x88D3 -#define GL_MATRIX20_ARB 0x88D4 -#define GL_MATRIX21_ARB 0x88D5 -#define GL_MATRIX22_ARB 0x88D6 -#define GL_MATRIX23_ARB 0x88D7 -#define GL_MATRIX24_ARB 0x88D8 -#define GL_MATRIX25_ARB 0x88D9 -#define GL_MATRIX26_ARB 0x88DA -#define GL_MATRIX27_ARB 0x88DB -#define GL_MATRIX28_ARB 0x88DC -#define GL_MATRIX29_ARB 0x88DD -#define GL_MATRIX30_ARB 0x88DE -#define GL_MATRIX31_ARB 0x88DF -#endif - -#ifndef GL_ARB_fragment_program -#define GL_FRAGMENT_PROGRAM_ARB 0x8804 -#define GL_PROGRAM_ALU_INSTRUCTIONS_ARB 0x8805 -#define GL_PROGRAM_TEX_INSTRUCTIONS_ARB 0x8806 -#define GL_PROGRAM_TEX_INDIRECTIONS_ARB 0x8807 -#define GL_PROGRAM_NATIVE_ALU_INSTRUCTIONS_ARB 0x8808 -#define GL_PROGRAM_NATIVE_TEX_INSTRUCTIONS_ARB 0x8809 -#define GL_PROGRAM_NATIVE_TEX_INDIRECTIONS_ARB 0x880A -#define GL_MAX_PROGRAM_ALU_INSTRUCTIONS_ARB 0x880B -#define GL_MAX_PROGRAM_TEX_INSTRUCTIONS_ARB 0x880C -#define GL_MAX_PROGRAM_TEX_INDIRECTIONS_ARB 0x880D -#define GL_MAX_PROGRAM_NATIVE_ALU_INSTRUCTIONS_ARB 0x880E -#define GL_MAX_PROGRAM_NATIVE_TEX_INSTRUCTIONS_ARB 0x880F -#define GL_MAX_PROGRAM_NATIVE_TEX_INDIRECTIONS_ARB 0x8810 -#define GL_MAX_TEXTURE_COORDS_ARB 0x8871 -#define GL_MAX_TEXTURE_IMAGE_UNITS_ARB 0x8872 -#endif - -#ifndef GL_ARB_vertex_buffer_object -#define GL_BUFFER_SIZE_ARB 0x8764 -#define GL_BUFFER_USAGE_ARB 0x8765 -#define GL_ARRAY_BUFFER_ARB 0x8892 -#define GL_ELEMENT_ARRAY_BUFFER_ARB 0x8893 -#define GL_ARRAY_BUFFER_BINDING_ARB 0x8894 -#define GL_ELEMENT_ARRAY_BUFFER_BINDING_ARB 0x8895 -#define GL_VERTEX_ARRAY_BUFFER_BINDING_ARB 0x8896 -#define GL_NORMAL_ARRAY_BUFFER_BINDING_ARB 0x8897 -#define GL_COLOR_ARRAY_BUFFER_BINDING_ARB 0x8898 -#define GL_INDEX_ARRAY_BUFFER_BINDING_ARB 0x8899 -#define GL_TEXTURE_COORD_ARRAY_BUFFER_BINDING_ARB 0x889A -#define GL_EDGE_FLAG_ARRAY_BUFFER_BINDING_ARB 0x889B -#define GL_SECONDARY_COLOR_ARRAY_BUFFER_BINDING_ARB 0x889C -#define GL_FOG_COORDINATE_ARRAY_BUFFER_BINDING_ARB 0x889D -#define GL_WEIGHT_ARRAY_BUFFER_BINDING_ARB 0x889E -#define GL_VERTEX_ATTRIB_ARRAY_BUFFER_BINDING_ARB 0x889F -#define GL_READ_ONLY_ARB 0x88B8 -#define GL_WRITE_ONLY_ARB 0x88B9 -#define GL_READ_WRITE_ARB 0x88BA -#define GL_BUFFER_ACCESS_ARB 0x88BB -#define GL_BUFFER_MAPPED_ARB 0x88BC -#define GL_BUFFER_MAP_POINTER_ARB 0x88BD -#define GL_STREAM_DRAW_ARB 0x88E0 -#define GL_STREAM_READ_ARB 0x88E1 -#define GL_STREAM_COPY_ARB 0x88E2 -#define GL_STATIC_DRAW_ARB 0x88E4 -#define GL_STATIC_READ_ARB 0x88E5 -#define GL_STATIC_COPY_ARB 0x88E6 -#define GL_DYNAMIC_DRAW_ARB 0x88E8 -#define GL_DYNAMIC_READ_ARB 0x88E9 -#define GL_DYNAMIC_COPY_ARB 0x88EA -#endif - -#ifndef GL_ARB_occlusion_query -#define GL_QUERY_COUNTER_BITS_ARB 0x8864 -#define GL_CURRENT_QUERY_ARB 0x8865 -#define GL_QUERY_RESULT_ARB 0x8866 -#define GL_QUERY_RESULT_AVAILABLE_ARB 0x8867 -#define GL_SAMPLES_PASSED_ARB 0x8914 -#endif - -#ifndef GL_ARB_shader_objects -#define GL_PROGRAM_OBJECT_ARB 0x8B40 -#define GL_SHADER_OBJECT_ARB 0x8B48 -#define GL_OBJECT_TYPE_ARB 0x8B4E -#define GL_OBJECT_SUBTYPE_ARB 0x8B4F -#define GL_FLOAT_VEC2_ARB 0x8B50 -#define GL_FLOAT_VEC3_ARB 0x8B51 -#define GL_FLOAT_VEC4_ARB 0x8B52 -#define GL_INT_VEC2_ARB 0x8B53 -#define GL_INT_VEC3_ARB 0x8B54 -#define GL_INT_VEC4_ARB 0x8B55 -#define GL_BOOL_ARB 0x8B56 -#define GL_BOOL_VEC2_ARB 0x8B57 -#define GL_BOOL_VEC3_ARB 0x8B58 -#define GL_BOOL_VEC4_ARB 0x8B59 -#define GL_FLOAT_MAT2_ARB 0x8B5A -#define GL_FLOAT_MAT3_ARB 0x8B5B -#define GL_FLOAT_MAT4_ARB 0x8B5C -#define GL_SAMPLER_1D_ARB 0x8B5D -#define GL_SAMPLER_2D_ARB 0x8B5E -#define GL_SAMPLER_3D_ARB 0x8B5F -#define GL_SAMPLER_CUBE_ARB 0x8B60 -#define GL_SAMPLER_1D_SHADOW_ARB 0x8B61 -#define GL_SAMPLER_2D_SHADOW_ARB 0x8B62 -#define GL_SAMPLER_2D_RECT_ARB 0x8B63 -#define GL_SAMPLER_2D_RECT_SHADOW_ARB 0x8B64 -#define GL_OBJECT_DELETE_STATUS_ARB 0x8B80 -#define GL_OBJECT_COMPILE_STATUS_ARB 0x8B81 -#define GL_OBJECT_LINK_STATUS_ARB 0x8B82 -#define GL_OBJECT_VALIDATE_STATUS_ARB 0x8B83 -#define GL_OBJECT_INFO_LOG_LENGTH_ARB 0x8B84 -#define GL_OBJECT_ATTACHED_OBJECTS_ARB 0x8B85 -#define GL_OBJECT_ACTIVE_UNIFORMS_ARB 0x8B86 -#define GL_OBJECT_ACTIVE_UNIFORM_MAX_LENGTH_ARB 0x8B87 -#define GL_OBJECT_SHADER_SOURCE_LENGTH_ARB 0x8B88 -#endif - -#ifndef GL_ARB_vertex_shader -#define GL_VERTEX_SHADER_ARB 0x8B31 -#define GL_MAX_VERTEX_UNIFORM_COMPONENTS_ARB 0x8B4A -#define GL_MAX_VARYING_FLOATS_ARB 0x8B4B -#define GL_MAX_VERTEX_TEXTURE_IMAGE_UNITS_ARB 0x8B4C -#define GL_MAX_COMBINED_TEXTURE_IMAGE_UNITS_ARB 0x8B4D -#define GL_OBJECT_ACTIVE_ATTRIBUTES_ARB 0x8B89 -#define GL_OBJECT_ACTIVE_ATTRIBUTE_MAX_LENGTH_ARB 0x8B8A -#endif - -#ifndef GL_ARB_fragment_shader -#define GL_FRAGMENT_SHADER_ARB 0x8B30 -#define GL_MAX_FRAGMENT_UNIFORM_COMPONENTS_ARB 0x8B49 -#define GL_FRAGMENT_SHADER_DERIVATIVE_HINT_ARB 0x8B8B -#endif - -#ifndef GL_ARB_shading_language_100 -#define GL_SHADING_LANGUAGE_VERSION_ARB 0x8B8C -#endif - -#ifndef GL_ARB_texture_non_power_of_two -#endif - -#ifndef GL_ARB_point_sprite -#define GL_POINT_SPRITE_ARB 0x8861 -#define GL_COORD_REPLACE_ARB 0x8862 -#endif - -#ifndef GL_ARB_fragment_program_shadow -#endif - -#ifndef GL_ARB_draw_buffers -#define GL_MAX_DRAW_BUFFERS_ARB 0x8824 -#define GL_DRAW_BUFFER0_ARB 0x8825 -#define GL_DRAW_BUFFER1_ARB 0x8826 -#define GL_DRAW_BUFFER2_ARB 0x8827 -#define GL_DRAW_BUFFER3_ARB 0x8828 -#define GL_DRAW_BUFFER4_ARB 0x8829 -#define GL_DRAW_BUFFER5_ARB 0x882A -#define GL_DRAW_BUFFER6_ARB 0x882B -#define GL_DRAW_BUFFER7_ARB 0x882C -#define GL_DRAW_BUFFER8_ARB 0x882D -#define GL_DRAW_BUFFER9_ARB 0x882E -#define GL_DRAW_BUFFER10_ARB 0x882F -#define GL_DRAW_BUFFER11_ARB 0x8830 -#define GL_DRAW_BUFFER12_ARB 0x8831 -#define GL_DRAW_BUFFER13_ARB 0x8832 -#define GL_DRAW_BUFFER14_ARB 0x8833 -#define GL_DRAW_BUFFER15_ARB 0x8834 -#endif - -#ifndef GL_ARB_texture_rectangle -#define GL_TEXTURE_RECTANGLE_ARB 0x84F5 -#define GL_TEXTURE_BINDING_RECTANGLE_ARB 0x84F6 -#define GL_PROXY_TEXTURE_RECTANGLE_ARB 0x84F7 -#define GL_MAX_RECTANGLE_TEXTURE_SIZE_ARB 0x84F8 -#endif - -#ifndef GL_ARB_color_buffer_float -#define GL_RGBA_FLOAT_MODE_ARB 0x8820 -#define GL_CLAMP_VERTEX_COLOR_ARB 0x891A -#define GL_CLAMP_FRAGMENT_COLOR_ARB 0x891B -#define GL_CLAMP_READ_COLOR_ARB 0x891C -#define GL_FIXED_ONLY_ARB 0x891D -#endif - -#ifndef GL_ARB_half_float_pixel -#define GL_HALF_FLOAT_ARB 0x140B -#endif - -#ifndef GL_ARB_texture_float -#define GL_TEXTURE_RED_TYPE_ARB 0x8C10 -#define GL_TEXTURE_GREEN_TYPE_ARB 0x8C11 -#define GL_TEXTURE_BLUE_TYPE_ARB 0x8C12 -#define GL_TEXTURE_ALPHA_TYPE_ARB 0x8C13 -#define GL_TEXTURE_LUMINANCE_TYPE_ARB 0x8C14 -#define GL_TEXTURE_INTENSITY_TYPE_ARB 0x8C15 -#define GL_TEXTURE_DEPTH_TYPE_ARB 0x8C16 -#define GL_UNSIGNED_NORMALIZED_ARB 0x8C17 -#define GL_RGBA32F_ARB 0x8814 -#define GL_RGB32F_ARB 0x8815 -#define GL_ALPHA32F_ARB 0x8816 -#define GL_INTENSITY32F_ARB 0x8817 -#define GL_LUMINANCE32F_ARB 0x8818 -#define GL_LUMINANCE_ALPHA32F_ARB 0x8819 -#define GL_RGBA16F_ARB 0x881A -#define GL_RGB16F_ARB 0x881B -#define GL_ALPHA16F_ARB 0x881C -#define GL_INTENSITY16F_ARB 0x881D -#define GL_LUMINANCE16F_ARB 0x881E -#define GL_LUMINANCE_ALPHA16F_ARB 0x881F -#endif - -#ifndef GL_ARB_pixel_buffer_object -#define GL_PIXEL_PACK_BUFFER_ARB 0x88EB -#define GL_PIXEL_UNPACK_BUFFER_ARB 0x88EC -#define GL_PIXEL_PACK_BUFFER_BINDING_ARB 0x88ED -#define GL_PIXEL_UNPACK_BUFFER_BINDING_ARB 0x88EF -#endif - -#ifndef GL_EXT_abgr -#define GL_ABGR_EXT 0x8000 -#endif - -#ifndef GL_EXT_blend_color -#define GL_CONSTANT_COLOR_EXT 0x8001 -#define GL_ONE_MINUS_CONSTANT_COLOR_EXT 0x8002 -#define GL_CONSTANT_ALPHA_EXT 0x8003 -#define GL_ONE_MINUS_CONSTANT_ALPHA_EXT 0x8004 -#define GL_BLEND_COLOR_EXT 0x8005 -#endif - -#ifndef GL_EXT_polygon_offset -#define GL_POLYGON_OFFSET_EXT 0x8037 -#define GL_POLYGON_OFFSET_FACTOR_EXT 0x8038 -#define GL_POLYGON_OFFSET_BIAS_EXT 0x8039 -#endif - -#ifndef GL_EXT_texture -#define GL_ALPHA4_EXT 0x803B -#define GL_ALPHA8_EXT 0x803C -#define GL_ALPHA12_EXT 0x803D -#define GL_ALPHA16_EXT 0x803E -#define GL_LUMINANCE4_EXT 0x803F -#define GL_LUMINANCE8_EXT 0x8040 -#define GL_LUMINANCE12_EXT 0x8041 -#define GL_LUMINANCE16_EXT 0x8042 -#define GL_LUMINANCE4_ALPHA4_EXT 0x8043 -#define GL_LUMINANCE6_ALPHA2_EXT 0x8044 -#define GL_LUMINANCE8_ALPHA8_EXT 0x8045 -#define GL_LUMINANCE12_ALPHA4_EXT 0x8046 -#define GL_LUMINANCE12_ALPHA12_EXT 0x8047 -#define GL_LUMINANCE16_ALPHA16_EXT 0x8048 -#define GL_INTENSITY_EXT 0x8049 -#define GL_INTENSITY4_EXT 0x804A -#define GL_INTENSITY8_EXT 0x804B -#define GL_INTENSITY12_EXT 0x804C -#define GL_INTENSITY16_EXT 0x804D -#define GL_RGB2_EXT 0x804E -#define GL_RGB4_EXT 0x804F -#define GL_RGB5_EXT 0x8050 -#define GL_RGB8_EXT 0x8051 -#define GL_RGB10_EXT 0x8052 -#define GL_RGB12_EXT 0x8053 -#define GL_RGB16_EXT 0x8054 -#define GL_RGBA2_EXT 0x8055 -#define GL_RGBA4_EXT 0x8056 -#define GL_RGB5_A1_EXT 0x8057 -#define GL_RGBA8_EXT 0x8058 -#define GL_RGB10_A2_EXT 0x8059 -#define GL_RGBA12_EXT 0x805A -#define GL_RGBA16_EXT 0x805B -#define GL_TEXTURE_RED_SIZE_EXT 0x805C -#define GL_TEXTURE_GREEN_SIZE_EXT 0x805D -#define GL_TEXTURE_BLUE_SIZE_EXT 0x805E -#define GL_TEXTURE_ALPHA_SIZE_EXT 0x805F -#define GL_TEXTURE_LUMINANCE_SIZE_EXT 0x8060 -#define GL_TEXTURE_INTENSITY_SIZE_EXT 0x8061 -#define GL_REPLACE_EXT 0x8062 -#define GL_PROXY_TEXTURE_1D_EXT 0x8063 -#define GL_PROXY_TEXTURE_2D_EXT 0x8064 -#define GL_TEXTURE_TOO_LARGE_EXT 0x8065 -#endif - -#ifndef GL_EXT_texture3D -#define GL_PACK_SKIP_IMAGES_EXT 0x806B -#define GL_PACK_IMAGE_HEIGHT_EXT 0x806C -#define GL_UNPACK_SKIP_IMAGES_EXT 0x806D -#define GL_UNPACK_IMAGE_HEIGHT_EXT 0x806E -#define GL_TEXTURE_3D_EXT 0x806F -#define GL_PROXY_TEXTURE_3D_EXT 0x8070 -#define GL_TEXTURE_DEPTH_EXT 0x8071 -#define GL_TEXTURE_WRAP_R_EXT 0x8072 -#define GL_MAX_3D_TEXTURE_SIZE_EXT 0x8073 -#endif - -#ifndef GL_SGIS_texture_filter4 -#define GL_FILTER4_SGIS 0x8146 -#define GL_TEXTURE_FILTER4_SIZE_SGIS 0x8147 -#endif - -#ifndef GL_EXT_subtexture -#endif - -#ifndef GL_EXT_copy_texture -#endif - -#ifndef GL_EXT_histogram -#define GL_HISTOGRAM_EXT 0x8024 -#define GL_PROXY_HISTOGRAM_EXT 0x8025 -#define GL_HISTOGRAM_WIDTH_EXT 0x8026 -#define GL_HISTOGRAM_FORMAT_EXT 0x8027 -#define GL_HISTOGRAM_RED_SIZE_EXT 0x8028 -#define GL_HISTOGRAM_GREEN_SIZE_EXT 0x8029 -#define GL_HISTOGRAM_BLUE_SIZE_EXT 0x802A -#define GL_HISTOGRAM_ALPHA_SIZE_EXT 0x802B -#define GL_HISTOGRAM_LUMINANCE_SIZE_EXT 0x802C -#define GL_HISTOGRAM_SINK_EXT 0x802D -#define GL_MINMAX_EXT 0x802E -#define GL_MINMAX_FORMAT_EXT 0x802F -#define GL_MINMAX_SINK_EXT 0x8030 -#define GL_TABLE_TOO_LARGE_EXT 0x8031 -#endif - -#ifndef GL_EXT_convolution -#define GL_CONVOLUTION_1D_EXT 0x8010 -#define GL_CONVOLUTION_2D_EXT 0x8011 -#define GL_SEPARABLE_2D_EXT 0x8012 -#define GL_CONVOLUTION_BORDER_MODE_EXT 0x8013 -#define GL_CONVOLUTION_FILTER_SCALE_EXT 0x8014 -#define GL_CONVOLUTION_FILTER_BIAS_EXT 0x8015 -#define GL_REDUCE_EXT 0x8016 -#define GL_CONVOLUTION_FORMAT_EXT 0x8017 -#define GL_CONVOLUTION_WIDTH_EXT 0x8018 -#define GL_CONVOLUTION_HEIGHT_EXT 0x8019 -#define GL_MAX_CONVOLUTION_WIDTH_EXT 0x801A -#define GL_MAX_CONVOLUTION_HEIGHT_EXT 0x801B -#define GL_POST_CONVOLUTION_RED_SCALE_EXT 0x801C -#define GL_POST_CONVOLUTION_GREEN_SCALE_EXT 0x801D -#define GL_POST_CONVOLUTION_BLUE_SCALE_EXT 0x801E -#define GL_POST_CONVOLUTION_ALPHA_SCALE_EXT 0x801F -#define GL_POST_CONVOLUTION_RED_BIAS_EXT 0x8020 -#define GL_POST_CONVOLUTION_GREEN_BIAS_EXT 0x8021 -#define GL_POST_CONVOLUTION_BLUE_BIAS_EXT 0x8022 -#define GL_POST_CONVOLUTION_ALPHA_BIAS_EXT 0x8023 -#endif - -#ifndef GL_SGI_color_matrix -#define GL_COLOR_MATRIX_SGI 0x80B1 -#define GL_COLOR_MATRIX_STACK_DEPTH_SGI 0x80B2 -#define GL_MAX_COLOR_MATRIX_STACK_DEPTH_SGI 0x80B3 -#define GL_POST_COLOR_MATRIX_RED_SCALE_SGI 0x80B4 -#define GL_POST_COLOR_MATRIX_GREEN_SCALE_SGI 0x80B5 -#define GL_POST_COLOR_MATRIX_BLUE_SCALE_SGI 0x80B6 -#define GL_POST_COLOR_MATRIX_ALPHA_SCALE_SGI 0x80B7 -#define GL_POST_COLOR_MATRIX_RED_BIAS_SGI 0x80B8 -#define GL_POST_COLOR_MATRIX_GREEN_BIAS_SGI 0x80B9 -#define GL_POST_COLOR_MATRIX_BLUE_BIAS_SGI 0x80BA -#define GL_POST_COLOR_MATRIX_ALPHA_BIAS_SGI 0x80BB -#endif - -#ifndef GL_SGI_color_table -#define GL_COLOR_TABLE_SGI 0x80D0 -#define GL_POST_CONVOLUTION_COLOR_TABLE_SGI 0x80D1 -#define GL_POST_COLOR_MATRIX_COLOR_TABLE_SGI 0x80D2 -#define GL_PROXY_COLOR_TABLE_SGI 0x80D3 -#define GL_PROXY_POST_CONVOLUTION_COLOR_TABLE_SGI 0x80D4 -#define GL_PROXY_POST_COLOR_MATRIX_COLOR_TABLE_SGI 0x80D5 -#define GL_COLOR_TABLE_SCALE_SGI 0x80D6 -#define GL_COLOR_TABLE_BIAS_SGI 0x80D7 -#define GL_COLOR_TABLE_FORMAT_SGI 0x80D8 -#define GL_COLOR_TABLE_WIDTH_SGI 0x80D9 -#define GL_COLOR_TABLE_RED_SIZE_SGI 0x80DA -#define GL_COLOR_TABLE_GREEN_SIZE_SGI 0x80DB -#define GL_COLOR_TABLE_BLUE_SIZE_SGI 0x80DC -#define GL_COLOR_TABLE_ALPHA_SIZE_SGI 0x80DD -#define GL_COLOR_TABLE_LUMINANCE_SIZE_SGI 0x80DE -#define GL_COLOR_TABLE_INTENSITY_SIZE_SGI 0x80DF -#endif - -#ifndef GL_SGIS_pixel_texture -#define GL_PIXEL_TEXTURE_SGIS 0x8353 -#define GL_PIXEL_FRAGMENT_RGB_SOURCE_SGIS 0x8354 -#define GL_PIXEL_FRAGMENT_ALPHA_SOURCE_SGIS 0x8355 -#define GL_PIXEL_GROUP_COLOR_SGIS 0x8356 -#endif - -#ifndef GL_SGIX_pixel_texture -#define GL_PIXEL_TEX_GEN_SGIX 0x8139 -#define GL_PIXEL_TEX_GEN_MODE_SGIX 0x832B -#endif - -#ifndef GL_SGIS_texture4D -#define GL_PACK_SKIP_VOLUMES_SGIS 0x8130 -#define GL_PACK_IMAGE_DEPTH_SGIS 0x8131 -#define GL_UNPACK_SKIP_VOLUMES_SGIS 0x8132 -#define GL_UNPACK_IMAGE_DEPTH_SGIS 0x8133 -#define GL_TEXTURE_4D_SGIS 0x8134 -#define GL_PROXY_TEXTURE_4D_SGIS 0x8135 -#define GL_TEXTURE_4DSIZE_SGIS 0x8136 -#define GL_TEXTURE_WRAP_Q_SGIS 0x8137 -#define GL_MAX_4D_TEXTURE_SIZE_SGIS 0x8138 -#define GL_TEXTURE_4D_BINDING_SGIS 0x814F -#endif - -#ifndef GL_SGI_texture_color_table -#define GL_TEXTURE_COLOR_TABLE_SGI 0x80BC -#define GL_PROXY_TEXTURE_COLOR_TABLE_SGI 0x80BD -#endif - -#ifndef GL_EXT_cmyka -#define GL_CMYK_EXT 0x800C -#define GL_CMYKA_EXT 0x800D -#define GL_PACK_CMYK_HINT_EXT 0x800E -#define GL_UNPACK_CMYK_HINT_EXT 0x800F -#endif - -#ifndef GL_EXT_texture_object -#define GL_TEXTURE_PRIORITY_EXT 0x8066 -#define GL_TEXTURE_RESIDENT_EXT 0x8067 -#define GL_TEXTURE_1D_BINDING_EXT 0x8068 -#define GL_TEXTURE_2D_BINDING_EXT 0x8069 -#define GL_TEXTURE_3D_BINDING_EXT 0x806A -#endif - -#ifndef GL_SGIS_detail_texture -#define GL_DETAIL_TEXTURE_2D_SGIS 0x8095 -#define GL_DETAIL_TEXTURE_2D_BINDING_SGIS 0x8096 -#define GL_LINEAR_DETAIL_SGIS 0x8097 -#define GL_LINEAR_DETAIL_ALPHA_SGIS 0x8098 -#define GL_LINEAR_DETAIL_COLOR_SGIS 0x8099 -#define GL_DETAIL_TEXTURE_LEVEL_SGIS 0x809A -#define GL_DETAIL_TEXTURE_MODE_SGIS 0x809B -#define GL_DETAIL_TEXTURE_FUNC_POINTS_SGIS 0x809C -#endif - -#ifndef GL_SGIS_sharpen_texture -#define GL_LINEAR_SHARPEN_SGIS 0x80AD -#define GL_LINEAR_SHARPEN_ALPHA_SGIS 0x80AE -#define GL_LINEAR_SHARPEN_COLOR_SGIS 0x80AF -#define GL_SHARPEN_TEXTURE_FUNC_POINTS_SGIS 0x80B0 -#endif - -#ifndef GL_EXT_packed_pixels -#define GL_UNSIGNED_BYTE_3_3_2_EXT 0x8032 -#define GL_UNSIGNED_SHORT_4_4_4_4_EXT 0x8033 -#define GL_UNSIGNED_SHORT_5_5_5_1_EXT 0x8034 -#define GL_UNSIGNED_INT_8_8_8_8_EXT 0x8035 -#define GL_UNSIGNED_INT_10_10_10_2_EXT 0x8036 -#endif - -#ifndef GL_SGIS_texture_lod -#define GL_TEXTURE_MIN_LOD_SGIS 0x813A -#define GL_TEXTURE_MAX_LOD_SGIS 0x813B -#define GL_TEXTURE_BASE_LEVEL_SGIS 0x813C -#define GL_TEXTURE_MAX_LEVEL_SGIS 0x813D -#endif - -#ifndef GL_SGIS_multisample -#define GL_MULTISAMPLE_SGIS 0x809D -#define GL_SAMPLE_ALPHA_TO_MASK_SGIS 0x809E -#define GL_SAMPLE_ALPHA_TO_ONE_SGIS 0x809F -#define GL_SAMPLE_MASK_SGIS 0x80A0 -#define GL_1PASS_SGIS 0x80A1 -#define GL_2PASS_0_SGIS 0x80A2 -#define GL_2PASS_1_SGIS 0x80A3 -#define GL_4PASS_0_SGIS 0x80A4 -#define GL_4PASS_1_SGIS 0x80A5 -#define GL_4PASS_2_SGIS 0x80A6 -#define GL_4PASS_3_SGIS 0x80A7 -#define GL_SAMPLE_BUFFERS_SGIS 0x80A8 -#define GL_SAMPLES_SGIS 0x80A9 -#define GL_SAMPLE_MASK_VALUE_SGIS 0x80AA -#define GL_SAMPLE_MASK_INVERT_SGIS 0x80AB -#define GL_SAMPLE_PATTERN_SGIS 0x80AC -#endif - -#ifndef GL_EXT_rescale_normal -#define GL_RESCALE_NORMAL_EXT 0x803A -#endif - -#ifndef GL_EXT_vertex_array -#define GL_VERTEX_ARRAY_EXT 0x8074 -#define GL_NORMAL_ARRAY_EXT 0x8075 -#define GL_COLOR_ARRAY_EXT 0x8076 -#define GL_INDEX_ARRAY_EXT 0x8077 -#define GL_TEXTURE_COORD_ARRAY_EXT 0x8078 -#define GL_EDGE_FLAG_ARRAY_EXT 0x8079 -#define GL_VERTEX_ARRAY_SIZE_EXT 0x807A -#define GL_VERTEX_ARRAY_TYPE_EXT 0x807B -#define GL_VERTEX_ARRAY_STRIDE_EXT 0x807C -#define GL_VERTEX_ARRAY_COUNT_EXT 0x807D -#define GL_NORMAL_ARRAY_TYPE_EXT 0x807E -#define GL_NORMAL_ARRAY_STRIDE_EXT 0x807F -#define GL_NORMAL_ARRAY_COUNT_EXT 0x8080 -#define GL_COLOR_ARRAY_SIZE_EXT 0x8081 -#define GL_COLOR_ARRAY_TYPE_EXT 0x8082 -#define GL_COLOR_ARRAY_STRIDE_EXT 0x8083 -#define GL_COLOR_ARRAY_COUNT_EXT 0x8084 -#define GL_INDEX_ARRAY_TYPE_EXT 0x8085 -#define GL_INDEX_ARRAY_STRIDE_EXT 0x8086 -#define GL_INDEX_ARRAY_COUNT_EXT 0x8087 -#define GL_TEXTURE_COORD_ARRAY_SIZE_EXT 0x8088 -#define GL_TEXTURE_COORD_ARRAY_TYPE_EXT 0x8089 -#define GL_TEXTURE_COORD_ARRAY_STRIDE_EXT 0x808A -#define GL_TEXTURE_COORD_ARRAY_COUNT_EXT 0x808B -#define GL_EDGE_FLAG_ARRAY_STRIDE_EXT 0x808C -#define GL_EDGE_FLAG_ARRAY_COUNT_EXT 0x808D -#define GL_VERTEX_ARRAY_POINTER_EXT 0x808E -#define GL_NORMAL_ARRAY_POINTER_EXT 0x808F -#define GL_COLOR_ARRAY_POINTER_EXT 0x8090 -#define GL_INDEX_ARRAY_POINTER_EXT 0x8091 -#define GL_TEXTURE_COORD_ARRAY_POINTER_EXT 0x8092 -#define GL_EDGE_FLAG_ARRAY_POINTER_EXT 0x8093 -#endif - -#ifndef GL_EXT_misc_attribute -#endif - -#ifndef GL_SGIS_generate_mipmap -#define GL_GENERATE_MIPMAP_SGIS 0x8191 -#define GL_GENERATE_MIPMAP_HINT_SGIS 0x8192 -#endif - -#ifndef GL_SGIX_clipmap -#define GL_LINEAR_CLIPMAP_LINEAR_SGIX 0x8170 -#define GL_TEXTURE_CLIPMAP_CENTER_SGIX 0x8171 -#define GL_TEXTURE_CLIPMAP_FRAME_SGIX 0x8172 -#define GL_TEXTURE_CLIPMAP_OFFSET_SGIX 0x8173 -#define GL_TEXTURE_CLIPMAP_VIRTUAL_DEPTH_SGIX 0x8174 -#define GL_TEXTURE_CLIPMAP_LOD_OFFSET_SGIX 0x8175 -#define GL_TEXTURE_CLIPMAP_DEPTH_SGIX 0x8176 -#define GL_MAX_CLIPMAP_DEPTH_SGIX 0x8177 -#define GL_MAX_CLIPMAP_VIRTUAL_DEPTH_SGIX 0x8178 -#define GL_NEAREST_CLIPMAP_NEAREST_SGIX 0x844D -#define GL_NEAREST_CLIPMAP_LINEAR_SGIX 0x844E -#define GL_LINEAR_CLIPMAP_NEAREST_SGIX 0x844F -#endif - -#ifndef GL_SGIX_shadow -#define GL_TEXTURE_COMPARE_SGIX 0x819A -#define GL_TEXTURE_COMPARE_OPERATOR_SGIX 0x819B -#define GL_TEXTURE_LEQUAL_R_SGIX 0x819C -#define GL_TEXTURE_GEQUAL_R_SGIX 0x819D -#endif - -#ifndef GL_SGIS_texture_edge_clamp -#define GL_CLAMP_TO_EDGE_SGIS 0x812F -#endif - -#ifndef GL_SGIS_texture_border_clamp -#define GL_CLAMP_TO_BORDER_SGIS 0x812D -#endif - -#ifndef GL_EXT_blend_minmax -#define GL_FUNC_ADD_EXT 0x8006 -#define GL_MIN_EXT 0x8007 -#define GL_MAX_EXT 0x8008 -#define GL_BLEND_EQUATION_EXT 0x8009 -#endif - -#ifndef GL_EXT_blend_subtract -#define GL_FUNC_SUBTRACT_EXT 0x800A -#define GL_FUNC_REVERSE_SUBTRACT_EXT 0x800B -#endif - -#ifndef GL_EXT_blend_logic_op -#endif - -#ifndef GL_SGIX_interlace -#define GL_INTERLACE_SGIX 0x8094 -#endif - -#ifndef GL_SGIX_pixel_tiles -#define GL_PIXEL_TILE_BEST_ALIGNMENT_SGIX 0x813E -#define GL_PIXEL_TILE_CACHE_INCREMENT_SGIX 0x813F -#define GL_PIXEL_TILE_WIDTH_SGIX 0x8140 -#define GL_PIXEL_TILE_HEIGHT_SGIX 0x8141 -#define GL_PIXEL_TILE_GRID_WIDTH_SGIX 0x8142 -#define GL_PIXEL_TILE_GRID_HEIGHT_SGIX 0x8143 -#define GL_PIXEL_TILE_GRID_DEPTH_SGIX 0x8144 -#define GL_PIXEL_TILE_CACHE_SIZE_SGIX 0x8145 -#endif - -#ifndef GL_SGIS_texture_select -#define GL_DUAL_ALPHA4_SGIS 0x8110 -#define GL_DUAL_ALPHA8_SGIS 0x8111 -#define GL_DUAL_ALPHA12_SGIS 0x8112 -#define GL_DUAL_ALPHA16_SGIS 0x8113 -#define GL_DUAL_LUMINANCE4_SGIS 0x8114 -#define GL_DUAL_LUMINANCE8_SGIS 0x8115 -#define GL_DUAL_LUMINANCE12_SGIS 0x8116 -#define GL_DUAL_LUMINANCE16_SGIS 0x8117 -#define GL_DUAL_INTENSITY4_SGIS 0x8118 -#define GL_DUAL_INTENSITY8_SGIS 0x8119 -#define GL_DUAL_INTENSITY12_SGIS 0x811A -#define GL_DUAL_INTENSITY16_SGIS 0x811B -#define GL_DUAL_LUMINANCE_ALPHA4_SGIS 0x811C -#define GL_DUAL_LUMINANCE_ALPHA8_SGIS 0x811D -#define GL_QUAD_ALPHA4_SGIS 0x811E -#define GL_QUAD_ALPHA8_SGIS 0x811F -#define GL_QUAD_LUMINANCE4_SGIS 0x8120 -#define GL_QUAD_LUMINANCE8_SGIS 0x8121 -#define GL_QUAD_INTENSITY4_SGIS 0x8122 -#define GL_QUAD_INTENSITY8_SGIS 0x8123 -#define GL_DUAL_TEXTURE_SELECT_SGIS 0x8124 -#define GL_QUAD_TEXTURE_SELECT_SGIS 0x8125 -#endif - -#ifndef GL_SGIX_sprite -#define GL_SPRITE_SGIX 0x8148 -#define GL_SPRITE_MODE_SGIX 0x8149 -#define GL_SPRITE_AXIS_SGIX 0x814A -#define GL_SPRITE_TRANSLATION_SGIX 0x814B -#define GL_SPRITE_AXIAL_SGIX 0x814C -#define GL_SPRITE_OBJECT_ALIGNED_SGIX 0x814D -#define GL_SPRITE_EYE_ALIGNED_SGIX 0x814E -#endif - -#ifndef GL_SGIX_texture_multi_buffer -#define GL_TEXTURE_MULTI_BUFFER_HINT_SGIX 0x812E -#endif - -#ifndef GL_EXT_point_parameters -#define GL_POINT_SIZE_MIN_EXT 0x8126 -#define GL_POINT_SIZE_MAX_EXT 0x8127 -#define GL_POINT_FADE_THRESHOLD_SIZE_EXT 0x8128 -#define GL_DISTANCE_ATTENUATION_EXT 0x8129 -#endif - -#ifndef GL_SGIS_point_parameters -#define GL_POINT_SIZE_MIN_SGIS 0x8126 -#define GL_POINT_SIZE_MAX_SGIS 0x8127 -#define GL_POINT_FADE_THRESHOLD_SIZE_SGIS 0x8128 -#define GL_DISTANCE_ATTENUATION_SGIS 0x8129 -#endif - -#ifndef GL_SGIX_instruments -#define GL_INSTRUMENT_BUFFER_POINTER_SGIX 0x8180 -#define GL_INSTRUMENT_MEASUREMENTS_SGIX 0x8181 -#endif - -#ifndef GL_SGIX_texture_scale_bias -#define GL_POST_TEXTURE_FILTER_BIAS_SGIX 0x8179 -#define GL_POST_TEXTURE_FILTER_SCALE_SGIX 0x817A -#define GL_POST_TEXTURE_FILTER_BIAS_RANGE_SGIX 0x817B -#define GL_POST_TEXTURE_FILTER_SCALE_RANGE_SGIX 0x817C -#endif - -#ifndef GL_SGIX_framezoom -#define GL_FRAMEZOOM_SGIX 0x818B -#define GL_FRAMEZOOM_FACTOR_SGIX 0x818C -#define GL_MAX_FRAMEZOOM_FACTOR_SGIX 0x818D -#endif - -#ifndef GL_SGIX_tag_sample_buffer -#endif - -#ifndef GL_FfdMaskSGIX -#define GL_TEXTURE_DEFORMATION_BIT_SGIX 0x00000001 -#define GL_GEOMETRY_DEFORMATION_BIT_SGIX 0x00000002 -#endif - -#ifndef GL_SGIX_polynomial_ffd -#define GL_GEOMETRY_DEFORMATION_SGIX 0x8194 -#define GL_TEXTURE_DEFORMATION_SGIX 0x8195 -#define GL_DEFORMATIONS_MASK_SGIX 0x8196 -#define GL_MAX_DEFORMATION_ORDER_SGIX 0x8197 -#endif - -#ifndef GL_SGIX_reference_plane -#define GL_REFERENCE_PLANE_SGIX 0x817D -#define GL_REFERENCE_PLANE_EQUATION_SGIX 0x817E -#endif - -#ifndef GL_SGIX_flush_raster -#endif - -#ifndef GL_SGIX_depth_texture -#define GL_DEPTH_COMPONENT16_SGIX 0x81A5 -#define GL_DEPTH_COMPONENT24_SGIX 0x81A6 -#define GL_DEPTH_COMPONENT32_SGIX 0x81A7 -#endif - -#ifndef GL_SGIS_fog_function -#define GL_FOG_FUNC_SGIS 0x812A -#define GL_FOG_FUNC_POINTS_SGIS 0x812B -#define GL_MAX_FOG_FUNC_POINTS_SGIS 0x812C -#endif - -#ifndef GL_SGIX_fog_offset -#define GL_FOG_OFFSET_SGIX 0x8198 -#define GL_FOG_OFFSET_VALUE_SGIX 0x8199 -#endif - -#ifndef GL_HP_image_transform -#define GL_IMAGE_SCALE_X_HP 0x8155 -#define GL_IMAGE_SCALE_Y_HP 0x8156 -#define GL_IMAGE_TRANSLATE_X_HP 0x8157 -#define GL_IMAGE_TRANSLATE_Y_HP 0x8158 -#define GL_IMAGE_ROTATE_ANGLE_HP 0x8159 -#define GL_IMAGE_ROTATE_ORIGIN_X_HP 0x815A -#define GL_IMAGE_ROTATE_ORIGIN_Y_HP 0x815B -#define GL_IMAGE_MAG_FILTER_HP 0x815C -#define GL_IMAGE_MIN_FILTER_HP 0x815D -#define GL_IMAGE_CUBIC_WEIGHT_HP 0x815E -#define GL_CUBIC_HP 0x815F -#define GL_AVERAGE_HP 0x8160 -#define GL_IMAGE_TRANSFORM_2D_HP 0x8161 -#define GL_POST_IMAGE_TRANSFORM_COLOR_TABLE_HP 0x8162 -#define GL_PROXY_POST_IMAGE_TRANSFORM_COLOR_TABLE_HP 0x8163 -#endif - -#ifndef GL_HP_convolution_border_modes -#define GL_IGNORE_BORDER_HP 0x8150 -#define GL_CONSTANT_BORDER_HP 0x8151 -#define GL_REPLICATE_BORDER_HP 0x8153 -#define GL_CONVOLUTION_BORDER_COLOR_HP 0x8154 -#endif - -#ifndef GL_INGR_palette_buffer -#endif - -#ifndef GL_SGIX_texture_add_env -#define GL_TEXTURE_ENV_BIAS_SGIX 0x80BE -#endif - -#ifndef GL_EXT_color_subtable -#endif - -#ifndef GL_PGI_vertex_hints -#define GL_VERTEX_DATA_HINT_PGI 0x1A22A -#define GL_VERTEX_CONSISTENT_HINT_PGI 0x1A22B -#define GL_MATERIAL_SIDE_HINT_PGI 0x1A22C -#define GL_MAX_VERTEX_HINT_PGI 0x1A22D -#define GL_COLOR3_BIT_PGI 0x00010000 -#define GL_COLOR4_BIT_PGI 0x00020000 -#define GL_EDGEFLAG_BIT_PGI 0x00040000 -#define GL_INDEX_BIT_PGI 0x00080000 -#define GL_MAT_AMBIENT_BIT_PGI 0x00100000 -#define GL_MAT_AMBIENT_AND_DIFFUSE_BIT_PGI 0x00200000 -#define GL_MAT_DIFFUSE_BIT_PGI 0x00400000 -#define GL_MAT_EMISSION_BIT_PGI 0x00800000 -#define GL_MAT_COLOR_INDEXES_BIT_PGI 0x01000000 -#define GL_MAT_SHININESS_BIT_PGI 0x02000000 -#define GL_MAT_SPECULAR_BIT_PGI 0x04000000 -#define GL_NORMAL_BIT_PGI 0x08000000 -#define GL_TEXCOORD1_BIT_PGI 0x10000000 -#define GL_TEXCOORD2_BIT_PGI 0x20000000 -#define GL_TEXCOORD3_BIT_PGI 0x40000000 -#define GL_TEXCOORD4_BIT_PGI 0x80000000 -#define GL_VERTEX23_BIT_PGI 0x00000004 -#define GL_VERTEX4_BIT_PGI 0x00000008 -#endif - -#ifndef GL_PGI_misc_hints -#define GL_PREFER_DOUBLEBUFFER_HINT_PGI 0x1A1F8 -#define GL_CONSERVE_MEMORY_HINT_PGI 0x1A1FD -#define GL_RECLAIM_MEMORY_HINT_PGI 0x1A1FE -#define GL_NATIVE_GRAPHICS_HANDLE_PGI 0x1A202 -#define GL_NATIVE_GRAPHICS_BEGIN_HINT_PGI 0x1A203 -#define GL_NATIVE_GRAPHICS_END_HINT_PGI 0x1A204 -#define GL_ALWAYS_FAST_HINT_PGI 0x1A20C -#define GL_ALWAYS_SOFT_HINT_PGI 0x1A20D -#define GL_ALLOW_DRAW_OBJ_HINT_PGI 0x1A20E -#define GL_ALLOW_DRAW_WIN_HINT_PGI 0x1A20F -#define GL_ALLOW_DRAW_FRG_HINT_PGI 0x1A210 -#define GL_ALLOW_DRAW_MEM_HINT_PGI 0x1A211 -#define GL_STRICT_DEPTHFUNC_HINT_PGI 0x1A216 -#define GL_STRICT_LIGHTING_HINT_PGI 0x1A217 -#define GL_STRICT_SCISSOR_HINT_PGI 0x1A218 -#define GL_FULL_STIPPLE_HINT_PGI 0x1A219 -#define GL_CLIP_NEAR_HINT_PGI 0x1A220 -#define GL_CLIP_FAR_HINT_PGI 0x1A221 -#define GL_WIDE_LINE_HINT_PGI 0x1A222 -#define GL_BACK_NORMALS_HINT_PGI 0x1A223 -#endif - -#ifndef GL_EXT_paletted_texture -#define GL_COLOR_INDEX1_EXT 0x80E2 -#define GL_COLOR_INDEX2_EXT 0x80E3 -#define GL_COLOR_INDEX4_EXT 0x80E4 -#define GL_COLOR_INDEX8_EXT 0x80E5 -#define GL_COLOR_INDEX12_EXT 0x80E6 -#define GL_COLOR_INDEX16_EXT 0x80E7 -#define GL_TEXTURE_INDEX_SIZE_EXT 0x80ED -#endif - -#ifndef GL_EXT_clip_volume_hint -#define GL_CLIP_VOLUME_CLIPPING_HINT_EXT 0x80F0 -#endif - -#ifndef GL_SGIX_list_priority -#define GL_LIST_PRIORITY_SGIX 0x8182 -#endif - -#ifndef GL_SGIX_ir_instrument1 -#define GL_IR_INSTRUMENT1_SGIX 0x817F -#endif - -#ifndef GL_SGIX_calligraphic_fragment -#define GL_CALLIGRAPHIC_FRAGMENT_SGIX 0x8183 -#endif - -#ifndef GL_SGIX_texture_lod_bias -#define GL_TEXTURE_LOD_BIAS_S_SGIX 0x818E -#define GL_TEXTURE_LOD_BIAS_T_SGIX 0x818F -#define GL_TEXTURE_LOD_BIAS_R_SGIX 0x8190 -#endif - -#ifndef GL_SGIX_shadow_ambient -#define GL_SHADOW_AMBIENT_SGIX 0x80BF -#endif - -#ifndef GL_EXT_index_texture -#endif - -#ifndef GL_EXT_index_material -#define GL_INDEX_MATERIAL_EXT 0x81B8 -#define GL_INDEX_MATERIAL_PARAMETER_EXT 0x81B9 -#define GL_INDEX_MATERIAL_FACE_EXT 0x81BA -#endif - -#ifndef GL_EXT_index_func -#define GL_INDEX_TEST_EXT 0x81B5 -#define GL_INDEX_TEST_FUNC_EXT 0x81B6 -#define GL_INDEX_TEST_REF_EXT 0x81B7 -#endif - -#ifndef GL_EXT_index_array_formats -#define GL_IUI_V2F_EXT 0x81AD -#define GL_IUI_V3F_EXT 0x81AE -#define GL_IUI_N3F_V2F_EXT 0x81AF -#define GL_IUI_N3F_V3F_EXT 0x81B0 -#define GL_T2F_IUI_V2F_EXT 0x81B1 -#define GL_T2F_IUI_V3F_EXT 0x81B2 -#define GL_T2F_IUI_N3F_V2F_EXT 0x81B3 -#define GL_T2F_IUI_N3F_V3F_EXT 0x81B4 -#endif - -#ifndef GL_EXT_compiled_vertex_array -#define GL_ARRAY_ELEMENT_LOCK_FIRST_EXT 0x81A8 -#define GL_ARRAY_ELEMENT_LOCK_COUNT_EXT 0x81A9 -#endif - -#ifndef GL_EXT_cull_vertex -#define GL_CULL_VERTEX_EXT 0x81AA -#define GL_CULL_VERTEX_EYE_POSITION_EXT 0x81AB -#define GL_CULL_VERTEX_OBJECT_POSITION_EXT 0x81AC -#endif - -#ifndef GL_SGIX_ycrcb -#define GL_YCRCB_422_SGIX 0x81BB -#define GL_YCRCB_444_SGIX 0x81BC -#endif - -#ifndef GL_SGIX_fragment_lighting -#define GL_FRAGMENT_LIGHTING_SGIX 0x8400 -#define GL_FRAGMENT_COLOR_MATERIAL_SGIX 0x8401 -#define GL_FRAGMENT_COLOR_MATERIAL_FACE_SGIX 0x8402 -#define GL_FRAGMENT_COLOR_MATERIAL_PARAMETER_SGIX 0x8403 -#define GL_MAX_FRAGMENT_LIGHTS_SGIX 0x8404 -#define GL_MAX_ACTIVE_LIGHTS_SGIX 0x8405 -#define GL_CURRENT_RASTER_NORMAL_SGIX 0x8406 -#define GL_LIGHT_ENV_MODE_SGIX 0x8407 -#define GL_FRAGMENT_LIGHT_MODEL_LOCAL_VIEWER_SGIX 0x8408 -#define GL_FRAGMENT_LIGHT_MODEL_TWO_SIDE_SGIX 0x8409 -#define GL_FRAGMENT_LIGHT_MODEL_AMBIENT_SGIX 0x840A -#define GL_FRAGMENT_LIGHT_MODEL_NORMAL_INTERPOLATION_SGIX 0x840B -#define GL_FRAGMENT_LIGHT0_SGIX 0x840C -#define GL_FRAGMENT_LIGHT1_SGIX 0x840D -#define GL_FRAGMENT_LIGHT2_SGIX 0x840E -#define GL_FRAGMENT_LIGHT3_SGIX 0x840F -#define GL_FRAGMENT_LIGHT4_SGIX 0x8410 -#define GL_FRAGMENT_LIGHT5_SGIX 0x8411 -#define GL_FRAGMENT_LIGHT6_SGIX 0x8412 -#define GL_FRAGMENT_LIGHT7_SGIX 0x8413 -#endif - -#ifndef GL_IBM_rasterpos_clip -#define GL_RASTER_POSITION_UNCLIPPED_IBM 0x19262 -#endif - -#ifndef GL_HP_texture_lighting -#define GL_TEXTURE_LIGHTING_MODE_HP 0x8167 -#define GL_TEXTURE_POST_SPECULAR_HP 0x8168 -#define GL_TEXTURE_PRE_SPECULAR_HP 0x8169 -#endif - -#ifndef GL_EXT_draw_range_elements -#define GL_MAX_ELEMENTS_VERTICES_EXT 0x80E8 -#define GL_MAX_ELEMENTS_INDICES_EXT 0x80E9 -#endif - -#ifndef GL_WIN_phong_shading -#define GL_PHONG_WIN 0x80EA -#define GL_PHONG_HINT_WIN 0x80EB -#endif - -#ifndef GL_WIN_specular_fog -#define GL_FOG_SPECULAR_TEXTURE_WIN 0x80EC -#endif - -#ifndef GL_EXT_light_texture -#define GL_FRAGMENT_MATERIAL_EXT 0x8349 -#define GL_FRAGMENT_NORMAL_EXT 0x834A -#define GL_FRAGMENT_COLOR_EXT 0x834C -#define GL_ATTENUATION_EXT 0x834D -#define GL_SHADOW_ATTENUATION_EXT 0x834E -#define GL_TEXTURE_APPLICATION_MODE_EXT 0x834F -#define GL_TEXTURE_LIGHT_EXT 0x8350 -#define GL_TEXTURE_MATERIAL_FACE_EXT 0x8351 -#define GL_TEXTURE_MATERIAL_PARAMETER_EXT 0x8352 -/* reuse GL_FRAGMENT_DEPTH_EXT */ -#endif - -#ifndef GL_SGIX_blend_alpha_minmax -#define GL_ALPHA_MIN_SGIX 0x8320 -#define GL_ALPHA_MAX_SGIX 0x8321 -#endif - -#ifndef GL_SGIX_impact_pixel_texture -#define GL_PIXEL_TEX_GEN_Q_CEILING_SGIX 0x8184 -#define GL_PIXEL_TEX_GEN_Q_ROUND_SGIX 0x8185 -#define GL_PIXEL_TEX_GEN_Q_FLOOR_SGIX 0x8186 -#define GL_PIXEL_TEX_GEN_ALPHA_REPLACE_SGIX 0x8187 -#define GL_PIXEL_TEX_GEN_ALPHA_NO_REPLACE_SGIX 0x8188 -#define GL_PIXEL_TEX_GEN_ALPHA_LS_SGIX 0x8189 -#define GL_PIXEL_TEX_GEN_ALPHA_MS_SGIX 0x818A -#endif - -#ifndef GL_EXT_bgra -#define GL_BGR_EXT 0x80E0 -#define GL_BGRA_EXT 0x80E1 -#endif - -#ifndef GL_SGIX_async -#define GL_ASYNC_MARKER_SGIX 0x8329 -#endif - -#ifndef GL_SGIX_async_pixel -#define GL_ASYNC_TEX_IMAGE_SGIX 0x835C -#define GL_ASYNC_DRAW_PIXELS_SGIX 0x835D -#define GL_ASYNC_READ_PIXELS_SGIX 0x835E -#define GL_MAX_ASYNC_TEX_IMAGE_SGIX 0x835F -#define GL_MAX_ASYNC_DRAW_PIXELS_SGIX 0x8360 -#define GL_MAX_ASYNC_READ_PIXELS_SGIX 0x8361 -#endif - -#ifndef GL_SGIX_async_histogram -#define GL_ASYNC_HISTOGRAM_SGIX 0x832C -#define GL_MAX_ASYNC_HISTOGRAM_SGIX 0x832D -#endif - -#ifndef GL_INTEL_texture_scissor -#endif - -#ifndef GL_INTEL_parallel_arrays -#define GL_PARALLEL_ARRAYS_INTEL 0x83F4 -#define GL_VERTEX_ARRAY_PARALLEL_POINTERS_INTEL 0x83F5 -#define GL_NORMAL_ARRAY_PARALLEL_POINTERS_INTEL 0x83F6 -#define GL_COLOR_ARRAY_PARALLEL_POINTERS_INTEL 0x83F7 -#define GL_TEXTURE_COORD_ARRAY_PARALLEL_POINTERS_INTEL 0x83F8 -#endif - -#ifndef GL_HP_occlusion_test -#define GL_OCCLUSION_TEST_HP 0x8165 -#define GL_OCCLUSION_TEST_RESULT_HP 0x8166 -#endif - -#ifndef GL_EXT_pixel_transform -#define GL_PIXEL_TRANSFORM_2D_EXT 0x8330 -#define GL_PIXEL_MAG_FILTER_EXT 0x8331 -#define GL_PIXEL_MIN_FILTER_EXT 0x8332 -#define GL_PIXEL_CUBIC_WEIGHT_EXT 0x8333 -#define GL_CUBIC_EXT 0x8334 -#define GL_AVERAGE_EXT 0x8335 -#define GL_PIXEL_TRANSFORM_2D_STACK_DEPTH_EXT 0x8336 -#define GL_MAX_PIXEL_TRANSFORM_2D_STACK_DEPTH_EXT 0x8337 -#define GL_PIXEL_TRANSFORM_2D_MATRIX_EXT 0x8338 -#endif - -#ifndef GL_EXT_pixel_transform_color_table -#endif - -#ifndef GL_EXT_shared_texture_palette -#define GL_SHARED_TEXTURE_PALETTE_EXT 0x81FB -#endif - -#ifndef GL_EXT_separate_specular_color -#define GL_LIGHT_MODEL_COLOR_CONTROL_EXT 0x81F8 -#define GL_SINGLE_COLOR_EXT 0x81F9 -#define GL_SEPARATE_SPECULAR_COLOR_EXT 0x81FA -#endif - -#ifndef GL_EXT_secondary_color -#define GL_COLOR_SUM_EXT 0x8458 -#define GL_CURRENT_SECONDARY_COLOR_EXT 0x8459 -#define GL_SECONDARY_COLOR_ARRAY_SIZE_EXT 0x845A -#define GL_SECONDARY_COLOR_ARRAY_TYPE_EXT 0x845B -#define GL_SECONDARY_COLOR_ARRAY_STRIDE_EXT 0x845C -#define GL_SECONDARY_COLOR_ARRAY_POINTER_EXT 0x845D -#define GL_SECONDARY_COLOR_ARRAY_EXT 0x845E -#endif - -#ifndef GL_EXT_texture_perturb_normal -#define GL_PERTURB_EXT 0x85AE -#define GL_TEXTURE_NORMAL_EXT 0x85AF -#endif - -#ifndef GL_EXT_multi_draw_arrays -#endif - -#ifndef GL_EXT_fog_coord -#define GL_FOG_COORDINATE_SOURCE_EXT 0x8450 -#define GL_FOG_COORDINATE_EXT 0x8451 -#define GL_FRAGMENT_DEPTH_EXT 0x8452 -#define GL_CURRENT_FOG_COORDINATE_EXT 0x8453 -#define GL_FOG_COORDINATE_ARRAY_TYPE_EXT 0x8454 -#define GL_FOG_COORDINATE_ARRAY_STRIDE_EXT 0x8455 -#define GL_FOG_COORDINATE_ARRAY_POINTER_EXT 0x8456 -#define GL_FOG_COORDINATE_ARRAY_EXT 0x8457 -#endif - -#ifndef GL_REND_screen_coordinates -#define GL_SCREEN_COORDINATES_REND 0x8490 -#define GL_INVERTED_SCREEN_W_REND 0x8491 -#endif - -#ifndef GL_EXT_coordinate_frame -#define GL_TANGENT_ARRAY_EXT 0x8439 -#define GL_BINORMAL_ARRAY_EXT 0x843A -#define GL_CURRENT_TANGENT_EXT 0x843B -#define GL_CURRENT_BINORMAL_EXT 0x843C -#define GL_TANGENT_ARRAY_TYPE_EXT 0x843E -#define GL_TANGENT_ARRAY_STRIDE_EXT 0x843F -#define GL_BINORMAL_ARRAY_TYPE_EXT 0x8440 -#define GL_BINORMAL_ARRAY_STRIDE_EXT 0x8441 -#define GL_TANGENT_ARRAY_POINTER_EXT 0x8442 -#define GL_BINORMAL_ARRAY_POINTER_EXT 0x8443 -#define GL_MAP1_TANGENT_EXT 0x8444 -#define GL_MAP2_TANGENT_EXT 0x8445 -#define GL_MAP1_BINORMAL_EXT 0x8446 -#define GL_MAP2_BINORMAL_EXT 0x8447 -#endif - -#ifndef GL_EXT_texture_env_combine -#define GL_COMBINE_EXT 0x8570 -#define GL_COMBINE_RGB_EXT 0x8571 -#define GL_COMBINE_ALPHA_EXT 0x8572 -#define GL_RGB_SCALE_EXT 0x8573 -#define GL_ADD_SIGNED_EXT 0x8574 -#define GL_INTERPOLATE_EXT 0x8575 -#define GL_CONSTANT_EXT 0x8576 -#define GL_PRIMARY_COLOR_EXT 0x8577 -#define GL_PREVIOUS_EXT 0x8578 -#define GL_SOURCE0_RGB_EXT 0x8580 -#define GL_SOURCE1_RGB_EXT 0x8581 -#define GL_SOURCE2_RGB_EXT 0x8582 -#define GL_SOURCE0_ALPHA_EXT 0x8588 -#define GL_SOURCE1_ALPHA_EXT 0x8589 -#define GL_SOURCE2_ALPHA_EXT 0x858A -#define GL_OPERAND0_RGB_EXT 0x8590 -#define GL_OPERAND1_RGB_EXT 0x8591 -#define GL_OPERAND2_RGB_EXT 0x8592 -#define GL_OPERAND0_ALPHA_EXT 0x8598 -#define GL_OPERAND1_ALPHA_EXT 0x8599 -#define GL_OPERAND2_ALPHA_EXT 0x859A -#endif - -#ifndef GL_APPLE_specular_vector -#define GL_LIGHT_MODEL_SPECULAR_VECTOR_APPLE 0x85B0 -#endif - -#ifndef GL_APPLE_transform_hint -#define GL_TRANSFORM_HINT_APPLE 0x85B1 -#endif - -#ifndef GL_SGIX_fog_scale -#define GL_FOG_SCALE_SGIX 0x81FC -#define GL_FOG_SCALE_VALUE_SGIX 0x81FD -#endif - -#ifndef GL_SUNX_constant_data -#define GL_UNPACK_CONSTANT_DATA_SUNX 0x81D5 -#define GL_TEXTURE_CONSTANT_DATA_SUNX 0x81D6 -#endif - -#ifndef GL_SUN_global_alpha -#define GL_GLOBAL_ALPHA_SUN 0x81D9 -#define GL_GLOBAL_ALPHA_FACTOR_SUN 0x81DA -#endif - -#ifndef GL_SUN_triangle_list -#define GL_RESTART_SUN 0x0001 -#define GL_REPLACE_MIDDLE_SUN 0x0002 -#define GL_REPLACE_OLDEST_SUN 0x0003 -#define GL_TRIANGLE_LIST_SUN 0x81D7 -#define GL_REPLACEMENT_CODE_SUN 0x81D8 -#define GL_REPLACEMENT_CODE_ARRAY_SUN 0x85C0 -#define GL_REPLACEMENT_CODE_ARRAY_TYPE_SUN 0x85C1 -#define GL_REPLACEMENT_CODE_ARRAY_STRIDE_SUN 0x85C2 -#define GL_REPLACEMENT_CODE_ARRAY_POINTER_SUN 0x85C3 -#define GL_R1UI_V3F_SUN 0x85C4 -#define GL_R1UI_C4UB_V3F_SUN 0x85C5 -#define GL_R1UI_C3F_V3F_SUN 0x85C6 -#define GL_R1UI_N3F_V3F_SUN 0x85C7 -#define GL_R1UI_C4F_N3F_V3F_SUN 0x85C8 -#define GL_R1UI_T2F_V3F_SUN 0x85C9 -#define GL_R1UI_T2F_N3F_V3F_SUN 0x85CA -#define GL_R1UI_T2F_C4F_N3F_V3F_SUN 0x85CB -#endif - -#ifndef GL_SUN_vertex -#endif - -#ifndef GL_EXT_blend_func_separate -#define GL_BLEND_DST_RGB_EXT 0x80C8 -#define GL_BLEND_SRC_RGB_EXT 0x80C9 -#define GL_BLEND_DST_ALPHA_EXT 0x80CA -#define GL_BLEND_SRC_ALPHA_EXT 0x80CB -#endif - -#ifndef GL_INGR_color_clamp -#define GL_RED_MIN_CLAMP_INGR 0x8560 -#define GL_GREEN_MIN_CLAMP_INGR 0x8561 -#define GL_BLUE_MIN_CLAMP_INGR 0x8562 -#define GL_ALPHA_MIN_CLAMP_INGR 0x8563 -#define GL_RED_MAX_CLAMP_INGR 0x8564 -#define GL_GREEN_MAX_CLAMP_INGR 0x8565 -#define GL_BLUE_MAX_CLAMP_INGR 0x8566 -#define GL_ALPHA_MAX_CLAMP_INGR 0x8567 -#endif - -#ifndef GL_INGR_interlace_read -#define GL_INTERLACE_READ_INGR 0x8568 -#endif - -#ifndef GL_EXT_stencil_wrap -#define GL_INCR_WRAP_EXT 0x8507 -#define GL_DECR_WRAP_EXT 0x8508 -#endif - -#ifndef GL_EXT_422_pixels -#define GL_422_EXT 0x80CC -#define GL_422_REV_EXT 0x80CD -#define GL_422_AVERAGE_EXT 0x80CE -#define GL_422_REV_AVERAGE_EXT 0x80CF -#endif - -#ifndef GL_NV_texgen_reflection -#define GL_NORMAL_MAP_NV 0x8511 -#define GL_REFLECTION_MAP_NV 0x8512 -#endif - -#ifndef GL_EXT_texture_cube_map -#define GL_NORMAL_MAP_EXT 0x8511 -#define GL_REFLECTION_MAP_EXT 0x8512 -#define GL_TEXTURE_CUBE_MAP_EXT 0x8513 -#define GL_TEXTURE_BINDING_CUBE_MAP_EXT 0x8514 -#define GL_TEXTURE_CUBE_MAP_POSITIVE_X_EXT 0x8515 -#define GL_TEXTURE_CUBE_MAP_NEGATIVE_X_EXT 0x8516 -#define GL_TEXTURE_CUBE_MAP_POSITIVE_Y_EXT 0x8517 -#define GL_TEXTURE_CUBE_MAP_NEGATIVE_Y_EXT 0x8518 -#define GL_TEXTURE_CUBE_MAP_POSITIVE_Z_EXT 0x8519 -#define GL_TEXTURE_CUBE_MAP_NEGATIVE_Z_EXT 0x851A -#define GL_PROXY_TEXTURE_CUBE_MAP_EXT 0x851B -#define GL_MAX_CUBE_MAP_TEXTURE_SIZE_EXT 0x851C -#endif - -#ifndef GL_SUN_convolution_border_modes -#define GL_WRAP_BORDER_SUN 0x81D4 -#endif - -#ifndef GL_EXT_texture_env_add -#endif - -#ifndef GL_EXT_texture_lod_bias -#define GL_MAX_TEXTURE_LOD_BIAS_EXT 0x84FD -#define GL_TEXTURE_FILTER_CONTROL_EXT 0x8500 -#define GL_TEXTURE_LOD_BIAS_EXT 0x8501 -#endif - -#ifndef GL_EXT_texture_filter_anisotropic -#define GL_TEXTURE_MAX_ANISOTROPY_EXT 0x84FE -#define GL_MAX_TEXTURE_MAX_ANISOTROPY_EXT 0x84FF -#endif - -#ifndef GL_EXT_vertex_weighting -#define GL_MODELVIEW0_STACK_DEPTH_EXT GL_MODELVIEW_STACK_DEPTH -#define GL_MODELVIEW1_STACK_DEPTH_EXT 0x8502 -#define GL_MODELVIEW0_MATRIX_EXT GL_MODELVIEW_MATRIX -#define GL_MODELVIEW1_MATRIX_EXT 0x8506 -#define GL_VERTEX_WEIGHTING_EXT 0x8509 -#define GL_MODELVIEW0_EXT GL_MODELVIEW -#define GL_MODELVIEW1_EXT 0x850A -#define GL_CURRENT_VERTEX_WEIGHT_EXT 0x850B -#define GL_VERTEX_WEIGHT_ARRAY_EXT 0x850C -#define GL_VERTEX_WEIGHT_ARRAY_SIZE_EXT 0x850D -#define GL_VERTEX_WEIGHT_ARRAY_TYPE_EXT 0x850E -#define GL_VERTEX_WEIGHT_ARRAY_STRIDE_EXT 0x850F -#define GL_VERTEX_WEIGHT_ARRAY_POINTER_EXT 0x8510 -#endif - -#ifndef GL_NV_light_max_exponent -#define GL_MAX_SHININESS_NV 0x8504 -#define GL_MAX_SPOT_EXPONENT_NV 0x8505 -#endif - -#ifndef GL_NV_vertex_array_range -#define GL_VERTEX_ARRAY_RANGE_NV 0x851D -#define GL_VERTEX_ARRAY_RANGE_LENGTH_NV 0x851E -#define GL_VERTEX_ARRAY_RANGE_VALID_NV 0x851F -#define GL_MAX_VERTEX_ARRAY_RANGE_ELEMENT_NV 0x8520 -#define GL_VERTEX_ARRAY_RANGE_POINTER_NV 0x8521 -#endif - -#ifndef GL_NV_register_combiners -#define GL_REGISTER_COMBINERS_NV 0x8522 -#define GL_VARIABLE_A_NV 0x8523 -#define GL_VARIABLE_B_NV 0x8524 -#define GL_VARIABLE_C_NV 0x8525 -#define GL_VARIABLE_D_NV 0x8526 -#define GL_VARIABLE_E_NV 0x8527 -#define GL_VARIABLE_F_NV 0x8528 -#define GL_VARIABLE_G_NV 0x8529 -#define GL_CONSTANT_COLOR0_NV 0x852A -#define GL_CONSTANT_COLOR1_NV 0x852B -#define GL_PRIMARY_COLOR_NV 0x852C -#define GL_SECONDARY_COLOR_NV 0x852D -#define GL_SPARE0_NV 0x852E -#define GL_SPARE1_NV 0x852F -#define GL_DISCARD_NV 0x8530 -#define GL_E_TIMES_F_NV 0x8531 -#define GL_SPARE0_PLUS_SECONDARY_COLOR_NV 0x8532 -#define GL_UNSIGNED_IDENTITY_NV 0x8536 -#define GL_UNSIGNED_INVERT_NV 0x8537 -#define GL_EXPAND_NORMAL_NV 0x8538 -#define GL_EXPAND_NEGATE_NV 0x8539 -#define GL_HALF_BIAS_NORMAL_NV 0x853A -#define GL_HALF_BIAS_NEGATE_NV 0x853B -#define GL_SIGNED_IDENTITY_NV 0x853C -#define GL_SIGNED_NEGATE_NV 0x853D -#define GL_SCALE_BY_TWO_NV 0x853E -#define GL_SCALE_BY_FOUR_NV 0x853F -#define GL_SCALE_BY_ONE_HALF_NV 0x8540 -#define GL_BIAS_BY_NEGATIVE_ONE_HALF_NV 0x8541 -#define GL_COMBINER_INPUT_NV 0x8542 -#define GL_COMBINER_MAPPING_NV 0x8543 -#define GL_COMBINER_COMPONENT_USAGE_NV 0x8544 -#define GL_COMBINER_AB_DOT_PRODUCT_NV 0x8545 -#define GL_COMBINER_CD_DOT_PRODUCT_NV 0x8546 -#define GL_COMBINER_MUX_SUM_NV 0x8547 -#define GL_COMBINER_SCALE_NV 0x8548 -#define GL_COMBINER_BIAS_NV 0x8549 -#define GL_COMBINER_AB_OUTPUT_NV 0x854A -#define GL_COMBINER_CD_OUTPUT_NV 0x854B -#define GL_COMBINER_SUM_OUTPUT_NV 0x854C -#define GL_MAX_GENERAL_COMBINERS_NV 0x854D -#define GL_NUM_GENERAL_COMBINERS_NV 0x854E -#define GL_COLOR_SUM_CLAMP_NV 0x854F -#define GL_COMBINER0_NV 0x8550 -#define GL_COMBINER1_NV 0x8551 -#define GL_COMBINER2_NV 0x8552 -#define GL_COMBINER3_NV 0x8553 -#define GL_COMBINER4_NV 0x8554 -#define GL_COMBINER5_NV 0x8555 -#define GL_COMBINER6_NV 0x8556 -#define GL_COMBINER7_NV 0x8557 -/* reuse GL_TEXTURE0_ARB */ -/* reuse GL_TEXTURE1_ARB */ -/* reuse GL_ZERO */ -/* reuse GL_NONE */ -/* reuse GL_FOG */ -#endif - -#ifndef GL_NV_fog_distance -#define GL_FOG_DISTANCE_MODE_NV 0x855A -#define GL_EYE_RADIAL_NV 0x855B -#define GL_EYE_PLANE_ABSOLUTE_NV 0x855C -/* reuse GL_EYE_PLANE */ -#endif - -#ifndef GL_NV_texgen_emboss -#define GL_EMBOSS_LIGHT_NV 0x855D -#define GL_EMBOSS_CONSTANT_NV 0x855E -#define GL_EMBOSS_MAP_NV 0x855F -#endif - -#ifndef GL_NV_blend_square -#endif - -#ifndef GL_NV_texture_env_combine4 -#define GL_COMBINE4_NV 0x8503 -#define GL_SOURCE3_RGB_NV 0x8583 -#define GL_SOURCE3_ALPHA_NV 0x858B -#define GL_OPERAND3_RGB_NV 0x8593 -#define GL_OPERAND3_ALPHA_NV 0x859B -#endif - -#ifndef GL_MESA_resize_buffers -#endif - -#ifndef GL_MESA_window_pos -#endif - -#ifndef GL_EXT_texture_compression_s3tc -#define GL_COMPRESSED_RGB_S3TC_DXT1_EXT 0x83F0 -#define GL_COMPRESSED_RGBA_S3TC_DXT1_EXT 0x83F1 -#define GL_COMPRESSED_RGBA_S3TC_DXT3_EXT 0x83F2 -#define GL_COMPRESSED_RGBA_S3TC_DXT5_EXT 0x83F3 -#endif - -#ifndef GL_IBM_cull_vertex -#define GL_CULL_VERTEX_IBM 103050 -#endif - -#ifndef GL_IBM_multimode_draw_arrays -#endif - -#ifndef GL_IBM_vertex_array_lists -#define GL_VERTEX_ARRAY_LIST_IBM 103070 -#define GL_NORMAL_ARRAY_LIST_IBM 103071 -#define GL_COLOR_ARRAY_LIST_IBM 103072 -#define GL_INDEX_ARRAY_LIST_IBM 103073 -#define GL_TEXTURE_COORD_ARRAY_LIST_IBM 103074 -#define GL_EDGE_FLAG_ARRAY_LIST_IBM 103075 -#define GL_FOG_COORDINATE_ARRAY_LIST_IBM 103076 -#define GL_SECONDARY_COLOR_ARRAY_LIST_IBM 103077 -#define GL_VERTEX_ARRAY_LIST_STRIDE_IBM 103080 -#define GL_NORMAL_ARRAY_LIST_STRIDE_IBM 103081 -#define GL_COLOR_ARRAY_LIST_STRIDE_IBM 103082 -#define GL_INDEX_ARRAY_LIST_STRIDE_IBM 103083 -#define GL_TEXTURE_COORD_ARRAY_LIST_STRIDE_IBM 103084 -#define GL_EDGE_FLAG_ARRAY_LIST_STRIDE_IBM 103085 -#define GL_FOG_COORDINATE_ARRAY_LIST_STRIDE_IBM 103086 -#define GL_SECONDARY_COLOR_ARRAY_LIST_STRIDE_IBM 103087 -#endif - -#ifndef GL_SGIX_subsample -#define GL_PACK_SUBSAMPLE_RATE_SGIX 0x85A0 -#define GL_UNPACK_SUBSAMPLE_RATE_SGIX 0x85A1 -#define GL_PIXEL_SUBSAMPLE_4444_SGIX 0x85A2 -#define GL_PIXEL_SUBSAMPLE_2424_SGIX 0x85A3 -#define GL_PIXEL_SUBSAMPLE_4242_SGIX 0x85A4 -#endif - -#ifndef GL_SGIX_ycrcb_subsample -#endif - -#ifndef GL_SGIX_ycrcba -#define GL_YCRCB_SGIX 0x8318 -#define GL_YCRCBA_SGIX 0x8319 -#endif - -#ifndef GL_SGI_depth_pass_instrument -#define GL_DEPTH_PASS_INSTRUMENT_SGIX 0x8310 -#define GL_DEPTH_PASS_INSTRUMENT_COUNTERS_SGIX 0x8311 -#define GL_DEPTH_PASS_INSTRUMENT_MAX_SGIX 0x8312 -#endif - -#ifndef GL_3DFX_texture_compression_FXT1 -#define GL_COMPRESSED_RGB_FXT1_3DFX 0x86B0 -#define GL_COMPRESSED_RGBA_FXT1_3DFX 0x86B1 -#endif - -#ifndef GL_3DFX_multisample -#define GL_MULTISAMPLE_3DFX 0x86B2 -#define GL_SAMPLE_BUFFERS_3DFX 0x86B3 -#define GL_SAMPLES_3DFX 0x86B4 -#define GL_MULTISAMPLE_BIT_3DFX 0x20000000 -#endif - -#ifndef GL_3DFX_tbuffer -#endif - -#ifndef GL_EXT_multisample -#define GL_MULTISAMPLE_EXT 0x809D -#define GL_SAMPLE_ALPHA_TO_MASK_EXT 0x809E -#define GL_SAMPLE_ALPHA_TO_ONE_EXT 0x809F -#define GL_SAMPLE_MASK_EXT 0x80A0 -#define GL_1PASS_EXT 0x80A1 -#define GL_2PASS_0_EXT 0x80A2 -#define GL_2PASS_1_EXT 0x80A3 -#define GL_4PASS_0_EXT 0x80A4 -#define GL_4PASS_1_EXT 0x80A5 -#define GL_4PASS_2_EXT 0x80A6 -#define GL_4PASS_3_EXT 0x80A7 -#define GL_SAMPLE_BUFFERS_EXT 0x80A8 -#define GL_SAMPLES_EXT 0x80A9 -#define GL_SAMPLE_MASK_VALUE_EXT 0x80AA -#define GL_SAMPLE_MASK_INVERT_EXT 0x80AB -#define GL_SAMPLE_PATTERN_EXT 0x80AC -#define GL_MULTISAMPLE_BIT_EXT 0x20000000 -#endif - -#ifndef GL_SGIX_vertex_preclip -#define GL_VERTEX_PRECLIP_SGIX 0x83EE -#define GL_VERTEX_PRECLIP_HINT_SGIX 0x83EF -#endif - -#ifndef GL_SGIX_convolution_accuracy -#define GL_CONVOLUTION_HINT_SGIX 0x8316 -#endif - -#ifndef GL_SGIX_resample -#define GL_PACK_RESAMPLE_SGIX 0x842C -#define GL_UNPACK_RESAMPLE_SGIX 0x842D -#define GL_RESAMPLE_REPLICATE_SGIX 0x842E -#define GL_RESAMPLE_ZERO_FILL_SGIX 0x842F -#define GL_RESAMPLE_DECIMATE_SGIX 0x8430 -#endif - -#ifndef GL_SGIS_point_line_texgen -#define GL_EYE_DISTANCE_TO_POINT_SGIS 0x81F0 -#define GL_OBJECT_DISTANCE_TO_POINT_SGIS 0x81F1 -#define GL_EYE_DISTANCE_TO_LINE_SGIS 0x81F2 -#define GL_OBJECT_DISTANCE_TO_LINE_SGIS 0x81F3 -#define GL_EYE_POINT_SGIS 0x81F4 -#define GL_OBJECT_POINT_SGIS 0x81F5 -#define GL_EYE_LINE_SGIS 0x81F6 -#define GL_OBJECT_LINE_SGIS 0x81F7 -#endif - -#ifndef GL_SGIS_texture_color_mask -#define GL_TEXTURE_COLOR_WRITEMASK_SGIS 0x81EF -#endif - -#ifndef GL_EXT_texture_env_dot3 -#define GL_DOT3_RGB_EXT 0x8740 -#define GL_DOT3_RGBA_EXT 0x8741 -#endif - -#ifndef GL_ATI_texture_mirror_once -#define GL_MIRROR_CLAMP_ATI 0x8742 -#define GL_MIRROR_CLAMP_TO_EDGE_ATI 0x8743 -#endif - -#ifndef GL_NV_fence -#define GL_ALL_COMPLETED_NV 0x84F2 -#define GL_FENCE_STATUS_NV 0x84F3 -#define GL_FENCE_CONDITION_NV 0x84F4 -#endif - -#ifndef GL_IBM_texture_mirrored_repeat -#define GL_MIRRORED_REPEAT_IBM 0x8370 -#endif - -#ifndef GL_NV_evaluators -#define GL_EVAL_2D_NV 0x86C0 -#define GL_EVAL_TRIANGULAR_2D_NV 0x86C1 -#define GL_MAP_TESSELLATION_NV 0x86C2 -#define GL_MAP_ATTRIB_U_ORDER_NV 0x86C3 -#define GL_MAP_ATTRIB_V_ORDER_NV 0x86C4 -#define GL_EVAL_FRACTIONAL_TESSELLATION_NV 0x86C5 -#define GL_EVAL_VERTEX_ATTRIB0_NV 0x86C6 -#define GL_EVAL_VERTEX_ATTRIB1_NV 0x86C7 -#define GL_EVAL_VERTEX_ATTRIB2_NV 0x86C8 -#define GL_EVAL_VERTEX_ATTRIB3_NV 0x86C9 -#define GL_EVAL_VERTEX_ATTRIB4_NV 0x86CA -#define GL_EVAL_VERTEX_ATTRIB5_NV 0x86CB -#define GL_EVAL_VERTEX_ATTRIB6_NV 0x86CC -#define GL_EVAL_VERTEX_ATTRIB7_NV 0x86CD -#define GL_EVAL_VERTEX_ATTRIB8_NV 0x86CE -#define GL_EVAL_VERTEX_ATTRIB9_NV 0x86CF -#define GL_EVAL_VERTEX_ATTRIB10_NV 0x86D0 -#define GL_EVAL_VERTEX_ATTRIB11_NV 0x86D1 -#define GL_EVAL_VERTEX_ATTRIB12_NV 0x86D2 -#define GL_EVAL_VERTEX_ATTRIB13_NV 0x86D3 -#define GL_EVAL_VERTEX_ATTRIB14_NV 0x86D4 -#define GL_EVAL_VERTEX_ATTRIB15_NV 0x86D5 -#define GL_MAX_MAP_TESSELLATION_NV 0x86D6 -#define GL_MAX_RATIONAL_EVAL_ORDER_NV 0x86D7 -#endif - -#ifndef GL_NV_packed_depth_stencil -#define GL_DEPTH_STENCIL_NV 0x84F9 -#define GL_UNSIGNED_INT_24_8_NV 0x84FA -#endif - -#ifndef GL_NV_register_combiners2 -#define GL_PER_STAGE_CONSTANTS_NV 0x8535 -#endif - -#ifndef GL_NV_texture_compression_vtc -#endif - -#ifndef GL_NV_texture_rectangle -#define GL_TEXTURE_RECTANGLE_NV 0x84F5 -#define GL_TEXTURE_BINDING_RECTANGLE_NV 0x84F6 -#define GL_PROXY_TEXTURE_RECTANGLE_NV 0x84F7 -#define GL_MAX_RECTANGLE_TEXTURE_SIZE_NV 0x84F8 -#endif - -#ifndef GL_NV_texture_shader -#define GL_OFFSET_TEXTURE_RECTANGLE_NV 0x864C -#define GL_OFFSET_TEXTURE_RECTANGLE_SCALE_NV 0x864D -#define GL_DOT_PRODUCT_TEXTURE_RECTANGLE_NV 0x864E -#define GL_RGBA_UNSIGNED_DOT_PRODUCT_MAPPING_NV 0x86D9 -#define GL_UNSIGNED_INT_S8_S8_8_8_NV 0x86DA -#define GL_UNSIGNED_INT_8_8_S8_S8_REV_NV 0x86DB -#define GL_DSDT_MAG_INTENSITY_NV 0x86DC -#define GL_SHADER_CONSISTENT_NV 0x86DD -#define GL_TEXTURE_SHADER_NV 0x86DE -#define GL_SHADER_OPERATION_NV 0x86DF -#define GL_CULL_MODES_NV 0x86E0 -#define GL_OFFSET_TEXTURE_MATRIX_NV 0x86E1 -#define GL_OFFSET_TEXTURE_SCALE_NV 0x86E2 -#define GL_OFFSET_TEXTURE_BIAS_NV 0x86E3 -#define GL_OFFSET_TEXTURE_2D_MATRIX_NV GL_OFFSET_TEXTURE_MATRIX_NV -#define GL_OFFSET_TEXTURE_2D_SCALE_NV GL_OFFSET_TEXTURE_SCALE_NV -#define GL_OFFSET_TEXTURE_2D_BIAS_NV GL_OFFSET_TEXTURE_BIAS_NV -#define GL_PREVIOUS_TEXTURE_INPUT_NV 0x86E4 -#define GL_CONST_EYE_NV 0x86E5 -#define GL_PASS_THROUGH_NV 0x86E6 -#define GL_CULL_FRAGMENT_NV 0x86E7 -#define GL_OFFSET_TEXTURE_2D_NV 0x86E8 -#define GL_DEPENDENT_AR_TEXTURE_2D_NV 0x86E9 -#define GL_DEPENDENT_GB_TEXTURE_2D_NV 0x86EA -#define GL_DOT_PRODUCT_NV 0x86EC -#define GL_DOT_PRODUCT_DEPTH_REPLACE_NV 0x86ED -#define GL_DOT_PRODUCT_TEXTURE_2D_NV 0x86EE -#define GL_DOT_PRODUCT_TEXTURE_CUBE_MAP_NV 0x86F0 -#define GL_DOT_PRODUCT_DIFFUSE_CUBE_MAP_NV 0x86F1 -#define GL_DOT_PRODUCT_REFLECT_CUBE_MAP_NV 0x86F2 -#define GL_DOT_PRODUCT_CONST_EYE_REFLECT_CUBE_MAP_NV 0x86F3 -#define GL_HILO_NV 0x86F4 -#define GL_DSDT_NV 0x86F5 -#define GL_DSDT_MAG_NV 0x86F6 -#define GL_DSDT_MAG_VIB_NV 0x86F7 -#define GL_HILO16_NV 0x86F8 -#define GL_SIGNED_HILO_NV 0x86F9 -#define GL_SIGNED_HILO16_NV 0x86FA -#define GL_SIGNED_RGBA_NV 0x86FB -#define GL_SIGNED_RGBA8_NV 0x86FC -#define GL_SIGNED_RGB_NV 0x86FE -#define GL_SIGNED_RGB8_NV 0x86FF -#define GL_SIGNED_LUMINANCE_NV 0x8701 -#define GL_SIGNED_LUMINANCE8_NV 0x8702 -#define GL_SIGNED_LUMINANCE_ALPHA_NV 0x8703 -#define GL_SIGNED_LUMINANCE8_ALPHA8_NV 0x8704 -#define GL_SIGNED_ALPHA_NV 0x8705 -#define GL_SIGNED_ALPHA8_NV 0x8706 -#define GL_SIGNED_INTENSITY_NV 0x8707 -#define GL_SIGNED_INTENSITY8_NV 0x8708 -#define GL_DSDT8_NV 0x8709 -#define GL_DSDT8_MAG8_NV 0x870A -#define GL_DSDT8_MAG8_INTENSITY8_NV 0x870B -#define GL_SIGNED_RGB_UNSIGNED_ALPHA_NV 0x870C -#define GL_SIGNED_RGB8_UNSIGNED_ALPHA8_NV 0x870D -#define GL_HI_SCALE_NV 0x870E -#define GL_LO_SCALE_NV 0x870F -#define GL_DS_SCALE_NV 0x8710 -#define GL_DT_SCALE_NV 0x8711 -#define GL_MAGNITUDE_SCALE_NV 0x8712 -#define GL_VIBRANCE_SCALE_NV 0x8713 -#define GL_HI_BIAS_NV 0x8714 -#define GL_LO_BIAS_NV 0x8715 -#define GL_DS_BIAS_NV 0x8716 -#define GL_DT_BIAS_NV 0x8717 -#define GL_MAGNITUDE_BIAS_NV 0x8718 -#define GL_VIBRANCE_BIAS_NV 0x8719 -#define GL_TEXTURE_BORDER_VALUES_NV 0x871A -#define GL_TEXTURE_HI_SIZE_NV 0x871B -#define GL_TEXTURE_LO_SIZE_NV 0x871C -#define GL_TEXTURE_DS_SIZE_NV 0x871D -#define GL_TEXTURE_DT_SIZE_NV 0x871E -#define GL_TEXTURE_MAG_SIZE_NV 0x871F -#endif - -#ifndef GL_NV_texture_shader2 -#define GL_DOT_PRODUCT_TEXTURE_3D_NV 0x86EF -#endif - -#ifndef GL_NV_vertex_array_range2 -#define GL_VERTEX_ARRAY_RANGE_WITHOUT_FLUSH_NV 0x8533 -#endif - -#ifndef GL_NV_vertex_program -#define GL_VERTEX_PROGRAM_NV 0x8620 -#define GL_VERTEX_STATE_PROGRAM_NV 0x8621 -#define GL_ATTRIB_ARRAY_SIZE_NV 0x8623 -#define GL_ATTRIB_ARRAY_STRIDE_NV 0x8624 -#define GL_ATTRIB_ARRAY_TYPE_NV 0x8625 -#define GL_CURRENT_ATTRIB_NV 0x8626 -#define GL_PROGRAM_LENGTH_NV 0x8627 -#define GL_PROGRAM_STRING_NV 0x8628 -#define GL_MODELVIEW_PROJECTION_NV 0x8629 -#define GL_IDENTITY_NV 0x862A -#define GL_INVERSE_NV 0x862B -#define GL_TRANSPOSE_NV 0x862C -#define GL_INVERSE_TRANSPOSE_NV 0x862D -#define GL_MAX_TRACK_MATRIX_STACK_DEPTH_NV 0x862E -#define GL_MAX_TRACK_MATRICES_NV 0x862F -#define GL_MATRIX0_NV 0x8630 -#define GL_MATRIX1_NV 0x8631 -#define GL_MATRIX2_NV 0x8632 -#define GL_MATRIX3_NV 0x8633 -#define GL_MATRIX4_NV 0x8634 -#define GL_MATRIX5_NV 0x8635 -#define GL_MATRIX6_NV 0x8636 -#define GL_MATRIX7_NV 0x8637 -#define GL_CURRENT_MATRIX_STACK_DEPTH_NV 0x8640 -#define GL_CURRENT_MATRIX_NV 0x8641 -#define GL_VERTEX_PROGRAM_POINT_SIZE_NV 0x8642 -#define GL_VERTEX_PROGRAM_TWO_SIDE_NV 0x8643 -#define GL_PROGRAM_PARAMETER_NV 0x8644 -#define GL_ATTRIB_ARRAY_POINTER_NV 0x8645 -#define GL_PROGRAM_TARGET_NV 0x8646 -#define GL_PROGRAM_RESIDENT_NV 0x8647 -#define GL_TRACK_MATRIX_NV 0x8648 -#define GL_TRACK_MATRIX_TRANSFORM_NV 0x8649 -#define GL_VERTEX_PROGRAM_BINDING_NV 0x864A -#define GL_PROGRAM_ERROR_POSITION_NV 0x864B -#define GL_VERTEX_ATTRIB_ARRAY0_NV 0x8650 -#define GL_VERTEX_ATTRIB_ARRAY1_NV 0x8651 -#define GL_VERTEX_ATTRIB_ARRAY2_NV 0x8652 -#define GL_VERTEX_ATTRIB_ARRAY3_NV 0x8653 -#define GL_VERTEX_ATTRIB_ARRAY4_NV 0x8654 -#define GL_VERTEX_ATTRIB_ARRAY5_NV 0x8655 -#define GL_VERTEX_ATTRIB_ARRAY6_NV 0x8656 -#define GL_VERTEX_ATTRIB_ARRAY7_NV 0x8657 -#define GL_VERTEX_ATTRIB_ARRAY8_NV 0x8658 -#define GL_VERTEX_ATTRIB_ARRAY9_NV 0x8659 -#define GL_VERTEX_ATTRIB_ARRAY10_NV 0x865A -#define GL_VERTEX_ATTRIB_ARRAY11_NV 0x865B -#define GL_VERTEX_ATTRIB_ARRAY12_NV 0x865C -#define GL_VERTEX_ATTRIB_ARRAY13_NV 0x865D -#define GL_VERTEX_ATTRIB_ARRAY14_NV 0x865E -#define GL_VERTEX_ATTRIB_ARRAY15_NV 0x865F -#define GL_MAP1_VERTEX_ATTRIB0_4_NV 0x8660 -#define GL_MAP1_VERTEX_ATTRIB1_4_NV 0x8661 -#define GL_MAP1_VERTEX_ATTRIB2_4_NV 0x8662 -#define GL_MAP1_VERTEX_ATTRIB3_4_NV 0x8663 -#define GL_MAP1_VERTEX_ATTRIB4_4_NV 0x8664 -#define GL_MAP1_VERTEX_ATTRIB5_4_NV 0x8665 -#define GL_MAP1_VERTEX_ATTRIB6_4_NV 0x8666 -#define GL_MAP1_VERTEX_ATTRIB7_4_NV 0x8667 -#define GL_MAP1_VERTEX_ATTRIB8_4_NV 0x8668 -#define GL_MAP1_VERTEX_ATTRIB9_4_NV 0x8669 -#define GL_MAP1_VERTEX_ATTRIB10_4_NV 0x866A -#define GL_MAP1_VERTEX_ATTRIB11_4_NV 0x866B -#define GL_MAP1_VERTEX_ATTRIB12_4_NV 0x866C -#define GL_MAP1_VERTEX_ATTRIB13_4_NV 0x866D -#define GL_MAP1_VERTEX_ATTRIB14_4_NV 0x866E -#define GL_MAP1_VERTEX_ATTRIB15_4_NV 0x866F -#define GL_MAP2_VERTEX_ATTRIB0_4_NV 0x8670 -#define GL_MAP2_VERTEX_ATTRIB1_4_NV 0x8671 -#define GL_MAP2_VERTEX_ATTRIB2_4_NV 0x8672 -#define GL_MAP2_VERTEX_ATTRIB3_4_NV 0x8673 -#define GL_MAP2_VERTEX_ATTRIB4_4_NV 0x8674 -#define GL_MAP2_VERTEX_ATTRIB5_4_NV 0x8675 -#define GL_MAP2_VERTEX_ATTRIB6_4_NV 0x8676 -#define GL_MAP2_VERTEX_ATTRIB7_4_NV 0x8677 -#define GL_MAP2_VERTEX_ATTRIB8_4_NV 0x8678 -#define GL_MAP2_VERTEX_ATTRIB9_4_NV 0x8679 -#define GL_MAP2_VERTEX_ATTRIB10_4_NV 0x867A -#define GL_MAP2_VERTEX_ATTRIB11_4_NV 0x867B -#define GL_MAP2_VERTEX_ATTRIB12_4_NV 0x867C -#define GL_MAP2_VERTEX_ATTRIB13_4_NV 0x867D -#define GL_MAP2_VERTEX_ATTRIB14_4_NV 0x867E -#define GL_MAP2_VERTEX_ATTRIB15_4_NV 0x867F -#endif - -#ifndef GL_SGIX_texture_coordinate_clamp -#define GL_TEXTURE_MAX_CLAMP_S_SGIX 0x8369 -#define GL_TEXTURE_MAX_CLAMP_T_SGIX 0x836A -#define GL_TEXTURE_MAX_CLAMP_R_SGIX 0x836B -#endif - -#ifndef GL_SGIX_scalebias_hint -#define GL_SCALEBIAS_HINT_SGIX 0x8322 -#endif - -#ifndef GL_OML_interlace -#define GL_INTERLACE_OML 0x8980 -#define GL_INTERLACE_READ_OML 0x8981 -#endif - -#ifndef GL_OML_subsample -#define GL_FORMAT_SUBSAMPLE_24_24_OML 0x8982 -#define GL_FORMAT_SUBSAMPLE_244_244_OML 0x8983 -#endif - -#ifndef GL_OML_resample -#define GL_PACK_RESAMPLE_OML 0x8984 -#define GL_UNPACK_RESAMPLE_OML 0x8985 -#define GL_RESAMPLE_REPLICATE_OML 0x8986 -#define GL_RESAMPLE_ZERO_FILL_OML 0x8987 -#define GL_RESAMPLE_AVERAGE_OML 0x8988 -#define GL_RESAMPLE_DECIMATE_OML 0x8989 -#endif - -#ifndef GL_NV_copy_depth_to_color -#define GL_DEPTH_STENCIL_TO_RGBA_NV 0x886E -#define GL_DEPTH_STENCIL_TO_BGRA_NV 0x886F -#endif - -#ifndef GL_ATI_envmap_bumpmap -#define GL_BUMP_ROT_MATRIX_ATI 0x8775 -#define GL_BUMP_ROT_MATRIX_SIZE_ATI 0x8776 -#define GL_BUMP_NUM_TEX_UNITS_ATI 0x8777 -#define GL_BUMP_TEX_UNITS_ATI 0x8778 -#define GL_DUDV_ATI 0x8779 -#define GL_DU8DV8_ATI 0x877A -#define GL_BUMP_ENVMAP_ATI 0x877B -#define GL_BUMP_TARGET_ATI 0x877C -#endif - -#ifndef GL_ATI_fragment_shader -#define GL_FRAGMENT_SHADER_ATI 0x8920 -#define GL_REG_0_ATI 0x8921 -#define GL_REG_1_ATI 0x8922 -#define GL_REG_2_ATI 0x8923 -#define GL_REG_3_ATI 0x8924 -#define GL_REG_4_ATI 0x8925 -#define GL_REG_5_ATI 0x8926 -#define GL_REG_6_ATI 0x8927 -#define GL_REG_7_ATI 0x8928 -#define GL_REG_8_ATI 0x8929 -#define GL_REG_9_ATI 0x892A -#define GL_REG_10_ATI 0x892B -#define GL_REG_11_ATI 0x892C -#define GL_REG_12_ATI 0x892D -#define GL_REG_13_ATI 0x892E -#define GL_REG_14_ATI 0x892F -#define GL_REG_15_ATI 0x8930 -#define GL_REG_16_ATI 0x8931 -#define GL_REG_17_ATI 0x8932 -#define GL_REG_18_ATI 0x8933 -#define GL_REG_19_ATI 0x8934 -#define GL_REG_20_ATI 0x8935 -#define GL_REG_21_ATI 0x8936 -#define GL_REG_22_ATI 0x8937 -#define GL_REG_23_ATI 0x8938 -#define GL_REG_24_ATI 0x8939 -#define GL_REG_25_ATI 0x893A -#define GL_REG_26_ATI 0x893B -#define GL_REG_27_ATI 0x893C -#define GL_REG_28_ATI 0x893D -#define GL_REG_29_ATI 0x893E -#define GL_REG_30_ATI 0x893F -#define GL_REG_31_ATI 0x8940 -#define GL_CON_0_ATI 0x8941 -#define GL_CON_1_ATI 0x8942 -#define GL_CON_2_ATI 0x8943 -#define GL_CON_3_ATI 0x8944 -#define GL_CON_4_ATI 0x8945 -#define GL_CON_5_ATI 0x8946 -#define GL_CON_6_ATI 0x8947 -#define GL_CON_7_ATI 0x8948 -#define GL_CON_8_ATI 0x8949 -#define GL_CON_9_ATI 0x894A -#define GL_CON_10_ATI 0x894B -#define GL_CON_11_ATI 0x894C -#define GL_CON_12_ATI 0x894D -#define GL_CON_13_ATI 0x894E -#define GL_CON_14_ATI 0x894F -#define GL_CON_15_ATI 0x8950 -#define GL_CON_16_ATI 0x8951 -#define GL_CON_17_ATI 0x8952 -#define GL_CON_18_ATI 0x8953 -#define GL_CON_19_ATI 0x8954 -#define GL_CON_20_ATI 0x8955 -#define GL_CON_21_ATI 0x8956 -#define GL_CON_22_ATI 0x8957 -#define GL_CON_23_ATI 0x8958 -#define GL_CON_24_ATI 0x8959 -#define GL_CON_25_ATI 0x895A -#define GL_CON_26_ATI 0x895B -#define GL_CON_27_ATI 0x895C -#define GL_CON_28_ATI 0x895D -#define GL_CON_29_ATI 0x895E -#define GL_CON_30_ATI 0x895F -#define GL_CON_31_ATI 0x8960 -#define GL_MOV_ATI 0x8961 -#define GL_ADD_ATI 0x8963 -#define GL_MUL_ATI 0x8964 -#define GL_SUB_ATI 0x8965 -#define GL_DOT3_ATI 0x8966 -#define GL_DOT4_ATI 0x8967 -#define GL_MAD_ATI 0x8968 -#define GL_LERP_ATI 0x8969 -#define GL_CND_ATI 0x896A -#define GL_CND0_ATI 0x896B -#define GL_DOT2_ADD_ATI 0x896C -#define GL_SECONDARY_INTERPOLATOR_ATI 0x896D -#define GL_NUM_FRAGMENT_REGISTERS_ATI 0x896E -#define GL_NUM_FRAGMENT_CONSTANTS_ATI 0x896F -#define GL_NUM_PASSES_ATI 0x8970 -#define GL_NUM_INSTRUCTIONS_PER_PASS_ATI 0x8971 -#define GL_NUM_INSTRUCTIONS_TOTAL_ATI 0x8972 -#define GL_NUM_INPUT_INTERPOLATOR_COMPONENTS_ATI 0x8973 -#define GL_NUM_LOOPBACK_COMPONENTS_ATI 0x8974 -#define GL_COLOR_ALPHA_PAIRING_ATI 0x8975 -#define GL_SWIZZLE_STR_ATI 0x8976 -#define GL_SWIZZLE_STQ_ATI 0x8977 -#define GL_SWIZZLE_STR_DR_ATI 0x8978 -#define GL_SWIZZLE_STQ_DQ_ATI 0x8979 -#define GL_SWIZZLE_STRQ_ATI 0x897A -#define GL_SWIZZLE_STRQ_DQ_ATI 0x897B -#define GL_RED_BIT_ATI 0x00000001 -#define GL_GREEN_BIT_ATI 0x00000002 -#define GL_BLUE_BIT_ATI 0x00000004 -#define GL_2X_BIT_ATI 0x00000001 -#define GL_4X_BIT_ATI 0x00000002 -#define GL_8X_BIT_ATI 0x00000004 -#define GL_HALF_BIT_ATI 0x00000008 -#define GL_QUARTER_BIT_ATI 0x00000010 -#define GL_EIGHTH_BIT_ATI 0x00000020 -#define GL_SATURATE_BIT_ATI 0x00000040 -#define GL_COMP_BIT_ATI 0x00000002 -#define GL_NEGATE_BIT_ATI 0x00000004 -#define GL_BIAS_BIT_ATI 0x00000008 -#endif - -#ifndef GL_ATI_pn_triangles -#define GL_PN_TRIANGLES_ATI 0x87F0 -#define GL_MAX_PN_TRIANGLES_TESSELATION_LEVEL_ATI 0x87F1 -#define GL_PN_TRIANGLES_POINT_MODE_ATI 0x87F2 -#define GL_PN_TRIANGLES_NORMAL_MODE_ATI 0x87F3 -#define GL_PN_TRIANGLES_TESSELATION_LEVEL_ATI 0x87F4 -#define GL_PN_TRIANGLES_POINT_MODE_LINEAR_ATI 0x87F5 -#define GL_PN_TRIANGLES_POINT_MODE_CUBIC_ATI 0x87F6 -#define GL_PN_TRIANGLES_NORMAL_MODE_LINEAR_ATI 0x87F7 -#define GL_PN_TRIANGLES_NORMAL_MODE_QUADRATIC_ATI 0x87F8 -#endif - -#ifndef GL_ATI_vertex_array_object -#define GL_STATIC_ATI 0x8760 -#define GL_DYNAMIC_ATI 0x8761 -#define GL_PRESERVE_ATI 0x8762 -#define GL_DISCARD_ATI 0x8763 -#define GL_OBJECT_BUFFER_SIZE_ATI 0x8764 -#define GL_OBJECT_BUFFER_USAGE_ATI 0x8765 -#define GL_ARRAY_OBJECT_BUFFER_ATI 0x8766 -#define GL_ARRAY_OBJECT_OFFSET_ATI 0x8767 -#endif - -#ifndef GL_EXT_vertex_shader -#define GL_VERTEX_SHADER_EXT 0x8780 -#define GL_VERTEX_SHADER_BINDING_EXT 0x8781 -#define GL_OP_INDEX_EXT 0x8782 -#define GL_OP_NEGATE_EXT 0x8783 -#define GL_OP_DOT3_EXT 0x8784 -#define GL_OP_DOT4_EXT 0x8785 -#define GL_OP_MUL_EXT 0x8786 -#define GL_OP_ADD_EXT 0x8787 -#define GL_OP_MADD_EXT 0x8788 -#define GL_OP_FRAC_EXT 0x8789 -#define GL_OP_MAX_EXT 0x878A -#define GL_OP_MIN_EXT 0x878B -#define GL_OP_SET_GE_EXT 0x878C -#define GL_OP_SET_LT_EXT 0x878D -#define GL_OP_CLAMP_EXT 0x878E -#define GL_OP_FLOOR_EXT 0x878F -#define GL_OP_ROUND_EXT 0x8790 -#define GL_OP_EXP_BASE_2_EXT 0x8791 -#define GL_OP_LOG_BASE_2_EXT 0x8792 -#define GL_OP_POWER_EXT 0x8793 -#define GL_OP_RECIP_EXT 0x8794 -#define GL_OP_RECIP_SQRT_EXT 0x8795 -#define GL_OP_SUB_EXT 0x8796 -#define GL_OP_CROSS_PRODUCT_EXT 0x8797 -#define GL_OP_MULTIPLY_MATRIX_EXT 0x8798 -#define GL_OP_MOV_EXT 0x8799 -#define GL_OUTPUT_VERTEX_EXT 0x879A -#define GL_OUTPUT_COLOR0_EXT 0x879B -#define GL_OUTPUT_COLOR1_EXT 0x879C -#define GL_OUTPUT_TEXTURE_COORD0_EXT 0x879D -#define GL_OUTPUT_TEXTURE_COORD1_EXT 0x879E -#define GL_OUTPUT_TEXTURE_COORD2_EXT 0x879F -#define GL_OUTPUT_TEXTURE_COORD3_EXT 0x87A0 -#define GL_OUTPUT_TEXTURE_COORD4_EXT 0x87A1 -#define GL_OUTPUT_TEXTURE_COORD5_EXT 0x87A2 -#define GL_OUTPUT_TEXTURE_COORD6_EXT 0x87A3 -#define GL_OUTPUT_TEXTURE_COORD7_EXT 0x87A4 -#define GL_OUTPUT_TEXTURE_COORD8_EXT 0x87A5 -#define GL_OUTPUT_TEXTURE_COORD9_EXT 0x87A6 -#define GL_OUTPUT_TEXTURE_COORD10_EXT 0x87A7 -#define GL_OUTPUT_TEXTURE_COORD11_EXT 0x87A8 -#define GL_OUTPUT_TEXTURE_COORD12_EXT 0x87A9 -#define GL_OUTPUT_TEXTURE_COORD13_EXT 0x87AA -#define GL_OUTPUT_TEXTURE_COORD14_EXT 0x87AB -#define GL_OUTPUT_TEXTURE_COORD15_EXT 0x87AC -#define GL_OUTPUT_TEXTURE_COORD16_EXT 0x87AD -#define GL_OUTPUT_TEXTURE_COORD17_EXT 0x87AE -#define GL_OUTPUT_TEXTURE_COORD18_EXT 0x87AF -#define GL_OUTPUT_TEXTURE_COORD19_EXT 0x87B0 -#define GL_OUTPUT_TEXTURE_COORD20_EXT 0x87B1 -#define GL_OUTPUT_TEXTURE_COORD21_EXT 0x87B2 -#define GL_OUTPUT_TEXTURE_COORD22_EXT 0x87B3 -#define GL_OUTPUT_TEXTURE_COORD23_EXT 0x87B4 -#define GL_OUTPUT_TEXTURE_COORD24_EXT 0x87B5 -#define GL_OUTPUT_TEXTURE_COORD25_EXT 0x87B6 -#define GL_OUTPUT_TEXTURE_COORD26_EXT 0x87B7 -#define GL_OUTPUT_TEXTURE_COORD27_EXT 0x87B8 -#define GL_OUTPUT_TEXTURE_COORD28_EXT 0x87B9 -#define GL_OUTPUT_TEXTURE_COORD29_EXT 0x87BA -#define GL_OUTPUT_TEXTURE_COORD30_EXT 0x87BB -#define GL_OUTPUT_TEXTURE_COORD31_EXT 0x87BC -#define GL_OUTPUT_FOG_EXT 0x87BD -#define GL_SCALAR_EXT 0x87BE -#define GL_VECTOR_EXT 0x87BF -#define GL_MATRIX_EXT 0x87C0 -#define GL_VARIANT_EXT 0x87C1 -#define GL_INVARIANT_EXT 0x87C2 -#define GL_LOCAL_CONSTANT_EXT 0x87C3 -#define GL_LOCAL_EXT 0x87C4 -#define GL_MAX_VERTEX_SHADER_INSTRUCTIONS_EXT 0x87C5 -#define GL_MAX_VERTEX_SHADER_VARIANTS_EXT 0x87C6 -#define GL_MAX_VERTEX_SHADER_INVARIANTS_EXT 0x87C7 -#define GL_MAX_VERTEX_SHADER_LOCAL_CONSTANTS_EXT 0x87C8 -#define GL_MAX_VERTEX_SHADER_LOCALS_EXT 0x87C9 -#define GL_MAX_OPTIMIZED_VERTEX_SHADER_INSTRUCTIONS_EXT 0x87CA -#define GL_MAX_OPTIMIZED_VERTEX_SHADER_VARIANTS_EXT 0x87CB -#define GL_MAX_OPTIMIZED_VERTEX_SHADER_LOCAL_CONSTANTS_EXT 0x87CC -#define GL_MAX_OPTIMIZED_VERTEX_SHADER_INVARIANTS_EXT 0x87CD -#define GL_MAX_OPTIMIZED_VERTEX_SHADER_LOCALS_EXT 0x87CE -#define GL_VERTEX_SHADER_INSTRUCTIONS_EXT 0x87CF -#define GL_VERTEX_SHADER_VARIANTS_EXT 0x87D0 -#define GL_VERTEX_SHADER_INVARIANTS_EXT 0x87D1 -#define GL_VERTEX_SHADER_LOCAL_CONSTANTS_EXT 0x87D2 -#define GL_VERTEX_SHADER_LOCALS_EXT 0x87D3 -#define GL_VERTEX_SHADER_OPTIMIZED_EXT 0x87D4 -#define GL_X_EXT 0x87D5 -#define GL_Y_EXT 0x87D6 -#define GL_Z_EXT 0x87D7 -#define GL_W_EXT 0x87D8 -#define GL_NEGATIVE_X_EXT 0x87D9 -#define GL_NEGATIVE_Y_EXT 0x87DA -#define GL_NEGATIVE_Z_EXT 0x87DB -#define GL_NEGATIVE_W_EXT 0x87DC -#define GL_ZERO_EXT 0x87DD -#define GL_ONE_EXT 0x87DE -#define GL_NEGATIVE_ONE_EXT 0x87DF -#define GL_NORMALIZED_RANGE_EXT 0x87E0 -#define GL_FULL_RANGE_EXT 0x87E1 -#define GL_CURRENT_VERTEX_EXT 0x87E2 -#define GL_MVP_MATRIX_EXT 0x87E3 -#define GL_VARIANT_VALUE_EXT 0x87E4 -#define GL_VARIANT_DATATYPE_EXT 0x87E5 -#define GL_VARIANT_ARRAY_STRIDE_EXT 0x87E6 -#define GL_VARIANT_ARRAY_TYPE_EXT 0x87E7 -#define GL_VARIANT_ARRAY_EXT 0x87E8 -#define GL_VARIANT_ARRAY_POINTER_EXT 0x87E9 -#define GL_INVARIANT_VALUE_EXT 0x87EA -#define GL_INVARIANT_DATATYPE_EXT 0x87EB -#define GL_LOCAL_CONSTANT_VALUE_EXT 0x87EC -#define GL_LOCAL_CONSTANT_DATATYPE_EXT 0x87ED -#endif - -#ifndef GL_ATI_vertex_streams -#define GL_MAX_VERTEX_STREAMS_ATI 0x876B -#define GL_VERTEX_STREAM0_ATI 0x876C -#define GL_VERTEX_STREAM1_ATI 0x876D -#define GL_VERTEX_STREAM2_ATI 0x876E -#define GL_VERTEX_STREAM3_ATI 0x876F -#define GL_VERTEX_STREAM4_ATI 0x8770 -#define GL_VERTEX_STREAM5_ATI 0x8771 -#define GL_VERTEX_STREAM6_ATI 0x8772 -#define GL_VERTEX_STREAM7_ATI 0x8773 -#define GL_VERTEX_SOURCE_ATI 0x8774 -#endif - -#ifndef GL_ATI_element_array -#define GL_ELEMENT_ARRAY_ATI 0x8768 -#define GL_ELEMENT_ARRAY_TYPE_ATI 0x8769 -#define GL_ELEMENT_ARRAY_POINTER_ATI 0x876A -#endif - -#ifndef GL_SUN_mesh_array -#define GL_QUAD_MESH_SUN 0x8614 -#define GL_TRIANGLE_MESH_SUN 0x8615 -#endif - -#ifndef GL_SUN_slice_accum -#define GL_SLICE_ACCUM_SUN 0x85CC -#endif - -#ifndef GL_NV_multisample_filter_hint -#define GL_MULTISAMPLE_FILTER_HINT_NV 0x8534 -#endif - -#ifndef GL_NV_depth_clamp -#define GL_DEPTH_CLAMP_NV 0x864F -#endif - -#ifndef GL_NV_occlusion_query -#define GL_PIXEL_COUNTER_BITS_NV 0x8864 -#define GL_CURRENT_OCCLUSION_QUERY_ID_NV 0x8865 -#define GL_PIXEL_COUNT_NV 0x8866 -#define GL_PIXEL_COUNT_AVAILABLE_NV 0x8867 -#endif - -#ifndef GL_NV_point_sprite -#define GL_POINT_SPRITE_NV 0x8861 -#define GL_COORD_REPLACE_NV 0x8862 -#define GL_POINT_SPRITE_R_MODE_NV 0x8863 -#endif - -#ifndef GL_NV_texture_shader3 -#define GL_OFFSET_PROJECTIVE_TEXTURE_2D_NV 0x8850 -#define GL_OFFSET_PROJECTIVE_TEXTURE_2D_SCALE_NV 0x8851 -#define GL_OFFSET_PROJECTIVE_TEXTURE_RECTANGLE_NV 0x8852 -#define GL_OFFSET_PROJECTIVE_TEXTURE_RECTANGLE_SCALE_NV 0x8853 -#define GL_OFFSET_HILO_TEXTURE_2D_NV 0x8854 -#define GL_OFFSET_HILO_TEXTURE_RECTANGLE_NV 0x8855 -#define GL_OFFSET_HILO_PROJECTIVE_TEXTURE_2D_NV 0x8856 -#define GL_OFFSET_HILO_PROJECTIVE_TEXTURE_RECTANGLE_NV 0x8857 -#define GL_DEPENDENT_HILO_TEXTURE_2D_NV 0x8858 -#define GL_DEPENDENT_RGB_TEXTURE_3D_NV 0x8859 -#define GL_DEPENDENT_RGB_TEXTURE_CUBE_MAP_NV 0x885A -#define GL_DOT_PRODUCT_PASS_THROUGH_NV 0x885B -#define GL_DOT_PRODUCT_TEXTURE_1D_NV 0x885C -#define GL_DOT_PRODUCT_AFFINE_DEPTH_REPLACE_NV 0x885D -#define GL_HILO8_NV 0x885E -#define GL_SIGNED_HILO8_NV 0x885F -#define GL_FORCE_BLUE_TO_ONE_NV 0x8860 -#endif - -#ifndef GL_NV_vertex_program1_1 -#endif - -#ifndef GL_EXT_shadow_funcs -#endif - -#ifndef GL_EXT_stencil_two_side -#define GL_STENCIL_TEST_TWO_SIDE_EXT 0x8910 -#define GL_ACTIVE_STENCIL_FACE_EXT 0x8911 -#endif - -#ifndef GL_ATI_text_fragment_shader -#define GL_TEXT_FRAGMENT_SHADER_ATI 0x8200 -#endif - -#ifndef GL_APPLE_client_storage -#define GL_UNPACK_CLIENT_STORAGE_APPLE 0x85B2 -#endif - -#ifndef GL_APPLE_element_array -#define GL_ELEMENT_ARRAY_APPLE 0x8768 -#define GL_ELEMENT_ARRAY_TYPE_APPLE 0x8769 -#define GL_ELEMENT_ARRAY_POINTER_APPLE 0x876A -#endif - -#ifndef GL_APPLE_fence -#define GL_DRAW_PIXELS_APPLE 0x8A0A -#define GL_FENCE_APPLE 0x8A0B -#endif - -#ifndef GL_APPLE_vertex_array_object -#define GL_VERTEX_ARRAY_BINDING_APPLE 0x85B5 -#endif - -#ifndef GL_APPLE_vertex_array_range -#define GL_VERTEX_ARRAY_RANGE_APPLE 0x851D -#define GL_VERTEX_ARRAY_RANGE_LENGTH_APPLE 0x851E -#define GL_VERTEX_ARRAY_STORAGE_HINT_APPLE 0x851F -#define GL_VERTEX_ARRAY_RANGE_POINTER_APPLE 0x8521 -#define GL_STORAGE_CACHED_APPLE 0x85BE -#define GL_STORAGE_SHARED_APPLE 0x85BF -#endif - -#ifndef GL_APPLE_ycbcr_422 -#define GL_YCBCR_422_APPLE 0x85B9 -#define GL_UNSIGNED_SHORT_8_8_APPLE 0x85BA -#define GL_UNSIGNED_SHORT_8_8_REV_APPLE 0x85BB -#endif - -#ifndef GL_S3_s3tc -#define GL_RGB_S3TC 0x83A0 -#define GL_RGB4_S3TC 0x83A1 -#define GL_RGBA_S3TC 0x83A2 -#define GL_RGBA4_S3TC 0x83A3 -#endif - -#ifndef GL_ATI_draw_buffers -#define GL_MAX_DRAW_BUFFERS_ATI 0x8824 -#define GL_DRAW_BUFFER0_ATI 0x8825 -#define GL_DRAW_BUFFER1_ATI 0x8826 -#define GL_DRAW_BUFFER2_ATI 0x8827 -#define GL_DRAW_BUFFER3_ATI 0x8828 -#define GL_DRAW_BUFFER4_ATI 0x8829 -#define GL_DRAW_BUFFER5_ATI 0x882A -#define GL_DRAW_BUFFER6_ATI 0x882B -#define GL_DRAW_BUFFER7_ATI 0x882C -#define GL_DRAW_BUFFER8_ATI 0x882D -#define GL_DRAW_BUFFER9_ATI 0x882E -#define GL_DRAW_BUFFER10_ATI 0x882F -#define GL_DRAW_BUFFER11_ATI 0x8830 -#define GL_DRAW_BUFFER12_ATI 0x8831 -#define GL_DRAW_BUFFER13_ATI 0x8832 -#define GL_DRAW_BUFFER14_ATI 0x8833 -#define GL_DRAW_BUFFER15_ATI 0x8834 -#endif - -#ifndef GL_ATI_pixel_format_float -#define GL_TYPE_RGBA_FLOAT_ATI 0x8820 -#define GL_COLOR_CLEAR_UNCLAMPED_VALUE_ATI 0x8835 -#endif - -#ifndef GL_ATI_texture_env_combine3 -#define GL_MODULATE_ADD_ATI 0x8744 -#define GL_MODULATE_SIGNED_ADD_ATI 0x8745 -#define GL_MODULATE_SUBTRACT_ATI 0x8746 -#endif - -#ifndef GL_ATI_texture_float -#define GL_RGBA_FLOAT32_ATI 0x8814 -#define GL_RGB_FLOAT32_ATI 0x8815 -#define GL_ALPHA_FLOAT32_ATI 0x8816 -#define GL_INTENSITY_FLOAT32_ATI 0x8817 -#define GL_LUMINANCE_FLOAT32_ATI 0x8818 -#define GL_LUMINANCE_ALPHA_FLOAT32_ATI 0x8819 -#define GL_RGBA_FLOAT16_ATI 0x881A -#define GL_RGB_FLOAT16_ATI 0x881B -#define GL_ALPHA_FLOAT16_ATI 0x881C -#define GL_INTENSITY_FLOAT16_ATI 0x881D -#define GL_LUMINANCE_FLOAT16_ATI 0x881E -#define GL_LUMINANCE_ALPHA_FLOAT16_ATI 0x881F -#endif - -#ifndef GL_NV_float_buffer -#define GL_FLOAT_R_NV 0x8880 -#define GL_FLOAT_RG_NV 0x8881 -#define GL_FLOAT_RGB_NV 0x8882 -#define GL_FLOAT_RGBA_NV 0x8883 -#define GL_FLOAT_R16_NV 0x8884 -#define GL_FLOAT_R32_NV 0x8885 -#define GL_FLOAT_RG16_NV 0x8886 -#define GL_FLOAT_RG32_NV 0x8887 -#define GL_FLOAT_RGB16_NV 0x8888 -#define GL_FLOAT_RGB32_NV 0x8889 -#define GL_FLOAT_RGBA16_NV 0x888A -#define GL_FLOAT_RGBA32_NV 0x888B -#define GL_TEXTURE_FLOAT_COMPONENTS_NV 0x888C -#define GL_FLOAT_CLEAR_COLOR_VALUE_NV 0x888D -#define GL_FLOAT_RGBA_MODE_NV 0x888E -#endif - -#ifndef GL_NV_fragment_program -#define GL_MAX_FRAGMENT_PROGRAM_LOCAL_PARAMETERS_NV 0x8868 -#define GL_FRAGMENT_PROGRAM_NV 0x8870 -#define GL_MAX_TEXTURE_COORDS_NV 0x8871 -#define GL_MAX_TEXTURE_IMAGE_UNITS_NV 0x8872 -#define GL_FRAGMENT_PROGRAM_BINDING_NV 0x8873 -#define GL_PROGRAM_ERROR_STRING_NV 0x8874 -#endif - -#ifndef GL_NV_half_float -#define GL_HALF_FLOAT_NV 0x140B -#endif - -#ifndef GL_NV_pixel_data_range -#define GL_WRITE_PIXEL_DATA_RANGE_NV 0x8878 -#define GL_READ_PIXEL_DATA_RANGE_NV 0x8879 -#define GL_WRITE_PIXEL_DATA_RANGE_LENGTH_NV 0x887A -#define GL_READ_PIXEL_DATA_RANGE_LENGTH_NV 0x887B -#define GL_WRITE_PIXEL_DATA_RANGE_POINTER_NV 0x887C -#define GL_READ_PIXEL_DATA_RANGE_POINTER_NV 0x887D -#endif - -#ifndef GL_NV_primitive_restart -#define GL_PRIMITIVE_RESTART_NV 0x8558 -#define GL_PRIMITIVE_RESTART_INDEX_NV 0x8559 -#endif - -#ifndef GL_NV_texture_expand_normal -#define GL_TEXTURE_UNSIGNED_REMAP_MODE_NV 0x888F -#endif - -#ifndef GL_NV_vertex_program2 -#endif - -#ifndef GL_ATI_map_object_buffer -#endif - -#ifndef GL_ATI_separate_stencil -#define GL_STENCIL_BACK_FUNC_ATI 0x8800 -#define GL_STENCIL_BACK_FAIL_ATI 0x8801 -#define GL_STENCIL_BACK_PASS_DEPTH_FAIL_ATI 0x8802 -#define GL_STENCIL_BACK_PASS_DEPTH_PASS_ATI 0x8803 -#endif - -#ifndef GL_ATI_vertex_attrib_array_object -#endif - -#ifndef GL_OES_read_format -#define GL_IMPLEMENTATION_COLOR_READ_TYPE_OES 0x8B9A -#define GL_IMPLEMENTATION_COLOR_READ_FORMAT_OES 0x8B9B -#endif - -#ifndef GL_EXT_depth_bounds_test -#define GL_DEPTH_BOUNDS_TEST_EXT 0x8890 -#define GL_DEPTH_BOUNDS_EXT 0x8891 -#endif - -#ifndef GL_EXT_texture_mirror_clamp -#define GL_MIRROR_CLAMP_EXT 0x8742 -#define GL_MIRROR_CLAMP_TO_EDGE_EXT 0x8743 -#define GL_MIRROR_CLAMP_TO_BORDER_EXT 0x8912 -#endif - -#ifndef GL_EXT_blend_equation_separate -#define GL_BLEND_EQUATION_RGB_EXT GL_BLEND_EQUATION -#define GL_BLEND_EQUATION_ALPHA_EXT 0x883D -#endif - -#ifndef GL_MESA_pack_invert -#define GL_PACK_INVERT_MESA 0x8758 -#endif - -#ifndef GL_MESA_ycbcr_texture -#define GL_UNSIGNED_SHORT_8_8_MESA 0x85BA -#define GL_UNSIGNED_SHORT_8_8_REV_MESA 0x85BB -#define GL_YCBCR_MESA 0x8757 -#endif - -#ifndef GL_EXT_pixel_buffer_object -#define GL_PIXEL_PACK_BUFFER_EXT 0x88EB -#define GL_PIXEL_UNPACK_BUFFER_EXT 0x88EC -#define GL_PIXEL_PACK_BUFFER_BINDING_EXT 0x88ED -#define GL_PIXEL_UNPACK_BUFFER_BINDING_EXT 0x88EF -#endif - -#ifndef GL_NV_fragment_program_option -#endif - -#ifndef GL_NV_fragment_program2 -#define GL_MAX_PROGRAM_EXEC_INSTRUCTIONS_NV 0x88F4 -#define GL_MAX_PROGRAM_CALL_DEPTH_NV 0x88F5 -#define GL_MAX_PROGRAM_IF_DEPTH_NV 0x88F6 -#define GL_MAX_PROGRAM_LOOP_DEPTH_NV 0x88F7 -#define GL_MAX_PROGRAM_LOOP_COUNT_NV 0x88F8 -#endif - -#ifndef GL_NV_vertex_program2_option -/* reuse GL_MAX_PROGRAM_EXEC_INSTRUCTIONS_NV */ -/* reuse GL_MAX_PROGRAM_CALL_DEPTH_NV */ -#endif - -#ifndef GL_NV_vertex_program3 -/* reuse GL_MAX_VERTEX_TEXTURE_IMAGE_UNITS_ARB */ -#endif - -#ifndef GL_EXT_framebuffer_object -#define GL_INVALID_FRAMEBUFFER_OPERATION_EXT 0x0506 -#define GL_MAX_RENDERBUFFER_SIZE_EXT 0x84E8 -#define GL_FRAMEBUFFER_BINDING_EXT 0x8CA6 -#define GL_RENDERBUFFER_BINDING_EXT 0x8CA7 -#define GL_FRAMEBUFFER_ATTACHMENT_OBJECT_TYPE_EXT 0x8CD0 -#define GL_FRAMEBUFFER_ATTACHMENT_OBJECT_NAME_EXT 0x8CD1 -#define GL_FRAMEBUFFER_ATTACHMENT_TEXTURE_LEVEL_EXT 0x8CD2 -#define GL_FRAMEBUFFER_ATTACHMENT_TEXTURE_CUBE_MAP_FACE_EXT 0x8CD3 -#define GL_FRAMEBUFFER_ATTACHMENT_TEXTURE_3D_ZOFFSET_EXT 0x8CD4 -#define GL_FRAMEBUFFER_COMPLETE_EXT 0x8CD5 -#define GL_FRAMEBUFFER_INCOMPLETE_ATTACHMENT_EXT 0x8CD6 -#define GL_FRAMEBUFFER_INCOMPLETE_MISSING_ATTACHMENT_EXT 0x8CD7 -#define GL_FRAMEBUFFER_INCOMPLETE_DUPLICATE_ATTACHMENT_EXT 0x8CD8 -#define GL_FRAMEBUFFER_INCOMPLETE_DIMENSIONS_EXT 0x8CD9 -#define GL_FRAMEBUFFER_INCOMPLETE_FORMATS_EXT 0x8CDA -#define GL_FRAMEBUFFER_INCOMPLETE_DRAW_BUFFER_EXT 0x8CDB -#define GL_FRAMEBUFFER_INCOMPLETE_READ_BUFFER_EXT 0x8CDC -#define GL_FRAMEBUFFER_UNSUPPORTED_EXT 0x8CDD -#define GL_MAX_COLOR_ATTACHMENTS_EXT 0x8CDF -#define GL_COLOR_ATTACHMENT0_EXT 0x8CE0 -#define GL_COLOR_ATTACHMENT1_EXT 0x8CE1 -#define GL_COLOR_ATTACHMENT2_EXT 0x8CE2 -#define GL_COLOR_ATTACHMENT3_EXT 0x8CE3 -#define GL_COLOR_ATTACHMENT4_EXT 0x8CE4 -#define GL_COLOR_ATTACHMENT5_EXT 0x8CE5 -#define GL_COLOR_ATTACHMENT6_EXT 0x8CE6 -#define GL_COLOR_ATTACHMENT7_EXT 0x8CE7 -#define GL_COLOR_ATTACHMENT8_EXT 0x8CE8 -#define GL_COLOR_ATTACHMENT9_EXT 0x8CE9 -#define GL_COLOR_ATTACHMENT10_EXT 0x8CEA -#define GL_COLOR_ATTACHMENT11_EXT 0x8CEB -#define GL_COLOR_ATTACHMENT12_EXT 0x8CEC -#define GL_COLOR_ATTACHMENT13_EXT 0x8CED -#define GL_COLOR_ATTACHMENT14_EXT 0x8CEE -#define GL_COLOR_ATTACHMENT15_EXT 0x8CEF -#define GL_DEPTH_ATTACHMENT_EXT 0x8D00 -#define GL_STENCIL_ATTACHMENT_EXT 0x8D20 -#define GL_FRAMEBUFFER_EXT 0x8D40 -#define GL_RENDERBUFFER_EXT 0x8D41 -#define GL_RENDERBUFFER_WIDTH_EXT 0x8D42 -#define GL_RENDERBUFFER_HEIGHT_EXT 0x8D43 -#define GL_RENDERBUFFER_INTERNAL_FORMAT_EXT 0x8D44 -#define GL_STENCIL_INDEX1_EXT 0x8D46 -#define GL_STENCIL_INDEX4_EXT 0x8D47 -#define GL_STENCIL_INDEX8_EXT 0x8D48 -#define GL_STENCIL_INDEX16_EXT 0x8D49 -#define GL_RENDERBUFFER_RED_SIZE_EXT 0x8D50 -#define GL_RENDERBUFFER_GREEN_SIZE_EXT 0x8D51 -#define GL_RENDERBUFFER_BLUE_SIZE_EXT 0x8D52 -#define GL_RENDERBUFFER_ALPHA_SIZE_EXT 0x8D53 -#define GL_RENDERBUFFER_DEPTH_SIZE_EXT 0x8D54 -#define GL_RENDERBUFFER_STENCIL_SIZE_EXT 0x8D55 -#endif - -#ifndef GL_GREMEDY_string_marker -#endif - - -/*************************************************************/ - -#include -#ifndef GL_VERSION_2_0 -/* GL type for program/shader text */ -typedef char GLchar; /* native character */ -#endif - -#ifndef GL_VERSION_1_5 -/* GL types for handling large vertex buffer objects */ -#ifdef __APPLE__ -typedef long GLintptr; -typedef long GLsizeiptr; -#else -typedef ptrdiff_t GLintptr; -typedef ptrdiff_t GLsizeiptr; -#endif -#endif - -#ifndef GL_ARB_vertex_buffer_object -/* GL types for handling large vertex buffer objects */ -#ifdef __APPLE__ -typedef long GLintptrARB; -typedef long GLsizeiptrARB; -#else -typedef ptrdiff_t GLintptrARB; -typedef ptrdiff_t GLsizeiptrARB; -#endif -#endif - -#ifndef GL_ARB_shader_objects -/* GL types for handling shader object handles and program/shader text */ -typedef char GLcharARB; /* native character */ -#if defined(__APPLE__) -typedef void *GLhandleARB; /* shader object handle */ -#else -typedef unsigned int GLhandleARB; /* shader object handle */ -#endif -#endif - -/* GL types for "half" precision (s10e5) float data in host memory */ -#ifndef GL_ARB_half_float_pixel -typedef unsigned short GLhalfARB; -#endif - -#ifndef GL_NV_half_float -typedef unsigned short GLhalfNV; -#endif - -#ifndef GL_VERSION_1_2 -#define GL_VERSION_1_2 1 -#ifdef GL_GLEXT_PROTOTYPES -GLAPI void APIENTRY glBlendColor (GLclampf, GLclampf, GLclampf, GLclampf); -GLAPI void APIENTRY glBlendEquation (GLenum); -GLAPI void APIENTRY glDrawRangeElements (GLenum, GLuint, GLuint, GLsizei, GLenum, const GLvoid *); -GLAPI void APIENTRY glColorTable (GLenum, GLenum, GLsizei, GLenum, GLenum, const GLvoid *); -GLAPI void APIENTRY glColorTableParameterfv (GLenum, GLenum, const GLfloat *); -GLAPI void APIENTRY glColorTableParameteriv (GLenum, GLenum, const GLint *); -GLAPI void APIENTRY glCopyColorTable (GLenum, GLenum, GLint, GLint, GLsizei); -GLAPI void APIENTRY glGetColorTable (GLenum, GLenum, GLenum, GLvoid *); -GLAPI void APIENTRY glGetColorTableParameterfv (GLenum, GLenum, GLfloat *); -GLAPI void APIENTRY glGetColorTableParameteriv (GLenum, GLenum, GLint *); -GLAPI void APIENTRY glColorSubTable (GLenum, GLsizei, GLsizei, GLenum, GLenum, const GLvoid *); -GLAPI void APIENTRY glCopyColorSubTable (GLenum, GLsizei, GLint, GLint, GLsizei); -GLAPI void APIENTRY glConvolutionFilter1D (GLenum, GLenum, GLsizei, GLenum, GLenum, const GLvoid *); -GLAPI void APIENTRY glConvolutionFilter2D (GLenum, GLenum, GLsizei, GLsizei, GLenum, GLenum, const GLvoid *); -GLAPI void APIENTRY glConvolutionParameterf (GLenum, GLenum, GLfloat); -GLAPI void APIENTRY glConvolutionParameterfv (GLenum, GLenum, const GLfloat *); -GLAPI void APIENTRY glConvolutionParameteri (GLenum, GLenum, GLint); -GLAPI void APIENTRY glConvolutionParameteriv (GLenum, GLenum, const GLint *); -GLAPI void APIENTRY glCopyConvolutionFilter1D (GLenum, GLenum, GLint, GLint, GLsizei); -GLAPI void APIENTRY glCopyConvolutionFilter2D (GLenum, GLenum, GLint, GLint, GLsizei, GLsizei); -GLAPI void APIENTRY glGetConvolutionFilter (GLenum, GLenum, GLenum, GLvoid *); -GLAPI void APIENTRY glGetConvolutionParameterfv (GLenum, GLenum, GLfloat *); -GLAPI void APIENTRY glGetConvolutionParameteriv (GLenum, GLenum, GLint *); -GLAPI void APIENTRY glGetSeparableFilter (GLenum, GLenum, GLenum, GLvoid *, GLvoid *, GLvoid *); -GLAPI void APIENTRY glSeparableFilter2D (GLenum, GLenum, GLsizei, GLsizei, GLenum, GLenum, const GLvoid *, const GLvoid *); -GLAPI void APIENTRY glGetHistogram (GLenum, GLboolean, GLenum, GLenum, GLvoid *); -GLAPI void APIENTRY glGetHistogramParameterfv (GLenum, GLenum, GLfloat *); -GLAPI void APIENTRY glGetHistogramParameteriv (GLenum, GLenum, GLint *); -GLAPI void APIENTRY glGetMinmax (GLenum, GLboolean, GLenum, GLenum, GLvoid *); -GLAPI void APIENTRY glGetMinmaxParameterfv (GLenum, GLenum, GLfloat *); -GLAPI void APIENTRY glGetMinmaxParameteriv (GLenum, GLenum, GLint *); -GLAPI void APIENTRY glHistogram (GLenum, GLsizei, GLenum, GLboolean); -GLAPI void APIENTRY glMinmax (GLenum, GLenum, GLboolean); -GLAPI void APIENTRY glResetHistogram (GLenum); -GLAPI void APIENTRY glResetMinmax (GLenum); -GLAPI void APIENTRY glTexImage3D (GLenum, GLint, GLint, GLsizei, GLsizei, GLsizei, GLint, GLenum, GLenum, const GLvoid *); -GLAPI void APIENTRY glTexSubImage3D (GLenum, GLint, GLint, GLint, GLint, GLsizei, GLsizei, GLsizei, GLenum, GLenum, const GLvoid *); -GLAPI void APIENTRY glCopyTexSubImage3D (GLenum, GLint, GLint, GLint, GLint, GLint, GLint, GLsizei, GLsizei); -#endif /* GL_GLEXT_PROTOTYPES */ -typedef void (APIENTRYP PFNGLBLENDCOLORPROC) (GLclampf red, GLclampf green, GLclampf blue, GLclampf alpha); -typedef void (APIENTRYP PFNGLBLENDEQUATIONPROC) (GLenum mode); -typedef void (APIENTRYP PFNGLDRAWRANGEELEMENTSPROC) (GLenum mode, GLuint start, GLuint end, GLsizei count, GLenum type, const GLvoid *indices); -typedef void (APIENTRYP PFNGLCOLORTABLEPROC) (GLenum target, GLenum internalformat, GLsizei width, GLenum format, GLenum type, const GLvoid *table); -typedef void (APIENTRYP PFNGLCOLORTABLEPARAMETERFVPROC) (GLenum target, GLenum pname, const GLfloat *params); -typedef void (APIENTRYP PFNGLCOLORTABLEPARAMETERIVPROC) (GLenum target, GLenum pname, const GLint *params); -typedef void (APIENTRYP PFNGLCOPYCOLORTABLEPROC) (GLenum target, GLenum internalformat, GLint x, GLint y, GLsizei width); -typedef void (APIENTRYP PFNGLGETCOLORTABLEPROC) (GLenum target, GLenum format, GLenum type, GLvoid *table); -typedef void (APIENTRYP PFNGLGETCOLORTABLEPARAMETERFVPROC) (GLenum target, GLenum pname, GLfloat *params); -typedef void (APIENTRYP PFNGLGETCOLORTABLEPARAMETERIVPROC) (GLenum target, GLenum pname, GLint *params); -typedef void (APIENTRYP PFNGLCOLORSUBTABLEPROC) (GLenum target, GLsizei start, GLsizei count, GLenum format, GLenum type, const GLvoid *data); -typedef void (APIENTRYP PFNGLCOPYCOLORSUBTABLEPROC) (GLenum target, GLsizei start, GLint x, GLint y, GLsizei width); -typedef void (APIENTRYP PFNGLCONVOLUTIONFILTER1DPROC) (GLenum target, GLenum internalformat, GLsizei width, GLenum format, GLenum type, const GLvoid *image); -typedef void (APIENTRYP PFNGLCONVOLUTIONFILTER2DPROC) (GLenum target, GLenum internalformat, GLsizei width, GLsizei height, GLenum format, GLenum type, const GLvoid *image); -typedef void (APIENTRYP PFNGLCONVOLUTIONPARAMETERFPROC) (GLenum target, GLenum pname, GLfloat params); -typedef void (APIENTRYP PFNGLCONVOLUTIONPARAMETERFVPROC) (GLenum target, GLenum pname, const GLfloat *params); -typedef void (APIENTRYP PFNGLCONVOLUTIONPARAMETERIPROC) (GLenum target, GLenum pname, GLint params); -typedef void (APIENTRYP PFNGLCONVOLUTIONPARAMETERIVPROC) (GLenum target, GLenum pname, const GLint *params); -typedef void (APIENTRYP PFNGLCOPYCONVOLUTIONFILTER1DPROC) (GLenum target, GLenum internalformat, GLint x, GLint y, GLsizei width); -typedef void (APIENTRYP PFNGLCOPYCONVOLUTIONFILTER2DPROC) (GLenum target, GLenum internalformat, GLint x, GLint y, GLsizei width, GLsizei height); -typedef void (APIENTRYP PFNGLGETCONVOLUTIONFILTERPROC) (GLenum target, GLenum format, GLenum type, GLvoid *image); -typedef void (APIENTRYP PFNGLGETCONVOLUTIONPARAMETERFVPROC) (GLenum target, GLenum pname, GLfloat *params); -typedef void (APIENTRYP PFNGLGETCONVOLUTIONPARAMETERIVPROC) (GLenum target, GLenum pname, GLint *params); -typedef void (APIENTRYP PFNGLGETSEPARABLEFILTERPROC) (GLenum target, GLenum format, GLenum type, GLvoid *row, GLvoid *column, GLvoid *span); -typedef void (APIENTRYP PFNGLSEPARABLEFILTER2DPROC) (GLenum target, GLenum internalformat, GLsizei width, GLsizei height, GLenum format, GLenum type, const GLvoid *row, const GLvoid *column); -typedef void (APIENTRYP PFNGLGETHISTOGRAMPROC) (GLenum target, GLboolean reset, GLenum format, GLenum type, GLvoid *values); -typedef void (APIENTRYP PFNGLGETHISTOGRAMPARAMETERFVPROC) (GLenum target, GLenum pname, GLfloat *params); -typedef void (APIENTRYP PFNGLGETHISTOGRAMPARAMETERIVPROC) (GLenum target, GLenum pname, GLint *params); -typedef void (APIENTRYP PFNGLGETMINMAXPROC) (GLenum target, GLboolean reset, GLenum format, GLenum type, GLvoid *values); -typedef void (APIENTRYP PFNGLGETMINMAXPARAMETERFVPROC) (GLenum target, GLenum pname, GLfloat *params); -typedef void (APIENTRYP PFNGLGETMINMAXPARAMETERIVPROC) (GLenum target, GLenum pname, GLint *params); -typedef void (APIENTRYP PFNGLHISTOGRAMPROC) (GLenum target, GLsizei width, GLenum internalformat, GLboolean sink); -typedef void (APIENTRYP PFNGLMINMAXPROC) (GLenum target, GLenum internalformat, GLboolean sink); -typedef void (APIENTRYP PFNGLRESETHISTOGRAMPROC) (GLenum target); -typedef void (APIENTRYP PFNGLRESETMINMAXPROC) (GLenum target); -typedef void (APIENTRYP PFNGLTEXIMAGE3DPROC) (GLenum target, GLint level, GLint internalformat, GLsizei width, GLsizei height, GLsizei depth, GLint border, GLenum format, GLenum type, const GLvoid *pixels); -typedef void (APIENTRYP PFNGLTEXSUBIMAGE3DPROC) (GLenum target, GLint level, GLint xoffset, GLint yoffset, GLint zoffset, GLsizei width, GLsizei height, GLsizei depth, GLenum format, GLenum type, const GLvoid *pixels); -typedef void (APIENTRYP PFNGLCOPYTEXSUBIMAGE3DPROC) (GLenum target, GLint level, GLint xoffset, GLint yoffset, GLint zoffset, GLint x, GLint y, GLsizei width, GLsizei height); -#endif - -#ifndef GL_VERSION_1_3 -#define GL_VERSION_1_3 1 -#ifdef GL_GLEXT_PROTOTYPES -GLAPI void APIENTRY glActiveTexture (GLenum); -GLAPI void APIENTRY glClientActiveTexture (GLenum); -GLAPI void APIENTRY glMultiTexCoord1d (GLenum, GLdouble); -GLAPI void APIENTRY glMultiTexCoord1dv (GLenum, const GLdouble *); -GLAPI void APIENTRY glMultiTexCoord1f (GLenum, GLfloat); -GLAPI void APIENTRY glMultiTexCoord1fv (GLenum, const GLfloat *); -GLAPI void APIENTRY glMultiTexCoord1i (GLenum, GLint); -GLAPI void APIENTRY glMultiTexCoord1iv (GLenum, const GLint *); -GLAPI void APIENTRY glMultiTexCoord1s (GLenum, GLshort); -GLAPI void APIENTRY glMultiTexCoord1sv (GLenum, const GLshort *); -GLAPI void APIENTRY glMultiTexCoord2d (GLenum, GLdouble, GLdouble); -GLAPI void APIENTRY glMultiTexCoord2dv (GLenum, const GLdouble *); -GLAPI void APIENTRY glMultiTexCoord2f (GLenum, GLfloat, GLfloat); -GLAPI void APIENTRY glMultiTexCoord2fv (GLenum, const GLfloat *); -GLAPI void APIENTRY glMultiTexCoord2i (GLenum, GLint, GLint); -GLAPI void APIENTRY glMultiTexCoord2iv (GLenum, const GLint *); -GLAPI void APIENTRY glMultiTexCoord2s (GLenum, GLshort, GLshort); -GLAPI void APIENTRY glMultiTexCoord2sv (GLenum, const GLshort *); -GLAPI void APIENTRY glMultiTexCoord3d (GLenum, GLdouble, GLdouble, GLdouble); -GLAPI void APIENTRY glMultiTexCoord3dv (GLenum, const GLdouble *); -GLAPI void APIENTRY glMultiTexCoord3f (GLenum, GLfloat, GLfloat, GLfloat); -GLAPI void APIENTRY glMultiTexCoord3fv (GLenum, const GLfloat *); -GLAPI void APIENTRY glMultiTexCoord3i (GLenum, GLint, GLint, GLint); -GLAPI void APIENTRY glMultiTexCoord3iv (GLenum, const GLint *); -GLAPI void APIENTRY glMultiTexCoord3s (GLenum, GLshort, GLshort, GLshort); -GLAPI void APIENTRY glMultiTexCoord3sv (GLenum, const GLshort *); -GLAPI void APIENTRY glMultiTexCoord4d (GLenum, GLdouble, GLdouble, GLdouble, GLdouble); -GLAPI void APIENTRY glMultiTexCoord4dv (GLenum, const GLdouble *); -GLAPI void APIENTRY glMultiTexCoord4f (GLenum, GLfloat, GLfloat, GLfloat, GLfloat); -GLAPI void APIENTRY glMultiTexCoord4fv (GLenum, const GLfloat *); -GLAPI void APIENTRY glMultiTexCoord4i (GLenum, GLint, GLint, GLint, GLint); -GLAPI void APIENTRY glMultiTexCoord4iv (GLenum, const GLint *); -GLAPI void APIENTRY glMultiTexCoord4s (GLenum, GLshort, GLshort, GLshort, GLshort); -GLAPI void APIENTRY glMultiTexCoord4sv (GLenum, const GLshort *); -GLAPI void APIENTRY glLoadTransposeMatrixf (const GLfloat *); -GLAPI void APIENTRY glLoadTransposeMatrixd (const GLdouble *); -GLAPI void APIENTRY glMultTransposeMatrixf (const GLfloat *); -GLAPI void APIENTRY glMultTransposeMatrixd (const GLdouble *); -GLAPI void APIENTRY glSampleCoverage (GLclampf, GLboolean); -GLAPI void APIENTRY glCompressedTexImage3D (GLenum, GLint, GLenum, GLsizei, GLsizei, GLsizei, GLint, GLsizei, const GLvoid *); -GLAPI void APIENTRY glCompressedTexImage2D (GLenum, GLint, GLenum, GLsizei, GLsizei, GLint, GLsizei, const GLvoid *); -GLAPI void APIENTRY glCompressedTexImage1D (GLenum, GLint, GLenum, GLsizei, GLint, GLsizei, const GLvoid *); -GLAPI void APIENTRY glCompressedTexSubImage3D (GLenum, GLint, GLint, GLint, GLint, GLsizei, GLsizei, GLsizei, GLenum, GLsizei, const GLvoid *); -GLAPI void APIENTRY glCompressedTexSubImage2D (GLenum, GLint, GLint, GLint, GLsizei, GLsizei, GLenum, GLsizei, const GLvoid *); -GLAPI void APIENTRY glCompressedTexSubImage1D (GLenum, GLint, GLint, GLsizei, GLenum, GLsizei, const GLvoid *); -GLAPI void APIENTRY glGetCompressedTexImage (GLenum, GLint, GLvoid *); -#endif /* GL_GLEXT_PROTOTYPES */ -typedef void (APIENTRYP PFNGLACTIVETEXTUREPROC) (GLenum texture); -typedef void (APIENTRYP PFNGLCLIENTACTIVETEXTUREPROC) (GLenum texture); -typedef void (APIENTRYP PFNGLMULTITEXCOORD1DPROC) (GLenum target, GLdouble s); -typedef void (APIENTRYP PFNGLMULTITEXCOORD1DVPROC) (GLenum target, const GLdouble *v); -typedef void (APIENTRYP PFNGLMULTITEXCOORD1FPROC) (GLenum target, GLfloat s); -typedef void (APIENTRYP PFNGLMULTITEXCOORD1FVPROC) (GLenum target, const GLfloat *v); -typedef void (APIENTRYP PFNGLMULTITEXCOORD1IPROC) (GLenum target, GLint s); -typedef void (APIENTRYP PFNGLMULTITEXCOORD1IVPROC) (GLenum target, const GLint *v); -typedef void (APIENTRYP PFNGLMULTITEXCOORD1SPROC) (GLenum target, GLshort s); -typedef void (APIENTRYP PFNGLMULTITEXCOORD1SVPROC) (GLenum target, const GLshort *v); -typedef void (APIENTRYP PFNGLMULTITEXCOORD2DPROC) (GLenum target, GLdouble s, GLdouble t); -typedef void (APIENTRYP PFNGLMULTITEXCOORD2DVPROC) (GLenum target, const GLdouble *v); -typedef void (APIENTRYP PFNGLMULTITEXCOORD2FPROC) (GLenum target, GLfloat s, GLfloat t); -typedef void (APIENTRYP PFNGLMULTITEXCOORD2FVPROC) (GLenum target, const GLfloat *v); -typedef void (APIENTRYP PFNGLMULTITEXCOORD2IPROC) (GLenum target, GLint s, GLint t); -typedef void (APIENTRYP PFNGLMULTITEXCOORD2IVPROC) (GLenum target, const GLint *v); -typedef void (APIENTRYP PFNGLMULTITEXCOORD2SPROC) (GLenum target, GLshort s, GLshort t); -typedef void (APIENTRYP PFNGLMULTITEXCOORD2SVPROC) (GLenum target, const GLshort *v); -typedef void (APIENTRYP PFNGLMULTITEXCOORD3DPROC) (GLenum target, GLdouble s, GLdouble t, GLdouble r); -typedef void (APIENTRYP PFNGLMULTITEXCOORD3DVPROC) (GLenum target, const GLdouble *v); -typedef void (APIENTRYP PFNGLMULTITEXCOORD3FPROC) (GLenum target, GLfloat s, GLfloat t, GLfloat r); -typedef void (APIENTRYP PFNGLMULTITEXCOORD3FVPROC) (GLenum target, const GLfloat *v); -typedef void (APIENTRYP PFNGLMULTITEXCOORD3IPROC) (GLenum target, GLint s, GLint t, GLint r); -typedef void (APIENTRYP PFNGLMULTITEXCOORD3IVPROC) (GLenum target, const GLint *v); -typedef void (APIENTRYP PFNGLMULTITEXCOORD3SPROC) (GLenum target, GLshort s, GLshort t, GLshort r); -typedef void (APIENTRYP PFNGLMULTITEXCOORD3SVPROC) (GLenum target, const GLshort *v); -typedef void (APIENTRYP PFNGLMULTITEXCOORD4DPROC) (GLenum target, GLdouble s, GLdouble t, GLdouble r, GLdouble q); -typedef void (APIENTRYP PFNGLMULTITEXCOORD4DVPROC) (GLenum target, const GLdouble *v); -typedef void (APIENTRYP PFNGLMULTITEXCOORD4FPROC) (GLenum target, GLfloat s, GLfloat t, GLfloat r, GLfloat q); -typedef void (APIENTRYP PFNGLMULTITEXCOORD4FVPROC) (GLenum target, const GLfloat *v); -typedef void (APIENTRYP PFNGLMULTITEXCOORD4IPROC) (GLenum target, GLint s, GLint t, GLint r, GLint q); -typedef void (APIENTRYP PFNGLMULTITEXCOORD4IVPROC) (GLenum target, const GLint *v); -typedef void (APIENTRYP PFNGLMULTITEXCOORD4SPROC) (GLenum target, GLshort s, GLshort t, GLshort r, GLshort q); -typedef void (APIENTRYP PFNGLMULTITEXCOORD4SVPROC) (GLenum target, const GLshort *v); -typedef void (APIENTRYP PFNGLLOADTRANSPOSEMATRIXFPROC) (const GLfloat *m); -typedef void (APIENTRYP PFNGLLOADTRANSPOSEMATRIXDPROC) (const GLdouble *m); -typedef void (APIENTRYP PFNGLMULTTRANSPOSEMATRIXFPROC) (const GLfloat *m); -typedef void (APIENTRYP PFNGLMULTTRANSPOSEMATRIXDPROC) (const GLdouble *m); -typedef void (APIENTRYP PFNGLSAMPLECOVERAGEPROC) (GLclampf value, GLboolean invert); -typedef void (APIENTRYP PFNGLCOMPRESSEDTEXIMAGE3DPROC) (GLenum target, GLint level, GLenum internalformat, GLsizei width, GLsizei height, GLsizei depth, GLint border, GLsizei imageSize, const GLvoid *data); -typedef void (APIENTRYP PFNGLCOMPRESSEDTEXIMAGE2DPROC) (GLenum target, GLint level, GLenum internalformat, GLsizei width, GLsizei height, GLint border, GLsizei imageSize, const GLvoid *data); -typedef void (APIENTRYP PFNGLCOMPRESSEDTEXIMAGE1DPROC) (GLenum target, GLint level, GLenum internalformat, GLsizei width, GLint border, GLsizei imageSize, const GLvoid *data); -typedef void (APIENTRYP PFNGLCOMPRESSEDTEXSUBIMAGE3DPROC) (GLenum target, GLint level, GLint xoffset, GLint yoffset, GLint zoffset, GLsizei width, GLsizei height, GLsizei depth, GLenum format, GLsizei imageSize, const GLvoid *data); -typedef void (APIENTRYP PFNGLCOMPRESSEDTEXSUBIMAGE2DPROC) (GLenum target, GLint level, GLint xoffset, GLint yoffset, GLsizei width, GLsizei height, GLenum format, GLsizei imageSize, const GLvoid *data); -typedef void (APIENTRYP PFNGLCOMPRESSEDTEXSUBIMAGE1DPROC) (GLenum target, GLint level, GLint xoffset, GLsizei width, GLenum format, GLsizei imageSize, const GLvoid *data); -typedef void (APIENTRYP PFNGLGETCOMPRESSEDTEXIMAGEPROC) (GLenum target, GLint level, GLvoid *img); -#endif - -#ifndef GL_VERSION_1_4 -#define GL_VERSION_1_4 1 -#ifdef GL_GLEXT_PROTOTYPES -GLAPI void APIENTRY glBlendFuncSeparate (GLenum, GLenum, GLenum, GLenum); -GLAPI void APIENTRY glFogCoordf (GLfloat); -GLAPI void APIENTRY glFogCoordfv (const GLfloat *); -GLAPI void APIENTRY glFogCoordd (GLdouble); -GLAPI void APIENTRY glFogCoorddv (const GLdouble *); -GLAPI void APIENTRY glFogCoordPointer (GLenum, GLsizei, const GLvoid *); -GLAPI void APIENTRY glMultiDrawArrays (GLenum, GLint *, GLsizei *, GLsizei); -GLAPI void APIENTRY glMultiDrawElements (GLenum, const GLsizei *, GLenum, const GLvoid* *, GLsizei); -GLAPI void APIENTRY glPointParameterf (GLenum, GLfloat); -GLAPI void APIENTRY glPointParameterfv (GLenum, const GLfloat *); -GLAPI void APIENTRY glPointParameteri (GLenum, GLint); -GLAPI void APIENTRY glPointParameteriv (GLenum, const GLint *); -GLAPI void APIENTRY glSecondaryColor3b (GLbyte, GLbyte, GLbyte); -GLAPI void APIENTRY glSecondaryColor3bv (const GLbyte *); -GLAPI void APIENTRY glSecondaryColor3d (GLdouble, GLdouble, GLdouble); -GLAPI void APIENTRY glSecondaryColor3dv (const GLdouble *); -GLAPI void APIENTRY glSecondaryColor3f (GLfloat, GLfloat, GLfloat); -GLAPI void APIENTRY glSecondaryColor3fv (const GLfloat *); -GLAPI void APIENTRY glSecondaryColor3i (GLint, GLint, GLint); -GLAPI void APIENTRY glSecondaryColor3iv (const GLint *); -GLAPI void APIENTRY glSecondaryColor3s (GLshort, GLshort, GLshort); -GLAPI void APIENTRY glSecondaryColor3sv (const GLshort *); -GLAPI void APIENTRY glSecondaryColor3ub (GLubyte, GLubyte, GLubyte); -GLAPI void APIENTRY glSecondaryColor3ubv (const GLubyte *); -GLAPI void APIENTRY glSecondaryColor3ui (GLuint, GLuint, GLuint); -GLAPI void APIENTRY glSecondaryColor3uiv (const GLuint *); -GLAPI void APIENTRY glSecondaryColor3us (GLushort, GLushort, GLushort); -GLAPI void APIENTRY glSecondaryColor3usv (const GLushort *); -GLAPI void APIENTRY glSecondaryColorPointer (GLint, GLenum, GLsizei, const GLvoid *); -GLAPI void APIENTRY glWindowPos2d (GLdouble, GLdouble); -GLAPI void APIENTRY glWindowPos2dv (const GLdouble *); -GLAPI void APIENTRY glWindowPos2f (GLfloat, GLfloat); -GLAPI void APIENTRY glWindowPos2fv (const GLfloat *); -GLAPI void APIENTRY glWindowPos2i (GLint, GLint); -GLAPI void APIENTRY glWindowPos2iv (const GLint *); -GLAPI void APIENTRY glWindowPos2s (GLshort, GLshort); -GLAPI void APIENTRY glWindowPos2sv (const GLshort *); -GLAPI void APIENTRY glWindowPos3d (GLdouble, GLdouble, GLdouble); -GLAPI void APIENTRY glWindowPos3dv (const GLdouble *); -GLAPI void APIENTRY glWindowPos3f (GLfloat, GLfloat, GLfloat); -GLAPI void APIENTRY glWindowPos3fv (const GLfloat *); -GLAPI void APIENTRY glWindowPos3i (GLint, GLint, GLint); -GLAPI void APIENTRY glWindowPos3iv (const GLint *); -GLAPI void APIENTRY glWindowPos3s (GLshort, GLshort, GLshort); -GLAPI void APIENTRY glWindowPos3sv (const GLshort *); -#endif /* GL_GLEXT_PROTOTYPES */ -typedef void (APIENTRYP PFNGLBLENDFUNCSEPARATEPROC) (GLenum sfactorRGB, GLenum dfactorRGB, GLenum sfactorAlpha, GLenum dfactorAlpha); -typedef void (APIENTRYP PFNGLFOGCOORDFPROC) (GLfloat coord); -typedef void (APIENTRYP PFNGLFOGCOORDFVPROC) (const GLfloat *coord); -typedef void (APIENTRYP PFNGLFOGCOORDDPROC) (GLdouble coord); -typedef void (APIENTRYP PFNGLFOGCOORDDVPROC) (const GLdouble *coord); -typedef void (APIENTRYP PFNGLFOGCOORDPOINTERPROC) (GLenum type, GLsizei stride, const GLvoid *pointer); -typedef void (APIENTRYP PFNGLMULTIDRAWARRAYSPROC) (GLenum mode, GLint *first, GLsizei *count, GLsizei primcount); -typedef void (APIENTRYP PFNGLMULTIDRAWELEMENTSPROC) (GLenum mode, const GLsizei *count, GLenum type, const GLvoid* *indices, GLsizei primcount); -typedef void (APIENTRYP PFNGLPOINTPARAMETERFPROC) (GLenum pname, GLfloat param); -typedef void (APIENTRYP PFNGLPOINTPARAMETERFVPROC) (GLenum pname, const GLfloat *params); -typedef void (APIENTRYP PFNGLPOINTPARAMETERIPROC) (GLenum pname, GLint param); -typedef void (APIENTRYP PFNGLPOINTPARAMETERIVPROC) (GLenum pname, const GLint *params); -typedef void (APIENTRYP PFNGLSECONDARYCOLOR3BPROC) (GLbyte red, GLbyte green, GLbyte blue); -typedef void (APIENTRYP PFNGLSECONDARYCOLOR3BVPROC) (const GLbyte *v); -typedef void (APIENTRYP PFNGLSECONDARYCOLOR3DPROC) (GLdouble red, GLdouble green, GLdouble blue); -typedef void (APIENTRYP PFNGLSECONDARYCOLOR3DVPROC) (const GLdouble *v); -typedef void (APIENTRYP PFNGLSECONDARYCOLOR3FPROC) (GLfloat red, GLfloat green, GLfloat blue); -typedef void (APIENTRYP PFNGLSECONDARYCOLOR3FVPROC) (const GLfloat *v); -typedef void (APIENTRYP PFNGLSECONDARYCOLOR3IPROC) (GLint red, GLint green, GLint blue); -typedef void (APIENTRYP PFNGLSECONDARYCOLOR3IVPROC) (const GLint *v); -typedef void (APIENTRYP PFNGLSECONDARYCOLOR3SPROC) (GLshort red, GLshort green, GLshort blue); -typedef void (APIENTRYP PFNGLSECONDARYCOLOR3SVPROC) (const GLshort *v); -typedef void (APIENTRYP PFNGLSECONDARYCOLOR3UBPROC) (GLubyte red, GLubyte green, GLubyte blue); -typedef void (APIENTRYP PFNGLSECONDARYCOLOR3UBVPROC) (const GLubyte *v); -typedef void (APIENTRYP PFNGLSECONDARYCOLOR3UIPROC) (GLuint red, GLuint green, GLuint blue); -typedef void (APIENTRYP PFNGLSECONDARYCOLOR3UIVPROC) (const GLuint *v); -typedef void (APIENTRYP PFNGLSECONDARYCOLOR3USPROC) (GLushort red, GLushort green, GLushort blue); -typedef void (APIENTRYP PFNGLSECONDARYCOLOR3USVPROC) (const GLushort *v); -typedef void (APIENTRYP PFNGLSECONDARYCOLORPOINTERPROC) (GLint size, GLenum type, GLsizei stride, const GLvoid *pointer); -typedef void (APIENTRYP PFNGLWINDOWPOS2DPROC) (GLdouble x, GLdouble y); -typedef void (APIENTRYP PFNGLWINDOWPOS2DVPROC) (const GLdouble *v); -typedef void (APIENTRYP PFNGLWINDOWPOS2FPROC) (GLfloat x, GLfloat y); -typedef void (APIENTRYP PFNGLWINDOWPOS2FVPROC) (const GLfloat *v); -typedef void (APIENTRYP PFNGLWINDOWPOS2IPROC) (GLint x, GLint y); -typedef void (APIENTRYP PFNGLWINDOWPOS2IVPROC) (const GLint *v); -typedef void (APIENTRYP PFNGLWINDOWPOS2SPROC) (GLshort x, GLshort y); -typedef void (APIENTRYP PFNGLWINDOWPOS2SVPROC) (const GLshort *v); -typedef void (APIENTRYP PFNGLWINDOWPOS3DPROC) (GLdouble x, GLdouble y, GLdouble z); -typedef void (APIENTRYP PFNGLWINDOWPOS3DVPROC) (const GLdouble *v); -typedef void (APIENTRYP PFNGLWINDOWPOS3FPROC) (GLfloat x, GLfloat y, GLfloat z); -typedef void (APIENTRYP PFNGLWINDOWPOS3FVPROC) (const GLfloat *v); -typedef void (APIENTRYP PFNGLWINDOWPOS3IPROC) (GLint x, GLint y, GLint z); -typedef void (APIENTRYP PFNGLWINDOWPOS3IVPROC) (const GLint *v); -typedef void (APIENTRYP PFNGLWINDOWPOS3SPROC) (GLshort x, GLshort y, GLshort z); -typedef void (APIENTRYP PFNGLWINDOWPOS3SVPROC) (const GLshort *v); -#endif - -#ifndef GL_VERSION_1_5 -#define GL_VERSION_1_5 1 -#ifdef GL_GLEXT_PROTOTYPES -GLAPI void APIENTRY glGenQueries (GLsizei, GLuint *); -GLAPI void APIENTRY glDeleteQueries (GLsizei, const GLuint *); -GLAPI GLboolean APIENTRY glIsQuery (GLuint); -GLAPI void APIENTRY glBeginQuery (GLenum, GLuint); -GLAPI void APIENTRY glEndQuery (GLenum); -GLAPI void APIENTRY glGetQueryiv (GLenum, GLenum, GLint *); -GLAPI void APIENTRY glGetQueryObjectiv (GLuint, GLenum, GLint *); -GLAPI void APIENTRY glGetQueryObjectuiv (GLuint, GLenum, GLuint *); -GLAPI void APIENTRY glBindBuffer (GLenum, GLuint); -GLAPI void APIENTRY glDeleteBuffers (GLsizei, const GLuint *); -GLAPI void APIENTRY glGenBuffers (GLsizei, GLuint *); -GLAPI GLboolean APIENTRY glIsBuffer (GLuint); -GLAPI void APIENTRY glBufferData (GLenum, GLsizeiptr, const GLvoid *, GLenum); -GLAPI void APIENTRY glBufferSubData (GLenum, GLintptr, GLsizeiptr, const GLvoid *); -GLAPI void APIENTRY glGetBufferSubData (GLenum, GLintptr, GLsizeiptr, GLvoid *); -GLAPI GLvoid* APIENTRY glMapBuffer (GLenum, GLenum); -GLAPI GLboolean APIENTRY glUnmapBuffer (GLenum); -GLAPI void APIENTRY glGetBufferParameteriv (GLenum, GLenum, GLint *); -GLAPI void APIENTRY glGetBufferPointerv (GLenum, GLenum, GLvoid* *); -#endif /* GL_GLEXT_PROTOTYPES */ -typedef void (APIENTRYP PFNGLGENQUERIESPROC) (GLsizei n, GLuint *ids); -typedef void (APIENTRYP PFNGLDELETEQUERIESPROC) (GLsizei n, const GLuint *ids); -typedef GLboolean (APIENTRYP PFNGLISQUERYPROC) (GLuint id); -typedef void (APIENTRYP PFNGLBEGINQUERYPROC) (GLenum target, GLuint id); -typedef void (APIENTRYP PFNGLENDQUERYPROC) (GLenum target); -typedef void (APIENTRYP PFNGLGETQUERYIVPROC) (GLenum target, GLenum pname, GLint *params); -typedef void (APIENTRYP PFNGLGETQUERYOBJECTIVPROC) (GLuint id, GLenum pname, GLint *params); -typedef void (APIENTRYP PFNGLGETQUERYOBJECTUIVPROC) (GLuint id, GLenum pname, GLuint *params); -typedef void (APIENTRYP PFNGLBINDBUFFERPROC) (GLenum target, GLuint buffer); -typedef void (APIENTRYP PFNGLDELETEBUFFERSPROC) (GLsizei n, const GLuint *buffers); -typedef void (APIENTRYP PFNGLGENBUFFERSPROC) (GLsizei n, GLuint *buffers); -typedef GLboolean (APIENTRYP PFNGLISBUFFERPROC) (GLuint buffer); -typedef void (APIENTRYP PFNGLBUFFERDATAPROC) (GLenum target, GLsizeiptr size, const GLvoid *data, GLenum usage); -typedef void (APIENTRYP PFNGLBUFFERSUBDATAPROC) (GLenum target, GLintptr offset, GLsizeiptr size, const GLvoid *data); -typedef void (APIENTRYP PFNGLGETBUFFERSUBDATAPROC) (GLenum target, GLintptr offset, GLsizeiptr size, GLvoid *data); -typedef GLvoid* (APIENTRYP PFNGLMAPBUFFERPROC) (GLenum target, GLenum access); -typedef GLboolean (APIENTRYP PFNGLUNMAPBUFFERPROC) (GLenum target); -typedef void (APIENTRYP PFNGLGETBUFFERPARAMETERIVPROC) (GLenum target, GLenum pname, GLint *params); -typedef void (APIENTRYP PFNGLGETBUFFERPOINTERVPROC) (GLenum target, GLenum pname, GLvoid* *params); -#endif - -#ifndef GL_VERSION_2_0 -#define GL_VERSION_2_0 1 -#ifdef GL_GLEXT_PROTOTYPES -GLAPI void APIENTRY glBlendEquationSeparate (GLenum, GLenum); -GLAPI void APIENTRY glDrawBuffers (GLsizei, const GLenum *); -GLAPI void APIENTRY glStencilOpSeparate (GLenum, GLenum, GLenum, GLenum); -GLAPI void APIENTRY glStencilFuncSeparate (GLenum, GLenum, GLint, GLuint); -GLAPI void APIENTRY glStencilMaskSeparate (GLenum, GLuint); -GLAPI void APIENTRY glAttachShader (GLuint, GLuint); -GLAPI void APIENTRY glBindAttribLocation (GLuint, GLuint, const GLchar *); -GLAPI void APIENTRY glCompileShader (GLuint); -GLAPI GLuint APIENTRY glCreateProgram (void); -GLAPI GLuint APIENTRY glCreateShader (GLenum); -GLAPI void APIENTRY glDeleteProgram (GLuint); -GLAPI void APIENTRY glDeleteShader (GLuint); -GLAPI void APIENTRY glDetachShader (GLuint, GLuint); -GLAPI void APIENTRY glDisableVertexAttribArray (GLuint); -GLAPI void APIENTRY glEnableVertexAttribArray (GLuint); -GLAPI void APIENTRY glGetActiveAttrib (GLuint, GLuint, GLsizei, GLsizei *, GLint *, GLenum *, GLchar *); -GLAPI void APIENTRY glGetActiveUniform (GLuint, GLuint, GLsizei, GLsizei *, GLint *, GLenum *, GLchar *); -GLAPI void APIENTRY glGetAttachedShaders (GLuint, GLsizei, GLsizei *, GLuint *); -GLAPI GLint APIENTRY glGetAttribLocation (GLuint, const GLchar *); -GLAPI void APIENTRY glGetProgramiv (GLuint, GLenum, GLint *); -GLAPI void APIENTRY glGetProgramInfoLog (GLuint, GLsizei, GLsizei *, GLchar *); -GLAPI void APIENTRY glGetShaderiv (GLuint, GLenum, GLint *); -GLAPI void APIENTRY glGetShaderInfoLog (GLuint, GLsizei, GLsizei *, GLchar *); -GLAPI void APIENTRY glGetShaderSource (GLuint, GLsizei, GLsizei *, GLchar *); -GLAPI GLint APIENTRY glGetUniformLocation (GLuint, const GLchar *); -GLAPI void APIENTRY glGetUniformfv (GLuint, GLint, GLfloat *); -GLAPI void APIENTRY glGetUniformiv (GLuint, GLint, GLint *); -GLAPI void APIENTRY glGetVertexAttribdv (GLuint, GLenum, GLdouble *); -GLAPI void APIENTRY glGetVertexAttribfv (GLuint, GLenum, GLfloat *); -GLAPI void APIENTRY glGetVertexAttribiv (GLuint, GLenum, GLint *); -GLAPI void APIENTRY glGetVertexAttribPointerv (GLuint, GLenum, GLvoid* *); -GLAPI GLboolean APIENTRY glIsProgram (GLuint); -GLAPI GLboolean APIENTRY glIsShader (GLuint); -GLAPI void APIENTRY glLinkProgram (GLuint); -GLAPI void APIENTRY glShaderSource (GLuint, GLsizei, const GLchar* *, const GLint *); -GLAPI void APIENTRY glUseProgram (GLuint); -GLAPI void APIENTRY glUniform1f (GLint, GLfloat); -GLAPI void APIENTRY glUniform2f (GLint, GLfloat, GLfloat); -GLAPI void APIENTRY glUniform3f (GLint, GLfloat, GLfloat, GLfloat); -GLAPI void APIENTRY glUniform4f (GLint, GLfloat, GLfloat, GLfloat, GLfloat); -GLAPI void APIENTRY glUniform1i (GLint, GLint); -GLAPI void APIENTRY glUniform2i (GLint, GLint, GLint); -GLAPI void APIENTRY glUniform3i (GLint, GLint, GLint, GLint); -GLAPI void APIENTRY glUniform4i (GLint, GLint, GLint, GLint, GLint); -GLAPI void APIENTRY glUniform1fv (GLint, GLsizei, const GLfloat *); -GLAPI void APIENTRY glUniform2fv (GLint, GLsizei, const GLfloat *); -GLAPI void APIENTRY glUniform3fv (GLint, GLsizei, const GLfloat *); -GLAPI void APIENTRY glUniform4fv (GLint, GLsizei, const GLfloat *); -GLAPI void APIENTRY glUniform1iv (GLint, GLsizei, const GLint *); -GLAPI void APIENTRY glUniform2iv (GLint, GLsizei, const GLint *); -GLAPI void APIENTRY glUniform3iv (GLint, GLsizei, const GLint *); -GLAPI void APIENTRY glUniform4iv (GLint, GLsizei, const GLint *); -GLAPI void APIENTRY glUniformMatrix2fv (GLint, GLsizei, GLboolean, const GLfloat *); -GLAPI void APIENTRY glUniformMatrix3fv (GLint, GLsizei, GLboolean, const GLfloat *); -GLAPI void APIENTRY glUniformMatrix4fv (GLint, GLsizei, GLboolean, const GLfloat *); -GLAPI void APIENTRY glValidateProgram (GLuint); -GLAPI void APIENTRY glVertexAttrib1d (GLuint, GLdouble); -GLAPI void APIENTRY glVertexAttrib1dv (GLuint, const GLdouble *); -GLAPI void APIENTRY glVertexAttrib1f (GLuint, GLfloat); -GLAPI void APIENTRY glVertexAttrib1fv (GLuint, const GLfloat *); -GLAPI void APIENTRY glVertexAttrib1s (GLuint, GLshort); -GLAPI void APIENTRY glVertexAttrib1sv (GLuint, const GLshort *); -GLAPI void APIENTRY glVertexAttrib2d (GLuint, GLdouble, GLdouble); -GLAPI void APIENTRY glVertexAttrib2dv (GLuint, const GLdouble *); -GLAPI void APIENTRY glVertexAttrib2f (GLuint, GLfloat, GLfloat); -GLAPI void APIENTRY glVertexAttrib2fv (GLuint, const GLfloat *); -GLAPI void APIENTRY glVertexAttrib2s (GLuint, GLshort, GLshort); -GLAPI void APIENTRY glVertexAttrib2sv (GLuint, const GLshort *); -GLAPI void APIENTRY glVertexAttrib3d (GLuint, GLdouble, GLdouble, GLdouble); -GLAPI void APIENTRY glVertexAttrib3dv (GLuint, const GLdouble *); -GLAPI void APIENTRY glVertexAttrib3f (GLuint, GLfloat, GLfloat, GLfloat); -GLAPI void APIENTRY glVertexAttrib3fv (GLuint, const GLfloat *); -GLAPI void APIENTRY glVertexAttrib3s (GLuint, GLshort, GLshort, GLshort); -GLAPI void APIENTRY glVertexAttrib3sv (GLuint, const GLshort *); -GLAPI void APIENTRY glVertexAttrib4Nbv (GLuint, const GLbyte *); -GLAPI void APIENTRY glVertexAttrib4Niv (GLuint, const GLint *); -GLAPI void APIENTRY glVertexAttrib4Nsv (GLuint, const GLshort *); -GLAPI void APIENTRY glVertexAttrib4Nub (GLuint, GLubyte, GLubyte, GLubyte, GLubyte); -GLAPI void APIENTRY glVertexAttrib4Nubv (GLuint, const GLubyte *); -GLAPI void APIENTRY glVertexAttrib4Nuiv (GLuint, const GLuint *); -GLAPI void APIENTRY glVertexAttrib4Nusv (GLuint, const GLushort *); -GLAPI void APIENTRY glVertexAttrib4bv (GLuint, const GLbyte *); -GLAPI void APIENTRY glVertexAttrib4d (GLuint, GLdouble, GLdouble, GLdouble, GLdouble); -GLAPI void APIENTRY glVertexAttrib4dv (GLuint, const GLdouble *); -GLAPI void APIENTRY glVertexAttrib4f (GLuint, GLfloat, GLfloat, GLfloat, GLfloat); -GLAPI void APIENTRY glVertexAttrib4fv (GLuint, const GLfloat *); -GLAPI void APIENTRY glVertexAttrib4iv (GLuint, const GLint *); -GLAPI void APIENTRY glVertexAttrib4s (GLuint, GLshort, GLshort, GLshort, GLshort); -GLAPI void APIENTRY glVertexAttrib4sv (GLuint, const GLshort *); -GLAPI void APIENTRY glVertexAttrib4ubv (GLuint, const GLubyte *); -GLAPI void APIENTRY glVertexAttrib4uiv (GLuint, const GLuint *); -GLAPI void APIENTRY glVertexAttrib4usv (GLuint, const GLushort *); -GLAPI void APIENTRY glVertexAttribPointer (GLuint, GLint, GLenum, GLboolean, GLsizei, const GLvoid *); -#endif /* GL_GLEXT_PROTOTYPES */ -typedef void (APIENTRYP PFNGLBLENDEQUATIONSEPARATEPROC) (GLenum modeRGB, GLenum modeAlpha); -typedef void (APIENTRYP PFNGLDRAWBUFFERSPROC) (GLsizei n, const GLenum *bufs); -typedef void (APIENTRYP PFNGLSTENCILOPSEPARATEPROC) (GLenum face, GLenum sfail, GLenum dpfail, GLenum dppass); -typedef void (APIENTRYP PFNGLSTENCILFUNCSEPARATEPROC) (GLenum frontfunc, GLenum backfunc, GLint ref, GLuint mask); -typedef void (APIENTRYP PFNGLSTENCILMASKSEPARATEPROC) (GLenum face, GLuint mask); -typedef void (APIENTRYP PFNGLATTACHSHADERPROC) (GLuint program, GLuint shader); -typedef void (APIENTRYP PFNGLBINDATTRIBLOCATIONPROC) (GLuint program, GLuint index, const GLchar *name); -typedef void (APIENTRYP PFNGLCOMPILESHADERPROC) (GLuint shader); -typedef GLuint (APIENTRYP PFNGLCREATEPROGRAMPROC) (void); -typedef GLuint (APIENTRYP PFNGLCREATESHADERPROC) (GLenum type); -typedef void (APIENTRYP PFNGLDELETEPROGRAMPROC) (GLuint program); -typedef void (APIENTRYP PFNGLDELETESHADERPROC) (GLuint shader); -typedef void (APIENTRYP PFNGLDETACHSHADERPROC) (GLuint program, GLuint shader); -typedef void (APIENTRYP PFNGLDISABLEVERTEXATTRIBARRAYPROC) (GLuint index); -typedef void (APIENTRYP PFNGLENABLEVERTEXATTRIBARRAYPROC) (GLuint index); -typedef void (APIENTRYP PFNGLGETACTIVEATTRIBPROC) (GLuint program, GLuint index, GLsizei bufSize, GLsizei *length, GLint *size, GLenum *type, GLchar *name); -typedef void (APIENTRYP PFNGLGETACTIVEUNIFORMPROC) (GLuint program, GLuint index, GLsizei bufSize, GLsizei *length, GLint *size, GLenum *type, GLchar *name); -typedef void (APIENTRYP PFNGLGETATTACHEDSHADERSPROC) (GLuint program, GLsizei maxCount, GLsizei *count, GLuint *obj); -typedef GLint (APIENTRYP PFNGLGETATTRIBLOCATIONPROC) (GLuint program, const GLchar *name); -typedef void (APIENTRYP PFNGLGETPROGRAMIVPROC) (GLuint program, GLenum pname, GLint *params); -typedef void (APIENTRYP PFNGLGETPROGRAMINFOLOGPROC) (GLuint program, GLsizei bufSize, GLsizei *length, GLchar *infoLog); -typedef void (APIENTRYP PFNGLGETSHADERIVPROC) (GLuint shader, GLenum pname, GLint *params); -typedef void (APIENTRYP PFNGLGETSHADERINFOLOGPROC) (GLuint shader, GLsizei bufSize, GLsizei *length, GLchar *infoLog); -typedef void (APIENTRYP PFNGLGETSHADERSOURCEPROC) (GLuint shader, GLsizei bufSize, GLsizei *length, GLchar *source); -typedef GLint (APIENTRYP PFNGLGETUNIFORMLOCATIONPROC) (GLuint program, const GLchar *name); -typedef void (APIENTRYP PFNGLGETUNIFORMFVPROC) (GLuint program, GLint location, GLfloat *params); -typedef void (APIENTRYP PFNGLGETUNIFORMIVPROC) (GLuint program, GLint location, GLint *params); -typedef void (APIENTRYP PFNGLGETVERTEXATTRIBDVPROC) (GLuint index, GLenum pname, GLdouble *params); -typedef void (APIENTRYP PFNGLGETVERTEXATTRIBFVPROC) (GLuint index, GLenum pname, GLfloat *params); -typedef void (APIENTRYP PFNGLGETVERTEXATTRIBIVPROC) (GLuint index, GLenum pname, GLint *params); -typedef void (APIENTRYP PFNGLGETVERTEXATTRIBPOINTERVPROC) (GLuint index, GLenum pname, GLvoid* *pointer); -typedef GLboolean (APIENTRYP PFNGLISPROGRAMPROC) (GLuint program); -typedef GLboolean (APIENTRYP PFNGLISSHADERPROC) (GLuint shader); -typedef void (APIENTRYP PFNGLLINKPROGRAMPROC) (GLuint program); -typedef void (APIENTRYP PFNGLSHADERSOURCEPROC) (GLuint shader, GLsizei count, const GLchar* *string, const GLint *length); -typedef void (APIENTRYP PFNGLUSEPROGRAMPROC) (GLuint program); -typedef void (APIENTRYP PFNGLUNIFORM1FPROC) (GLint location, GLfloat v0); -typedef void (APIENTRYP PFNGLUNIFORM2FPROC) (GLint location, GLfloat v0, GLfloat v1); -typedef void (APIENTRYP PFNGLUNIFORM3FPROC) (GLint location, GLfloat v0, GLfloat v1, GLfloat v2); -typedef void (APIENTRYP PFNGLUNIFORM4FPROC) (GLint location, GLfloat v0, GLfloat v1, GLfloat v2, GLfloat v3); -typedef void (APIENTRYP PFNGLUNIFORM1IPROC) (GLint location, GLint v0); -typedef void (APIENTRYP PFNGLUNIFORM2IPROC) (GLint location, GLint v0, GLint v1); -typedef void (APIENTRYP PFNGLUNIFORM3IPROC) (GLint location, GLint v0, GLint v1, GLint v2); -typedef void (APIENTRYP PFNGLUNIFORM4IPROC) (GLint location, GLint v0, GLint v1, GLint v2, GLint v3); -typedef void (APIENTRYP PFNGLUNIFORM1FVPROC) (GLint location, GLsizei count, const GLfloat *value); -typedef void (APIENTRYP PFNGLUNIFORM2FVPROC) (GLint location, GLsizei count, const GLfloat *value); -typedef void (APIENTRYP PFNGLUNIFORM3FVPROC) (GLint location, GLsizei count, const GLfloat *value); -typedef void (APIENTRYP PFNGLUNIFORM4FVPROC) (GLint location, GLsizei count, const GLfloat *value); -typedef void (APIENTRYP PFNGLUNIFORM1IVPROC) (GLint location, GLsizei count, const GLint *value); -typedef void (APIENTRYP PFNGLUNIFORM2IVPROC) (GLint location, GLsizei count, const GLint *value); -typedef void (APIENTRYP PFNGLUNIFORM3IVPROC) (GLint location, GLsizei count, const GLint *value); -typedef void (APIENTRYP PFNGLUNIFORM4IVPROC) (GLint location, GLsizei count, const GLint *value); -typedef void (APIENTRYP PFNGLUNIFORMMATRIX2FVPROC) (GLint location, GLsizei count, GLboolean transpose, const GLfloat *value); -typedef void (APIENTRYP PFNGLUNIFORMMATRIX3FVPROC) (GLint location, GLsizei count, GLboolean transpose, const GLfloat *value); -typedef void (APIENTRYP PFNGLUNIFORMMATRIX4FVPROC) (GLint location, GLsizei count, GLboolean transpose, const GLfloat *value); -typedef void (APIENTRYP PFNGLVALIDATEPROGRAMPROC) (GLuint program); -typedef void (APIENTRYP PFNGLVERTEXATTRIB1DPROC) (GLuint index, GLdouble x); -typedef void (APIENTRYP PFNGLVERTEXATTRIB1DVPROC) (GLuint index, const GLdouble *v); -typedef void (APIENTRYP PFNGLVERTEXATTRIB1FPROC) (GLuint index, GLfloat x); -typedef void (APIENTRYP PFNGLVERTEXATTRIB1FVPROC) (GLuint index, const GLfloat *v); -typedef void (APIENTRYP PFNGLVERTEXATTRIB1SPROC) (GLuint index, GLshort x); -typedef void (APIENTRYP PFNGLVERTEXATTRIB1SVPROC) (GLuint index, const GLshort *v); -typedef void (APIENTRYP PFNGLVERTEXATTRIB2DPROC) (GLuint index, GLdouble x, GLdouble y); -typedef void (APIENTRYP PFNGLVERTEXATTRIB2DVPROC) (GLuint index, const GLdouble *v); -typedef void (APIENTRYP PFNGLVERTEXATTRIB2FPROC) (GLuint index, GLfloat x, GLfloat y); -typedef void (APIENTRYP PFNGLVERTEXATTRIB2FVPROC) (GLuint index, const GLfloat *v); -typedef void (APIENTRYP PFNGLVERTEXATTRIB2SPROC) (GLuint index, GLshort x, GLshort y); -typedef void (APIENTRYP PFNGLVERTEXATTRIB2SVPROC) (GLuint index, const GLshort *v); -typedef void (APIENTRYP PFNGLVERTEXATTRIB3DPROC) (GLuint index, GLdouble x, GLdouble y, GLdouble z); -typedef void (APIENTRYP PFNGLVERTEXATTRIB3DVPROC) (GLuint index, const GLdouble *v); -typedef void (APIENTRYP PFNGLVERTEXATTRIB3FPROC) (GLuint index, GLfloat x, GLfloat y, GLfloat z); -typedef void (APIENTRYP PFNGLVERTEXATTRIB3FVPROC) (GLuint index, const GLfloat *v); -typedef void (APIENTRYP PFNGLVERTEXATTRIB3SPROC) (GLuint index, GLshort x, GLshort y, GLshort z); -typedef void (APIENTRYP PFNGLVERTEXATTRIB3SVPROC) (GLuint index, const GLshort *v); -typedef void (APIENTRYP PFNGLVERTEXATTRIB4NBVPROC) (GLuint index, const GLbyte *v); -typedef void (APIENTRYP PFNGLVERTEXATTRIB4NIVPROC) (GLuint index, const GLint *v); -typedef void (APIENTRYP PFNGLVERTEXATTRIB4NSVPROC) (GLuint index, const GLshort *v); -typedef void (APIENTRYP PFNGLVERTEXATTRIB4NUBPROC) (GLuint index, GLubyte x, GLubyte y, GLubyte z, GLubyte w); -typedef void (APIENTRYP PFNGLVERTEXATTRIB4NUBVPROC) (GLuint index, const GLubyte *v); -typedef void (APIENTRYP PFNGLVERTEXATTRIB4NUIVPROC) (GLuint index, const GLuint *v); -typedef void (APIENTRYP PFNGLVERTEXATTRIB4NUSVPROC) (GLuint index, const GLushort *v); -typedef void (APIENTRYP PFNGLVERTEXATTRIB4BVPROC) (GLuint index, const GLbyte *v); -typedef void (APIENTRYP PFNGLVERTEXATTRIB4DPROC) (GLuint index, GLdouble x, GLdouble y, GLdouble z, GLdouble w); -typedef void (APIENTRYP PFNGLVERTEXATTRIB4DVPROC) (GLuint index, const GLdouble *v); -typedef void (APIENTRYP PFNGLVERTEXATTRIB4FPROC) (GLuint index, GLfloat x, GLfloat y, GLfloat z, GLfloat w); -typedef void (APIENTRYP PFNGLVERTEXATTRIB4FVPROC) (GLuint index, const GLfloat *v); -typedef void (APIENTRYP PFNGLVERTEXATTRIB4IVPROC) (GLuint index, const GLint *v); -typedef void (APIENTRYP PFNGLVERTEXATTRIB4SPROC) (GLuint index, GLshort x, GLshort y, GLshort z, GLshort w); -typedef void (APIENTRYP PFNGLVERTEXATTRIB4SVPROC) (GLuint index, const GLshort *v); -typedef void (APIENTRYP PFNGLVERTEXATTRIB4UBVPROC) (GLuint index, const GLubyte *v); -typedef void (APIENTRYP PFNGLVERTEXATTRIB4UIVPROC) (GLuint index, const GLuint *v); -typedef void (APIENTRYP PFNGLVERTEXATTRIB4USVPROC) (GLuint index, const GLushort *v); -typedef void (APIENTRYP PFNGLVERTEXATTRIBPOINTERPROC) (GLuint index, GLint size, GLenum type, GLboolean normalized, GLsizei stride, const GLvoid *pointer); -#endif - -#ifndef GL_ARB_multitexture -#define GL_ARB_multitexture 1 -#ifdef GL_GLEXT_PROTOTYPES -GLAPI void APIENTRY glActiveTextureARB (GLenum); -GLAPI void APIENTRY glClientActiveTextureARB (GLenum); -GLAPI void APIENTRY glMultiTexCoord1dARB (GLenum, GLdouble); -GLAPI void APIENTRY glMultiTexCoord1dvARB (GLenum, const GLdouble *); -GLAPI void APIENTRY glMultiTexCoord1fARB (GLenum, GLfloat); -GLAPI void APIENTRY glMultiTexCoord1fvARB (GLenum, const GLfloat *); -GLAPI void APIENTRY glMultiTexCoord1iARB (GLenum, GLint); -GLAPI void APIENTRY glMultiTexCoord1ivARB (GLenum, const GLint *); -GLAPI void APIENTRY glMultiTexCoord1sARB (GLenum, GLshort); -GLAPI void APIENTRY glMultiTexCoord1svARB (GLenum, const GLshort *); -GLAPI void APIENTRY glMultiTexCoord2dARB (GLenum, GLdouble, GLdouble); -GLAPI void APIENTRY glMultiTexCoord2dvARB (GLenum, const GLdouble *); -GLAPI void APIENTRY glMultiTexCoord2fARB (GLenum, GLfloat, GLfloat); -GLAPI void APIENTRY glMultiTexCoord2fvARB (GLenum, const GLfloat *); -GLAPI void APIENTRY glMultiTexCoord2iARB (GLenum, GLint, GLint); -GLAPI void APIENTRY glMultiTexCoord2ivARB (GLenum, const GLint *); -GLAPI void APIENTRY glMultiTexCoord2sARB (GLenum, GLshort, GLshort); -GLAPI void APIENTRY glMultiTexCoord2svARB (GLenum, const GLshort *); -GLAPI void APIENTRY glMultiTexCoord3dARB (GLenum, GLdouble, GLdouble, GLdouble); -GLAPI void APIENTRY glMultiTexCoord3dvARB (GLenum, const GLdouble *); -GLAPI void APIENTRY glMultiTexCoord3fARB (GLenum, GLfloat, GLfloat, GLfloat); -GLAPI void APIENTRY glMultiTexCoord3fvARB (GLenum, const GLfloat *); -GLAPI void APIENTRY glMultiTexCoord3iARB (GLenum, GLint, GLint, GLint); -GLAPI void APIENTRY glMultiTexCoord3ivARB (GLenum, const GLint *); -GLAPI void APIENTRY glMultiTexCoord3sARB (GLenum, GLshort, GLshort, GLshort); -GLAPI void APIENTRY glMultiTexCoord3svARB (GLenum, const GLshort *); -GLAPI void APIENTRY glMultiTexCoord4dARB (GLenum, GLdouble, GLdouble, GLdouble, GLdouble); -GLAPI void APIENTRY glMultiTexCoord4dvARB (GLenum, const GLdouble *); -GLAPI void APIENTRY glMultiTexCoord4fARB (GLenum, GLfloat, GLfloat, GLfloat, GLfloat); -GLAPI void APIENTRY glMultiTexCoord4fvARB (GLenum, const GLfloat *); -GLAPI void APIENTRY glMultiTexCoord4iARB (GLenum, GLint, GLint, GLint, GLint); -GLAPI void APIENTRY glMultiTexCoord4ivARB (GLenum, const GLint *); -GLAPI void APIENTRY glMultiTexCoord4sARB (GLenum, GLshort, GLshort, GLshort, GLshort); -GLAPI void APIENTRY glMultiTexCoord4svARB (GLenum, const GLshort *); -#endif /* GL_GLEXT_PROTOTYPES */ -typedef void (APIENTRYP PFNGLACTIVETEXTUREARBPROC) (GLenum texture); -typedef void (APIENTRYP PFNGLCLIENTACTIVETEXTUREARBPROC) (GLenum texture); -typedef void (APIENTRYP PFNGLMULTITEXCOORD1DARBPROC) (GLenum target, GLdouble s); -typedef void (APIENTRYP PFNGLMULTITEXCOORD1DVARBPROC) (GLenum target, const GLdouble *v); -typedef void (APIENTRYP PFNGLMULTITEXCOORD1FARBPROC) (GLenum target, GLfloat s); -typedef void (APIENTRYP PFNGLMULTITEXCOORD1FVARBPROC) (GLenum target, const GLfloat *v); -typedef void (APIENTRYP PFNGLMULTITEXCOORD1IARBPROC) (GLenum target, GLint s); -typedef void (APIENTRYP PFNGLMULTITEXCOORD1IVARBPROC) (GLenum target, const GLint *v); -typedef void (APIENTRYP PFNGLMULTITEXCOORD1SARBPROC) (GLenum target, GLshort s); -typedef void (APIENTRYP PFNGLMULTITEXCOORD1SVARBPROC) (GLenum target, const GLshort *v); -typedef void (APIENTRYP PFNGLMULTITEXCOORD2DARBPROC) (GLenum target, GLdouble s, GLdouble t); -typedef void (APIENTRYP PFNGLMULTITEXCOORD2DVARBPROC) (GLenum target, const GLdouble *v); -typedef void (APIENTRYP PFNGLMULTITEXCOORD2FARBPROC) (GLenum target, GLfloat s, GLfloat t); -typedef void (APIENTRYP PFNGLMULTITEXCOORD2FVARBPROC) (GLenum target, const GLfloat *v); -typedef void (APIENTRYP PFNGLMULTITEXCOORD2IARBPROC) (GLenum target, GLint s, GLint t); -typedef void (APIENTRYP PFNGLMULTITEXCOORD2IVARBPROC) (GLenum target, const GLint *v); -typedef void (APIENTRYP PFNGLMULTITEXCOORD2SARBPROC) (GLenum target, GLshort s, GLshort t); -typedef void (APIENTRYP PFNGLMULTITEXCOORD2SVARBPROC) (GLenum target, const GLshort *v); -typedef void (APIENTRYP PFNGLMULTITEXCOORD3DARBPROC) (GLenum target, GLdouble s, GLdouble t, GLdouble r); -typedef void (APIENTRYP PFNGLMULTITEXCOORD3DVARBPROC) (GLenum target, const GLdouble *v); -typedef void (APIENTRYP PFNGLMULTITEXCOORD3FARBPROC) (GLenum target, GLfloat s, GLfloat t, GLfloat r); -typedef void (APIENTRYP PFNGLMULTITEXCOORD3FVARBPROC) (GLenum target, const GLfloat *v); -typedef void (APIENTRYP PFNGLMULTITEXCOORD3IARBPROC) (GLenum target, GLint s, GLint t, GLint r); -typedef void (APIENTRYP PFNGLMULTITEXCOORD3IVARBPROC) (GLenum target, const GLint *v); -typedef void (APIENTRYP PFNGLMULTITEXCOORD3SARBPROC) (GLenum target, GLshort s, GLshort t, GLshort r); -typedef void (APIENTRYP PFNGLMULTITEXCOORD3SVARBPROC) (GLenum target, const GLshort *v); -typedef void (APIENTRYP PFNGLMULTITEXCOORD4DARBPROC) (GLenum target, GLdouble s, GLdouble t, GLdouble r, GLdouble q); -typedef void (APIENTRYP PFNGLMULTITEXCOORD4DVARBPROC) (GLenum target, const GLdouble *v); -typedef void (APIENTRYP PFNGLMULTITEXCOORD4FARBPROC) (GLenum target, GLfloat s, GLfloat t, GLfloat r, GLfloat q); -typedef void (APIENTRYP PFNGLMULTITEXCOORD4FVARBPROC) (GLenum target, const GLfloat *v); -typedef void (APIENTRYP PFNGLMULTITEXCOORD4IARBPROC) (GLenum target, GLint s, GLint t, GLint r, GLint q); -typedef void (APIENTRYP PFNGLMULTITEXCOORD4IVARBPROC) (GLenum target, const GLint *v); -typedef void (APIENTRYP PFNGLMULTITEXCOORD4SARBPROC) (GLenum target, GLshort s, GLshort t, GLshort r, GLshort q); -typedef void (APIENTRYP PFNGLMULTITEXCOORD4SVARBPROC) (GLenum target, const GLshort *v); -#endif - -#ifndef GL_ARB_transpose_matrix -#define GL_ARB_transpose_matrix 1 -#ifdef GL_GLEXT_PROTOTYPES -GLAPI void APIENTRY glLoadTransposeMatrixfARB (const GLfloat *); -GLAPI void APIENTRY glLoadTransposeMatrixdARB (const GLdouble *); -GLAPI void APIENTRY glMultTransposeMatrixfARB (const GLfloat *); -GLAPI void APIENTRY glMultTransposeMatrixdARB (const GLdouble *); -#endif /* GL_GLEXT_PROTOTYPES */ -typedef void (APIENTRYP PFNGLLOADTRANSPOSEMATRIXFARBPROC) (const GLfloat *m); -typedef void (APIENTRYP PFNGLLOADTRANSPOSEMATRIXDARBPROC) (const GLdouble *m); -typedef void (APIENTRYP PFNGLMULTTRANSPOSEMATRIXFARBPROC) (const GLfloat *m); -typedef void (APIENTRYP PFNGLMULTTRANSPOSEMATRIXDARBPROC) (const GLdouble *m); -#endif - -#ifndef GL_ARB_multisample -#define GL_ARB_multisample 1 -#ifdef GL_GLEXT_PROTOTYPES -GLAPI void APIENTRY glSampleCoverageARB (GLclampf, GLboolean); -#endif /* GL_GLEXT_PROTOTYPES */ -typedef void (APIENTRYP PFNGLSAMPLECOVERAGEARBPROC) (GLclampf value, GLboolean invert); -#endif - -#ifndef GL_ARB_texture_env_add -#define GL_ARB_texture_env_add 1 -#endif - -#ifndef GL_ARB_texture_cube_map -#define GL_ARB_texture_cube_map 1 -#endif - -#ifndef GL_ARB_texture_compression -#define GL_ARB_texture_compression 1 -#ifdef GL_GLEXT_PROTOTYPES -GLAPI void APIENTRY glCompressedTexImage3DARB (GLenum, GLint, GLenum, GLsizei, GLsizei, GLsizei, GLint, GLsizei, const GLvoid *); -GLAPI void APIENTRY glCompressedTexImage2DARB (GLenum, GLint, GLenum, GLsizei, GLsizei, GLint, GLsizei, const GLvoid *); -GLAPI void APIENTRY glCompressedTexImage1DARB (GLenum, GLint, GLenum, GLsizei, GLint, GLsizei, const GLvoid *); -GLAPI void APIENTRY glCompressedTexSubImage3DARB (GLenum, GLint, GLint, GLint, GLint, GLsizei, GLsizei, GLsizei, GLenum, GLsizei, const GLvoid *); -GLAPI void APIENTRY glCompressedTexSubImage2DARB (GLenum, GLint, GLint, GLint, GLsizei, GLsizei, GLenum, GLsizei, const GLvoid *); -GLAPI void APIENTRY glCompressedTexSubImage1DARB (GLenum, GLint, GLint, GLsizei, GLenum, GLsizei, const GLvoid *); -GLAPI void APIENTRY glGetCompressedTexImageARB (GLenum, GLint, GLvoid *); -#endif /* GL_GLEXT_PROTOTYPES */ -typedef void (APIENTRYP PFNGLCOMPRESSEDTEXIMAGE3DARBPROC) (GLenum target, GLint level, GLenum internalformat, GLsizei width, GLsizei height, GLsizei depth, GLint border, GLsizei imageSize, const GLvoid *data); -typedef void (APIENTRYP PFNGLCOMPRESSEDTEXIMAGE2DARBPROC) (GLenum target, GLint level, GLenum internalformat, GLsizei width, GLsizei height, GLint border, GLsizei imageSize, const GLvoid *data); -typedef void (APIENTRYP PFNGLCOMPRESSEDTEXIMAGE1DARBPROC) (GLenum target, GLint level, GLenum internalformat, GLsizei width, GLint border, GLsizei imageSize, const GLvoid *data); -typedef void (APIENTRYP PFNGLCOMPRESSEDTEXSUBIMAGE3DARBPROC) (GLenum target, GLint level, GLint xoffset, GLint yoffset, GLint zoffset, GLsizei width, GLsizei height, GLsizei depth, GLenum format, GLsizei imageSize, const GLvoid *data); -typedef void (APIENTRYP PFNGLCOMPRESSEDTEXSUBIMAGE2DARBPROC) (GLenum target, GLint level, GLint xoffset, GLint yoffset, GLsizei width, GLsizei height, GLenum format, GLsizei imageSize, const GLvoid *data); -typedef void (APIENTRYP PFNGLCOMPRESSEDTEXSUBIMAGE1DARBPROC) (GLenum target, GLint level, GLint xoffset, GLsizei width, GLenum format, GLsizei imageSize, const GLvoid *data); -typedef void (APIENTRYP PFNGLGETCOMPRESSEDTEXIMAGEARBPROC) (GLenum target, GLint level, GLvoid *img); -#endif - -#ifndef GL_ARB_texture_border_clamp -#define GL_ARB_texture_border_clamp 1 -#endif - -#ifndef GL_ARB_point_parameters -#define GL_ARB_point_parameters 1 -#ifdef GL_GLEXT_PROTOTYPES -GLAPI void APIENTRY glPointParameterfARB (GLenum, GLfloat); -GLAPI void APIENTRY glPointParameterfvARB (GLenum, const GLfloat *); -#endif /* GL_GLEXT_PROTOTYPES */ -typedef void (APIENTRYP PFNGLPOINTPARAMETERFARBPROC) (GLenum pname, GLfloat param); -typedef void (APIENTRYP PFNGLPOINTPARAMETERFVARBPROC) (GLenum pname, const GLfloat *params); -#endif - -#ifndef GL_ARB_vertex_blend -#define GL_ARB_vertex_blend 1 -#ifdef GL_GLEXT_PROTOTYPES -GLAPI void APIENTRY glWeightbvARB (GLint, const GLbyte *); -GLAPI void APIENTRY glWeightsvARB (GLint, const GLshort *); -GLAPI void APIENTRY glWeightivARB (GLint, const GLint *); -GLAPI void APIENTRY glWeightfvARB (GLint, const GLfloat *); -GLAPI void APIENTRY glWeightdvARB (GLint, const GLdouble *); -GLAPI void APIENTRY glWeightubvARB (GLint, const GLubyte *); -GLAPI void APIENTRY glWeightusvARB (GLint, const GLushort *); -GLAPI void APIENTRY glWeightuivARB (GLint, const GLuint *); -GLAPI void APIENTRY glWeightPointerARB (GLint, GLenum, GLsizei, const GLvoid *); -GLAPI void APIENTRY glVertexBlendARB (GLint); -#endif /* GL_GLEXT_PROTOTYPES */ -typedef void (APIENTRYP PFNGLWEIGHTBVARBPROC) (GLint size, const GLbyte *weights); -typedef void (APIENTRYP PFNGLWEIGHTSVARBPROC) (GLint size, const GLshort *weights); -typedef void (APIENTRYP PFNGLWEIGHTIVARBPROC) (GLint size, const GLint *weights); -typedef void (APIENTRYP PFNGLWEIGHTFVARBPROC) (GLint size, const GLfloat *weights); -typedef void (APIENTRYP PFNGLWEIGHTDVARBPROC) (GLint size, const GLdouble *weights); -typedef void (APIENTRYP PFNGLWEIGHTUBVARBPROC) (GLint size, const GLubyte *weights); -typedef void (APIENTRYP PFNGLWEIGHTUSVARBPROC) (GLint size, const GLushort *weights); -typedef void (APIENTRYP PFNGLWEIGHTUIVARBPROC) (GLint size, const GLuint *weights); -typedef void (APIENTRYP PFNGLWEIGHTPOINTERARBPROC) (GLint size, GLenum type, GLsizei stride, const GLvoid *pointer); -typedef void (APIENTRYP PFNGLVERTEXBLENDARBPROC) (GLint count); -#endif - -#ifndef GL_ARB_matrix_palette -#define GL_ARB_matrix_palette 1 -#ifdef GL_GLEXT_PROTOTYPES -GLAPI void APIENTRY glCurrentPaletteMatrixARB (GLint); -GLAPI void APIENTRY glMatrixIndexubvARB (GLint, const GLubyte *); -GLAPI void APIENTRY glMatrixIndexusvARB (GLint, const GLushort *); -GLAPI void APIENTRY glMatrixIndexuivARB (GLint, const GLuint *); -GLAPI void APIENTRY glMatrixIndexPointerARB (GLint, GLenum, GLsizei, const GLvoid *); -#endif /* GL_GLEXT_PROTOTYPES */ -typedef void (APIENTRYP PFNGLCURRENTPALETTEMATRIXARBPROC) (GLint index); -typedef void (APIENTRYP PFNGLMATRIXINDEXUBVARBPROC) (GLint size, const GLubyte *indices); -typedef void (APIENTRYP PFNGLMATRIXINDEXUSVARBPROC) (GLint size, const GLushort *indices); -typedef void (APIENTRYP PFNGLMATRIXINDEXUIVARBPROC) (GLint size, const GLuint *indices); -typedef void (APIENTRYP PFNGLMATRIXINDEXPOINTERARBPROC) (GLint size, GLenum type, GLsizei stride, const GLvoid *pointer); -#endif - -#ifndef GL_ARB_texture_env_combine -#define GL_ARB_texture_env_combine 1 -#endif - -#ifndef GL_ARB_texture_env_crossbar -#define GL_ARB_texture_env_crossbar 1 -#endif - -#ifndef GL_ARB_texture_env_dot3 -#define GL_ARB_texture_env_dot3 1 -#endif - -#ifndef GL_ARB_texture_mirrored_repeat -#define GL_ARB_texture_mirrored_repeat 1 -#endif - -#ifndef GL_ARB_depth_texture -#define GL_ARB_depth_texture 1 -#endif - -#ifndef GL_ARB_shadow -#define GL_ARB_shadow 1 -#endif - -#ifndef GL_ARB_shadow_ambient -#define GL_ARB_shadow_ambient 1 -#endif - -#ifndef GL_ARB_window_pos -#define GL_ARB_window_pos 1 -#ifdef GL_GLEXT_PROTOTYPES -GLAPI void APIENTRY glWindowPos2dARB (GLdouble, GLdouble); -GLAPI void APIENTRY glWindowPos2dvARB (const GLdouble *); -GLAPI void APIENTRY glWindowPos2fARB (GLfloat, GLfloat); -GLAPI void APIENTRY glWindowPos2fvARB (const GLfloat *); -GLAPI void APIENTRY glWindowPos2iARB (GLint, GLint); -GLAPI void APIENTRY glWindowPos2ivARB (const GLint *); -GLAPI void APIENTRY glWindowPos2sARB (GLshort, GLshort); -GLAPI void APIENTRY glWindowPos2svARB (const GLshort *); -GLAPI void APIENTRY glWindowPos3dARB (GLdouble, GLdouble, GLdouble); -GLAPI void APIENTRY glWindowPos3dvARB (const GLdouble *); -GLAPI void APIENTRY glWindowPos3fARB (GLfloat, GLfloat, GLfloat); -GLAPI void APIENTRY glWindowPos3fvARB (const GLfloat *); -GLAPI void APIENTRY glWindowPos3iARB (GLint, GLint, GLint); -GLAPI void APIENTRY glWindowPos3ivARB (const GLint *); -GLAPI void APIENTRY glWindowPos3sARB (GLshort, GLshort, GLshort); -GLAPI void APIENTRY glWindowPos3svARB (const GLshort *); -#endif /* GL_GLEXT_PROTOTYPES */ -typedef void (APIENTRYP PFNGLWINDOWPOS2DARBPROC) (GLdouble x, GLdouble y); -typedef void (APIENTRYP PFNGLWINDOWPOS2DVARBPROC) (const GLdouble *v); -typedef void (APIENTRYP PFNGLWINDOWPOS2FARBPROC) (GLfloat x, GLfloat y); -typedef void (APIENTRYP PFNGLWINDOWPOS2FVARBPROC) (const GLfloat *v); -typedef void (APIENTRYP PFNGLWINDOWPOS2IARBPROC) (GLint x, GLint y); -typedef void (APIENTRYP PFNGLWINDOWPOS2IVARBPROC) (const GLint *v); -typedef void (APIENTRYP PFNGLWINDOWPOS2SARBPROC) (GLshort x, GLshort y); -typedef void (APIENTRYP PFNGLWINDOWPOS2SVARBPROC) (const GLshort *v); -typedef void (APIENTRYP PFNGLWINDOWPOS3DARBPROC) (GLdouble x, GLdouble y, GLdouble z); -typedef void (APIENTRYP PFNGLWINDOWPOS3DVARBPROC) (const GLdouble *v); -typedef void (APIENTRYP PFNGLWINDOWPOS3FARBPROC) (GLfloat x, GLfloat y, GLfloat z); -typedef void (APIENTRYP PFNGLWINDOWPOS3FVARBPROC) (const GLfloat *v); -typedef void (APIENTRYP PFNGLWINDOWPOS3IARBPROC) (GLint x, GLint y, GLint z); -typedef void (APIENTRYP PFNGLWINDOWPOS3IVARBPROC) (const GLint *v); -typedef void (APIENTRYP PFNGLWINDOWPOS3SARBPROC) (GLshort x, GLshort y, GLshort z); -typedef void (APIENTRYP PFNGLWINDOWPOS3SVARBPROC) (const GLshort *v); -#endif - -#ifndef GL_ARB_vertex_program -#define GL_ARB_vertex_program 1 -#ifdef GL_GLEXT_PROTOTYPES -GLAPI void APIENTRY glVertexAttrib1dARB (GLuint, GLdouble); -GLAPI void APIENTRY glVertexAttrib1dvARB (GLuint, const GLdouble *); -GLAPI void APIENTRY glVertexAttrib1fARB (GLuint, GLfloat); -GLAPI void APIENTRY glVertexAttrib1fvARB (GLuint, const GLfloat *); -GLAPI void APIENTRY glVertexAttrib1sARB (GLuint, GLshort); -GLAPI void APIENTRY glVertexAttrib1svARB (GLuint, const GLshort *); -GLAPI void APIENTRY glVertexAttrib2dARB (GLuint, GLdouble, GLdouble); -GLAPI void APIENTRY glVertexAttrib2dvARB (GLuint, const GLdouble *); -GLAPI void APIENTRY glVertexAttrib2fARB (GLuint, GLfloat, GLfloat); -GLAPI void APIENTRY glVertexAttrib2fvARB (GLuint, const GLfloat *); -GLAPI void APIENTRY glVertexAttrib2sARB (GLuint, GLshort, GLshort); -GLAPI void APIENTRY glVertexAttrib2svARB (GLuint, const GLshort *); -GLAPI void APIENTRY glVertexAttrib3dARB (GLuint, GLdouble, GLdouble, GLdouble); -GLAPI void APIENTRY glVertexAttrib3dvARB (GLuint, const GLdouble *); -GLAPI void APIENTRY glVertexAttrib3fARB (GLuint, GLfloat, GLfloat, GLfloat); -GLAPI void APIENTRY glVertexAttrib3fvARB (GLuint, const GLfloat *); -GLAPI void APIENTRY glVertexAttrib3sARB (GLuint, GLshort, GLshort, GLshort); -GLAPI void APIENTRY glVertexAttrib3svARB (GLuint, const GLshort *); -GLAPI void APIENTRY glVertexAttrib4NbvARB (GLuint, const GLbyte *); -GLAPI void APIENTRY glVertexAttrib4NivARB (GLuint, const GLint *); -GLAPI void APIENTRY glVertexAttrib4NsvARB (GLuint, const GLshort *); -GLAPI void APIENTRY glVertexAttrib4NubARB (GLuint, GLubyte, GLubyte, GLubyte, GLubyte); -GLAPI void APIENTRY glVertexAttrib4NubvARB (GLuint, const GLubyte *); -GLAPI void APIENTRY glVertexAttrib4NuivARB (GLuint, const GLuint *); -GLAPI void APIENTRY glVertexAttrib4NusvARB (GLuint, const GLushort *); -GLAPI void APIENTRY glVertexAttrib4bvARB (GLuint, const GLbyte *); -GLAPI void APIENTRY glVertexAttrib4dARB (GLuint, GLdouble, GLdouble, GLdouble, GLdouble); -GLAPI void APIENTRY glVertexAttrib4dvARB (GLuint, const GLdouble *); -GLAPI void APIENTRY glVertexAttrib4fARB (GLuint, GLfloat, GLfloat, GLfloat, GLfloat); -GLAPI void APIENTRY glVertexAttrib4fvARB (GLuint, const GLfloat *); -GLAPI void APIENTRY glVertexAttrib4ivARB (GLuint, const GLint *); -GLAPI void APIENTRY glVertexAttrib4sARB (GLuint, GLshort, GLshort, GLshort, GLshort); -GLAPI void APIENTRY glVertexAttrib4svARB (GLuint, const GLshort *); -GLAPI void APIENTRY glVertexAttrib4ubvARB (GLuint, const GLubyte *); -GLAPI void APIENTRY glVertexAttrib4uivARB (GLuint, const GLuint *); -GLAPI void APIENTRY glVertexAttrib4usvARB (GLuint, const GLushort *); -GLAPI void APIENTRY glVertexAttribPointerARB (GLuint, GLint, GLenum, GLboolean, GLsizei, const GLvoid *); -GLAPI void APIENTRY glEnableVertexAttribArrayARB (GLuint); -GLAPI void APIENTRY glDisableVertexAttribArrayARB (GLuint); -GLAPI void APIENTRY glProgramStringARB (GLenum, GLenum, GLsizei, const GLvoid *); -GLAPI void APIENTRY glBindProgramARB (GLenum, GLuint); -GLAPI void APIENTRY glDeleteProgramsARB (GLsizei, const GLuint *); -GLAPI void APIENTRY glGenProgramsARB (GLsizei, GLuint *); -GLAPI void APIENTRY glProgramEnvParameter4dARB (GLenum, GLuint, GLdouble, GLdouble, GLdouble, GLdouble); -GLAPI void APIENTRY glProgramEnvParameter4dvARB (GLenum, GLuint, const GLdouble *); -GLAPI void APIENTRY glProgramEnvParameter4fARB (GLenum, GLuint, GLfloat, GLfloat, GLfloat, GLfloat); -GLAPI void APIENTRY glProgramEnvParameter4fvARB (GLenum, GLuint, const GLfloat *); -GLAPI void APIENTRY glProgramLocalParameter4dARB (GLenum, GLuint, GLdouble, GLdouble, GLdouble, GLdouble); -GLAPI void APIENTRY glProgramLocalParameter4dvARB (GLenum, GLuint, const GLdouble *); -GLAPI void APIENTRY glProgramLocalParameter4fARB (GLenum, GLuint, GLfloat, GLfloat, GLfloat, GLfloat); -GLAPI void APIENTRY glProgramLocalParameter4fvARB (GLenum, GLuint, const GLfloat *); -GLAPI void APIENTRY glGetProgramEnvParameterdvARB (GLenum, GLuint, GLdouble *); -GLAPI void APIENTRY glGetProgramEnvParameterfvARB (GLenum, GLuint, GLfloat *); -GLAPI void APIENTRY glGetProgramLocalParameterdvARB (GLenum, GLuint, GLdouble *); -GLAPI void APIENTRY glGetProgramLocalParameterfvARB (GLenum, GLuint, GLfloat *); -GLAPI void APIENTRY glGetProgramivARB (GLenum, GLenum, GLint *); -GLAPI void APIENTRY glGetProgramStringARB (GLenum, GLenum, GLvoid *); -GLAPI void APIENTRY glGetVertexAttribdvARB (GLuint, GLenum, GLdouble *); -GLAPI void APIENTRY glGetVertexAttribfvARB (GLuint, GLenum, GLfloat *); -GLAPI void APIENTRY glGetVertexAttribivARB (GLuint, GLenum, GLint *); -GLAPI void APIENTRY glGetVertexAttribPointervARB (GLuint, GLenum, GLvoid* *); -GLAPI GLboolean APIENTRY glIsProgramARB (GLuint); -#endif /* GL_GLEXT_PROTOTYPES */ -typedef void (APIENTRYP PFNGLVERTEXATTRIB1DARBPROC) (GLuint index, GLdouble x); -typedef void (APIENTRYP PFNGLVERTEXATTRIB1DVARBPROC) (GLuint index, const GLdouble *v); -typedef void (APIENTRYP PFNGLVERTEXATTRIB1FARBPROC) (GLuint index, GLfloat x); -typedef void (APIENTRYP PFNGLVERTEXATTRIB1FVARBPROC) (GLuint index, const GLfloat *v); -typedef void (APIENTRYP PFNGLVERTEXATTRIB1SARBPROC) (GLuint index, GLshort x); -typedef void (APIENTRYP PFNGLVERTEXATTRIB1SVARBPROC) (GLuint index, const GLshort *v); -typedef void (APIENTRYP PFNGLVERTEXATTRIB2DARBPROC) (GLuint index, GLdouble x, GLdouble y); -typedef void (APIENTRYP PFNGLVERTEXATTRIB2DVARBPROC) (GLuint index, const GLdouble *v); -typedef void (APIENTRYP PFNGLVERTEXATTRIB2FARBPROC) (GLuint index, GLfloat x, GLfloat y); -typedef void (APIENTRYP PFNGLVERTEXATTRIB2FVARBPROC) (GLuint index, const GLfloat *v); -typedef void (APIENTRYP PFNGLVERTEXATTRIB2SARBPROC) (GLuint index, GLshort x, GLshort y); -typedef void (APIENTRYP PFNGLVERTEXATTRIB2SVARBPROC) (GLuint index, const GLshort *v); -typedef void (APIENTRYP PFNGLVERTEXATTRIB3DARBPROC) (GLuint index, GLdouble x, GLdouble y, GLdouble z); -typedef void (APIENTRYP PFNGLVERTEXATTRIB3DVARBPROC) (GLuint index, const GLdouble *v); -typedef void (APIENTRYP PFNGLVERTEXATTRIB3FARBPROC) (GLuint index, GLfloat x, GLfloat y, GLfloat z); -typedef void (APIENTRYP PFNGLVERTEXATTRIB3FVARBPROC) (GLuint index, const GLfloat *v); -typedef void (APIENTRYP PFNGLVERTEXATTRIB3SARBPROC) (GLuint index, GLshort x, GLshort y, GLshort z); -typedef void (APIENTRYP PFNGLVERTEXATTRIB3SVARBPROC) (GLuint index, const GLshort *v); -typedef void (APIENTRYP PFNGLVERTEXATTRIB4NBVARBPROC) (GLuint index, const GLbyte *v); -typedef void (APIENTRYP PFNGLVERTEXATTRIB4NIVARBPROC) (GLuint index, const GLint *v); -typedef void (APIENTRYP PFNGLVERTEXATTRIB4NSVARBPROC) (GLuint index, const GLshort *v); -typedef void (APIENTRYP PFNGLVERTEXATTRIB4NUBARBPROC) (GLuint index, GLubyte x, GLubyte y, GLubyte z, GLubyte w); -typedef void (APIENTRYP PFNGLVERTEXATTRIB4NUBVARBPROC) (GLuint index, const GLubyte *v); -typedef void (APIENTRYP PFNGLVERTEXATTRIB4NUIVARBPROC) (GLuint index, const GLuint *v); -typedef void (APIENTRYP PFNGLVERTEXATTRIB4NUSVARBPROC) (GLuint index, const GLushort *v); -typedef void (APIENTRYP PFNGLVERTEXATTRIB4BVARBPROC) (GLuint index, const GLbyte *v); -typedef void (APIENTRYP PFNGLVERTEXATTRIB4DARBPROC) (GLuint index, GLdouble x, GLdouble y, GLdouble z, GLdouble w); -typedef void (APIENTRYP PFNGLVERTEXATTRIB4DVARBPROC) (GLuint index, const GLdouble *v); -typedef void (APIENTRYP PFNGLVERTEXATTRIB4FARBPROC) (GLuint index, GLfloat x, GLfloat y, GLfloat z, GLfloat w); -typedef void (APIENTRYP PFNGLVERTEXATTRIB4FVARBPROC) (GLuint index, const GLfloat *v); -typedef void (APIENTRYP PFNGLVERTEXATTRIB4IVARBPROC) (GLuint index, const GLint *v); -typedef void (APIENTRYP PFNGLVERTEXATTRIB4SARBPROC) (GLuint index, GLshort x, GLshort y, GLshort z, GLshort w); -typedef void (APIENTRYP PFNGLVERTEXATTRIB4SVARBPROC) (GLuint index, const GLshort *v); -typedef void (APIENTRYP PFNGLVERTEXATTRIB4UBVARBPROC) (GLuint index, const GLubyte *v); -typedef void (APIENTRYP PFNGLVERTEXATTRIB4UIVARBPROC) (GLuint index, const GLuint *v); -typedef void (APIENTRYP PFNGLVERTEXATTRIB4USVARBPROC) (GLuint index, const GLushort *v); -typedef void (APIENTRYP PFNGLVERTEXATTRIBPOINTERARBPROC) (GLuint index, GLint size, GLenum type, GLboolean normalized, GLsizei stride, const GLvoid *pointer); -typedef void (APIENTRYP PFNGLENABLEVERTEXATTRIBARRAYARBPROC) (GLuint index); -typedef void (APIENTRYP PFNGLDISABLEVERTEXATTRIBARRAYARBPROC) (GLuint index); -typedef void (APIENTRYP PFNGLPROGRAMSTRINGARBPROC) (GLenum target, GLenum format, GLsizei len, const GLvoid *string); -typedef void (APIENTRYP PFNGLBINDPROGRAMARBPROC) (GLenum target, GLuint program); -typedef void (APIENTRYP PFNGLDELETEPROGRAMSARBPROC) (GLsizei n, const GLuint *programs); -typedef void (APIENTRYP PFNGLGENPROGRAMSARBPROC) (GLsizei n, GLuint *programs); -typedef void (APIENTRYP PFNGLPROGRAMENVPARAMETER4DARBPROC) (GLenum target, GLuint index, GLdouble x, GLdouble y, GLdouble z, GLdouble w); -typedef void (APIENTRYP PFNGLPROGRAMENVPARAMETER4DVARBPROC) (GLenum target, GLuint index, const GLdouble *params); -typedef void (APIENTRYP PFNGLPROGRAMENVPARAMETER4FARBPROC) (GLenum target, GLuint index, GLfloat x, GLfloat y, GLfloat z, GLfloat w); -typedef void (APIENTRYP PFNGLPROGRAMENVPARAMETER4FVARBPROC) (GLenum target, GLuint index, const GLfloat *params); -typedef void (APIENTRYP PFNGLPROGRAMLOCALPARAMETER4DARBPROC) (GLenum target, GLuint index, GLdouble x, GLdouble y, GLdouble z, GLdouble w); -typedef void (APIENTRYP PFNGLPROGRAMLOCALPARAMETER4DVARBPROC) (GLenum target, GLuint index, const GLdouble *params); -typedef void (APIENTRYP PFNGLPROGRAMLOCALPARAMETER4FARBPROC) (GLenum target, GLuint index, GLfloat x, GLfloat y, GLfloat z, GLfloat w); -typedef void (APIENTRYP PFNGLPROGRAMLOCALPARAMETER4FVARBPROC) (GLenum target, GLuint index, const GLfloat *params); -typedef void (APIENTRYP PFNGLGETPROGRAMENVPARAMETERDVARBPROC) (GLenum target, GLuint index, GLdouble *params); -typedef void (APIENTRYP PFNGLGETPROGRAMENVPARAMETERFVARBPROC) (GLenum target, GLuint index, GLfloat *params); -typedef void (APIENTRYP PFNGLGETPROGRAMLOCALPARAMETERDVARBPROC) (GLenum target, GLuint index, GLdouble *params); -typedef void (APIENTRYP PFNGLGETPROGRAMLOCALPARAMETERFVARBPROC) (GLenum target, GLuint index, GLfloat *params); -typedef void (APIENTRYP PFNGLGETPROGRAMIVARBPROC) (GLenum target, GLenum pname, GLint *params); -typedef void (APIENTRYP PFNGLGETPROGRAMSTRINGARBPROC) (GLenum target, GLenum pname, GLvoid *string); -typedef void (APIENTRYP PFNGLGETVERTEXATTRIBDVARBPROC) (GLuint index, GLenum pname, GLdouble *params); -typedef void (APIENTRYP PFNGLGETVERTEXATTRIBFVARBPROC) (GLuint index, GLenum pname, GLfloat *params); -typedef void (APIENTRYP PFNGLGETVERTEXATTRIBIVARBPROC) (GLuint index, GLenum pname, GLint *params); -typedef void (APIENTRYP PFNGLGETVERTEXATTRIBPOINTERVARBPROC) (GLuint index, GLenum pname, GLvoid* *pointer); -typedef GLboolean (APIENTRYP PFNGLISPROGRAMARBPROC) (GLuint program); -#endif - -#ifndef GL_ARB_fragment_program -#define GL_ARB_fragment_program 1 -/* All ARB_fragment_program entry points are shared with ARB_vertex_program. */ -#endif - -#ifndef GL_ARB_vertex_buffer_object -#define GL_ARB_vertex_buffer_object 1 -#ifdef GL_GLEXT_PROTOTYPES -GLAPI void APIENTRY glBindBufferARB (GLenum, GLuint); -GLAPI void APIENTRY glDeleteBuffersARB (GLsizei, const GLuint *); -GLAPI void APIENTRY glGenBuffersARB (GLsizei, GLuint *); -GLAPI GLboolean APIENTRY glIsBufferARB (GLuint); -GLAPI void APIENTRY glBufferDataARB (GLenum, GLsizeiptrARB, const GLvoid *, GLenum); -GLAPI void APIENTRY glBufferSubDataARB (GLenum, GLintptrARB, GLsizeiptrARB, const GLvoid *); -GLAPI void APIENTRY glGetBufferSubDataARB (GLenum, GLintptrARB, GLsizeiptrARB, GLvoid *); -GLAPI GLvoid* APIENTRY glMapBufferARB (GLenum, GLenum); -GLAPI GLboolean APIENTRY glUnmapBufferARB (GLenum); -GLAPI void APIENTRY glGetBufferParameterivARB (GLenum, GLenum, GLint *); -GLAPI void APIENTRY glGetBufferPointervARB (GLenum, GLenum, GLvoid* *); -#endif /* GL_GLEXT_PROTOTYPES */ -typedef void (APIENTRYP PFNGLBINDBUFFERARBPROC) (GLenum target, GLuint buffer); -typedef void (APIENTRYP PFNGLDELETEBUFFERSARBPROC) (GLsizei n, const GLuint *buffers); -typedef void (APIENTRYP PFNGLGENBUFFERSARBPROC) (GLsizei n, GLuint *buffers); -typedef GLboolean (APIENTRYP PFNGLISBUFFERARBPROC) (GLuint buffer); -typedef void (APIENTRYP PFNGLBUFFERDATAARBPROC) (GLenum target, GLsizeiptrARB size, const GLvoid *data, GLenum usage); -typedef void (APIENTRYP PFNGLBUFFERSUBDATAARBPROC) (GLenum target, GLintptrARB offset, GLsizeiptrARB size, const GLvoid *data); -typedef void (APIENTRYP PFNGLGETBUFFERSUBDATAARBPROC) (GLenum target, GLintptrARB offset, GLsizeiptrARB size, GLvoid *data); -typedef GLvoid* (APIENTRYP PFNGLMAPBUFFERARBPROC) (GLenum target, GLenum access); -typedef GLboolean (APIENTRYP PFNGLUNMAPBUFFERARBPROC) (GLenum target); -typedef void (APIENTRYP PFNGLGETBUFFERPARAMETERIVARBPROC) (GLenum target, GLenum pname, GLint *params); -typedef void (APIENTRYP PFNGLGETBUFFERPOINTERVARBPROC) (GLenum target, GLenum pname, GLvoid* *params); -#endif - -#ifndef GL_ARB_occlusion_query -#define GL_ARB_occlusion_query 1 -#ifdef GL_GLEXT_PROTOTYPES -GLAPI void APIENTRY glGenQueriesARB (GLsizei, GLuint *); -GLAPI void APIENTRY glDeleteQueriesARB (GLsizei, const GLuint *); -GLAPI GLboolean APIENTRY glIsQueryARB (GLuint); -GLAPI void APIENTRY glBeginQueryARB (GLenum, GLuint); -GLAPI void APIENTRY glEndQueryARB (GLenum); -GLAPI void APIENTRY glGetQueryivARB (GLenum, GLenum, GLint *); -GLAPI void APIENTRY glGetQueryObjectivARB (GLuint, GLenum, GLint *); -GLAPI void APIENTRY glGetQueryObjectuivARB (GLuint, GLenum, GLuint *); -#endif /* GL_GLEXT_PROTOTYPES */ -typedef void (APIENTRYP PFNGLGENQUERIESARBPROC) (GLsizei n, GLuint *ids); -typedef void (APIENTRYP PFNGLDELETEQUERIESARBPROC) (GLsizei n, const GLuint *ids); -typedef GLboolean (APIENTRYP PFNGLISQUERYARBPROC) (GLuint id); -typedef void (APIENTRYP PFNGLBEGINQUERYARBPROC) (GLenum target, GLuint id); -typedef void (APIENTRYP PFNGLENDQUERYARBPROC) (GLenum target); -typedef void (APIENTRYP PFNGLGETQUERYIVARBPROC) (GLenum target, GLenum pname, GLint *params); -typedef void (APIENTRYP PFNGLGETQUERYOBJECTIVARBPROC) (GLuint id, GLenum pname, GLint *params); -typedef void (APIENTRYP PFNGLGETQUERYOBJECTUIVARBPROC) (GLuint id, GLenum pname, GLuint *params); -#endif - -#ifndef GL_ARB_shader_objects -#define GL_ARB_shader_objects 1 -#ifdef GL_GLEXT_PROTOTYPES -GLAPI void APIENTRY glDeleteObjectARB (GLhandleARB); -GLAPI GLhandleARB APIENTRY glGetHandleARB (GLenum); -GLAPI void APIENTRY glDetachObjectARB (GLhandleARB, GLhandleARB); -GLAPI GLhandleARB APIENTRY glCreateShaderObjectARB (GLenum); -GLAPI void APIENTRY glShaderSourceARB (GLhandleARB, GLsizei, const GLcharARB* *, const GLint *); -GLAPI void APIENTRY glCompileShaderARB (GLhandleARB); -GLAPI GLhandleARB APIENTRY glCreateProgramObjectARB (void); -GLAPI void APIENTRY glAttachObjectARB (GLhandleARB, GLhandleARB); -GLAPI void APIENTRY glLinkProgramARB (GLhandleARB); -GLAPI void APIENTRY glUseProgramObjectARB (GLhandleARB); -GLAPI void APIENTRY glValidateProgramARB (GLhandleARB); -GLAPI void APIENTRY glUniform1fARB (GLint, GLfloat); -GLAPI void APIENTRY glUniform2fARB (GLint, GLfloat, GLfloat); -GLAPI void APIENTRY glUniform3fARB (GLint, GLfloat, GLfloat, GLfloat); -GLAPI void APIENTRY glUniform4fARB (GLint, GLfloat, GLfloat, GLfloat, GLfloat); -GLAPI void APIENTRY glUniform1iARB (GLint, GLint); -GLAPI void APIENTRY glUniform2iARB (GLint, GLint, GLint); -GLAPI void APIENTRY glUniform3iARB (GLint, GLint, GLint, GLint); -GLAPI void APIENTRY glUniform4iARB (GLint, GLint, GLint, GLint, GLint); -GLAPI void APIENTRY glUniform1fvARB (GLint, GLsizei, const GLfloat *); -GLAPI void APIENTRY glUniform2fvARB (GLint, GLsizei, const GLfloat *); -GLAPI void APIENTRY glUniform3fvARB (GLint, GLsizei, const GLfloat *); -GLAPI void APIENTRY glUniform4fvARB (GLint, GLsizei, const GLfloat *); -GLAPI void APIENTRY glUniform1ivARB (GLint, GLsizei, const GLint *); -GLAPI void APIENTRY glUniform2ivARB (GLint, GLsizei, const GLint *); -GLAPI void APIENTRY glUniform3ivARB (GLint, GLsizei, const GLint *); -GLAPI void APIENTRY glUniform4ivARB (GLint, GLsizei, const GLint *); -GLAPI void APIENTRY glUniformMatrix2fvARB (GLint, GLsizei, GLboolean, const GLfloat *); -GLAPI void APIENTRY glUniformMatrix3fvARB (GLint, GLsizei, GLboolean, const GLfloat *); -GLAPI void APIENTRY glUniformMatrix4fvARB (GLint, GLsizei, GLboolean, const GLfloat *); -GLAPI void APIENTRY glGetObjectParameterfvARB (GLhandleARB, GLenum, GLfloat *); -GLAPI void APIENTRY glGetObjectParameterivARB (GLhandleARB, GLenum, GLint *); -GLAPI void APIENTRY glGetInfoLogARB (GLhandleARB, GLsizei, GLsizei *, GLcharARB *); -GLAPI void APIENTRY glGetAttachedObjectsARB (GLhandleARB, GLsizei, GLsizei *, GLhandleARB *); -GLAPI GLint APIENTRY glGetUniformLocationARB (GLhandleARB, const GLcharARB *); -GLAPI void APIENTRY glGetActiveUniformARB (GLhandleARB, GLuint, GLsizei, GLsizei *, GLint *, GLenum *, GLcharARB *); -GLAPI void APIENTRY glGetUniformfvARB (GLhandleARB, GLint, GLfloat *); -GLAPI void APIENTRY glGetUniformivARB (GLhandleARB, GLint, GLint *); -GLAPI void APIENTRY glGetShaderSourceARB (GLhandleARB, GLsizei, GLsizei *, GLcharARB *); -#endif /* GL_GLEXT_PROTOTYPES */ -typedef void (APIENTRYP PFNGLDELETEOBJECTARBPROC) (GLhandleARB obj); -typedef GLhandleARB (APIENTRYP PFNGLGETHANDLEARBPROC) (GLenum pname); -typedef void (APIENTRYP PFNGLDETACHOBJECTARBPROC) (GLhandleARB containerObj, GLhandleARB attachedObj); -typedef GLhandleARB (APIENTRYP PFNGLCREATESHADEROBJECTARBPROC) (GLenum shaderType); -typedef void (APIENTRYP PFNGLSHADERSOURCEARBPROC) (GLhandleARB shaderObj, GLsizei count, const GLcharARB* *string, const GLint *length); -typedef void (APIENTRYP PFNGLCOMPILESHADERARBPROC) (GLhandleARB shaderObj); -typedef GLhandleARB (APIENTRYP PFNGLCREATEPROGRAMOBJECTARBPROC) (void); -typedef void (APIENTRYP PFNGLATTACHOBJECTARBPROC) (GLhandleARB containerObj, GLhandleARB obj); -typedef void (APIENTRYP PFNGLLINKPROGRAMARBPROC) (GLhandleARB programObj); -typedef void (APIENTRYP PFNGLUSEPROGRAMOBJECTARBPROC) (GLhandleARB programObj); -typedef void (APIENTRYP PFNGLVALIDATEPROGRAMARBPROC) (GLhandleARB programObj); -typedef void (APIENTRYP PFNGLUNIFORM1FARBPROC) (GLint location, GLfloat v0); -typedef void (APIENTRYP PFNGLUNIFORM2FARBPROC) (GLint location, GLfloat v0, GLfloat v1); -typedef void (APIENTRYP PFNGLUNIFORM3FARBPROC) (GLint location, GLfloat v0, GLfloat v1, GLfloat v2); -typedef void (APIENTRYP PFNGLUNIFORM4FARBPROC) (GLint location, GLfloat v0, GLfloat v1, GLfloat v2, GLfloat v3); -typedef void (APIENTRYP PFNGLUNIFORM1IARBPROC) (GLint location, GLint v0); -typedef void (APIENTRYP PFNGLUNIFORM2IARBPROC) (GLint location, GLint v0, GLint v1); -typedef void (APIENTRYP PFNGLUNIFORM3IARBPROC) (GLint location, GLint v0, GLint v1, GLint v2); -typedef void (APIENTRYP PFNGLUNIFORM4IARBPROC) (GLint location, GLint v0, GLint v1, GLint v2, GLint v3); -typedef void (APIENTRYP PFNGLUNIFORM1FVARBPROC) (GLint location, GLsizei count, const GLfloat *value); -typedef void (APIENTRYP PFNGLUNIFORM2FVARBPROC) (GLint location, GLsizei count, const GLfloat *value); -typedef void (APIENTRYP PFNGLUNIFORM3FVARBPROC) (GLint location, GLsizei count, const GLfloat *value); -typedef void (APIENTRYP PFNGLUNIFORM4FVARBPROC) (GLint location, GLsizei count, const GLfloat *value); -typedef void (APIENTRYP PFNGLUNIFORM1IVARBPROC) (GLint location, GLsizei count, const GLint *value); -typedef void (APIENTRYP PFNGLUNIFORM2IVARBPROC) (GLint location, GLsizei count, const GLint *value); -typedef void (APIENTRYP PFNGLUNIFORM3IVARBPROC) (GLint location, GLsizei count, const GLint *value); -typedef void (APIENTRYP PFNGLUNIFORM4IVARBPROC) (GLint location, GLsizei count, const GLint *value); -typedef void (APIENTRYP PFNGLUNIFORMMATRIX2FVARBPROC) (GLint location, GLsizei count, GLboolean transpose, const GLfloat *value); -typedef void (APIENTRYP PFNGLUNIFORMMATRIX3FVARBPROC) (GLint location, GLsizei count, GLboolean transpose, const GLfloat *value); -typedef void (APIENTRYP PFNGLUNIFORMMATRIX4FVARBPROC) (GLint location, GLsizei count, GLboolean transpose, const GLfloat *value); -typedef void (APIENTRYP PFNGLGETOBJECTPARAMETERFVARBPROC) (GLhandleARB obj, GLenum pname, GLfloat *params); -typedef void (APIENTRYP PFNGLGETOBJECTPARAMETERIVARBPROC) (GLhandleARB obj, GLenum pname, GLint *params); -typedef void (APIENTRYP PFNGLGETINFOLOGARBPROC) (GLhandleARB obj, GLsizei maxLength, GLsizei *length, GLcharARB *infoLog); -typedef void (APIENTRYP PFNGLGETATTACHEDOBJECTSARBPROC) (GLhandleARB containerObj, GLsizei maxCount, GLsizei *count, GLhandleARB *obj); -typedef GLint (APIENTRYP PFNGLGETUNIFORMLOCATIONARBPROC) (GLhandleARB programObj, const GLcharARB *name); -typedef void (APIENTRYP PFNGLGETACTIVEUNIFORMARBPROC) (GLhandleARB programObj, GLuint index, GLsizei maxLength, GLsizei *length, GLint *size, GLenum *type, GLcharARB *name); -typedef void (APIENTRYP PFNGLGETUNIFORMFVARBPROC) (GLhandleARB programObj, GLint location, GLfloat *params); -typedef void (APIENTRYP PFNGLGETUNIFORMIVARBPROC) (GLhandleARB programObj, GLint location, GLint *params); -typedef void (APIENTRYP PFNGLGETSHADERSOURCEARBPROC) (GLhandleARB obj, GLsizei maxLength, GLsizei *length, GLcharARB *source); -#endif - -#ifndef GL_ARB_vertex_shader -#define GL_ARB_vertex_shader 1 -#ifdef GL_GLEXT_PROTOTYPES -GLAPI void APIENTRY glBindAttribLocationARB (GLhandleARB, GLuint, const GLcharARB *); -GLAPI void APIENTRY glGetActiveAttribARB (GLhandleARB, GLuint, GLsizei, GLsizei *, GLint *, GLenum *, GLcharARB *); -GLAPI GLint APIENTRY glGetAttribLocationARB (GLhandleARB, const GLcharARB *); -#endif /* GL_GLEXT_PROTOTYPES */ -typedef void (APIENTRYP PFNGLBINDATTRIBLOCATIONARBPROC) (GLhandleARB programObj, GLuint index, const GLcharARB *name); -typedef void (APIENTRYP PFNGLGETACTIVEATTRIBARBPROC) (GLhandleARB programObj, GLuint index, GLsizei maxLength, GLsizei *length, GLint *size, GLenum *type, GLcharARB *name); -typedef GLint (APIENTRYP PFNGLGETATTRIBLOCATIONARBPROC) (GLhandleARB programObj, const GLcharARB *name); -#endif - -#ifndef GL_ARB_fragment_shader -#define GL_ARB_fragment_shader 1 -#endif - -#ifndef GL_ARB_shading_language_100 -#define GL_ARB_shading_language_100 1 -#endif - -#ifndef GL_ARB_texture_non_power_of_two -#define GL_ARB_texture_non_power_of_two 1 -#endif - -#ifndef GL_ARB_point_sprite -#define GL_ARB_point_sprite 1 -#endif - -#ifndef GL_ARB_fragment_program_shadow -#define GL_ARB_fragment_program_shadow 1 -#endif - -#ifndef GL_ARB_draw_buffers -#define GL_ARB_draw_buffers 1 -#ifdef GL_GLEXT_PROTOTYPES -GLAPI void APIENTRY glDrawBuffersARB (GLsizei, const GLenum *); -#endif /* GL_GLEXT_PROTOTYPES */ -typedef void (APIENTRYP PFNGLDRAWBUFFERSARBPROC) (GLsizei n, const GLenum *bufs); -#endif - -#ifndef GL_ARB_texture_rectangle -#define GL_ARB_texture_rectangle 1 -#endif - -#ifndef GL_ARB_color_buffer_float -#define GL_ARB_color_buffer_float 1 -#ifdef GL_GLEXT_PROTOTYPES -GLAPI void APIENTRY glClampColorARB (GLenum, GLenum); -#endif /* GL_GLEXT_PROTOTYPES */ -typedef void (APIENTRYP PFNGLCLAMPCOLORARBPROC) (GLenum target, GLenum clamp); -#endif - -#ifndef GL_ARB_half_float_pixel -#define GL_ARB_half_float_pixel 1 -#endif - -#ifndef GL_ARB_texture_float -#define GL_ARB_texture_float 1 -#endif - -#ifndef GL_ARB_pixel_buffer_object -#define GL_ARB_pixel_buffer_object 1 -#endif - -#ifndef GL_EXT_abgr -#define GL_EXT_abgr 1 -#endif - -#ifndef GL_EXT_blend_color -#define GL_EXT_blend_color 1 -#ifdef GL_GLEXT_PROTOTYPES -GLAPI void APIENTRY glBlendColorEXT (GLclampf, GLclampf, GLclampf, GLclampf); -#endif /* GL_GLEXT_PROTOTYPES */ -typedef void (APIENTRYP PFNGLBLENDCOLOREXTPROC) (GLclampf red, GLclampf green, GLclampf blue, GLclampf alpha); -#endif - -#ifndef GL_EXT_polygon_offset -#define GL_EXT_polygon_offset 1 -#ifdef GL_GLEXT_PROTOTYPES -GLAPI void APIENTRY glPolygonOffsetEXT (GLfloat, GLfloat); -#endif /* GL_GLEXT_PROTOTYPES */ -typedef void (APIENTRYP PFNGLPOLYGONOFFSETEXTPROC) (GLfloat factor, GLfloat bias); -#endif - -#ifndef GL_EXT_texture -#define GL_EXT_texture 1 -#endif - -#ifndef GL_EXT_texture3D -#define GL_EXT_texture3D 1 -#ifdef GL_GLEXT_PROTOTYPES -GLAPI void APIENTRY glTexImage3DEXT (GLenum, GLint, GLenum, GLsizei, GLsizei, GLsizei, GLint, GLenum, GLenum, const GLvoid *); -GLAPI void APIENTRY glTexSubImage3DEXT (GLenum, GLint, GLint, GLint, GLint, GLsizei, GLsizei, GLsizei, GLenum, GLenum, const GLvoid *); -#endif /* GL_GLEXT_PROTOTYPES */ -typedef void (APIENTRYP PFNGLTEXIMAGE3DEXTPROC) (GLenum target, GLint level, GLenum internalformat, GLsizei width, GLsizei height, GLsizei depth, GLint border, GLenum format, GLenum type, const GLvoid *pixels); -typedef void (APIENTRYP PFNGLTEXSUBIMAGE3DEXTPROC) (GLenum target, GLint level, GLint xoffset, GLint yoffset, GLint zoffset, GLsizei width, GLsizei height, GLsizei depth, GLenum format, GLenum type, const GLvoid *pixels); -#endif - -#ifndef GL_SGIS_texture_filter4 -#define GL_SGIS_texture_filter4 1 -#ifdef GL_GLEXT_PROTOTYPES -GLAPI void APIENTRY glGetTexFilterFuncSGIS (GLenum, GLenum, GLfloat *); -GLAPI void APIENTRY glTexFilterFuncSGIS (GLenum, GLenum, GLsizei, const GLfloat *); -#endif /* GL_GLEXT_PROTOTYPES */ -typedef void (APIENTRYP PFNGLGETTEXFILTERFUNCSGISPROC) (GLenum target, GLenum filter, GLfloat *weights); -typedef void (APIENTRYP PFNGLTEXFILTERFUNCSGISPROC) (GLenum target, GLenum filter, GLsizei n, const GLfloat *weights); -#endif - -#ifndef GL_EXT_subtexture -#define GL_EXT_subtexture 1 -#ifdef GL_GLEXT_PROTOTYPES -GLAPI void APIENTRY glTexSubImage1DEXT (GLenum, GLint, GLint, GLsizei, GLenum, GLenum, const GLvoid *); -GLAPI void APIENTRY glTexSubImage2DEXT (GLenum, GLint, GLint, GLint, GLsizei, GLsizei, GLenum, GLenum, const GLvoid *); -#endif /* GL_GLEXT_PROTOTYPES */ -typedef void (APIENTRYP PFNGLTEXSUBIMAGE1DEXTPROC) (GLenum target, GLint level, GLint xoffset, GLsizei width, GLenum format, GLenum type, const GLvoid *pixels); -typedef void (APIENTRYP PFNGLTEXSUBIMAGE2DEXTPROC) (GLenum target, GLint level, GLint xoffset, GLint yoffset, GLsizei width, GLsizei height, GLenum format, GLenum type, const GLvoid *pixels); -#endif - -#ifndef GL_EXT_copy_texture -#define GL_EXT_copy_texture 1 -#ifdef GL_GLEXT_PROTOTYPES -GLAPI void APIENTRY glCopyTexImage1DEXT (GLenum, GLint, GLenum, GLint, GLint, GLsizei, GLint); -GLAPI void APIENTRY glCopyTexImage2DEXT (GLenum, GLint, GLenum, GLint, GLint, GLsizei, GLsizei, GLint); -GLAPI void APIENTRY glCopyTexSubImage1DEXT (GLenum, GLint, GLint, GLint, GLint, GLsizei); -GLAPI void APIENTRY glCopyTexSubImage2DEXT (GLenum, GLint, GLint, GLint, GLint, GLint, GLsizei, GLsizei); -GLAPI void APIENTRY glCopyTexSubImage3DEXT (GLenum, GLint, GLint, GLint, GLint, GLint, GLint, GLsizei, GLsizei); -#endif /* GL_GLEXT_PROTOTYPES */ -typedef void (APIENTRYP PFNGLCOPYTEXIMAGE1DEXTPROC) (GLenum target, GLint level, GLenum internalformat, GLint x, GLint y, GLsizei width, GLint border); -typedef void (APIENTRYP PFNGLCOPYTEXIMAGE2DEXTPROC) (GLenum target, GLint level, GLenum internalformat, GLint x, GLint y, GLsizei width, GLsizei height, GLint border); -typedef void (APIENTRYP PFNGLCOPYTEXSUBIMAGE1DEXTPROC) (GLenum target, GLint level, GLint xoffset, GLint x, GLint y, GLsizei width); -typedef void (APIENTRYP PFNGLCOPYTEXSUBIMAGE2DEXTPROC) (GLenum target, GLint level, GLint xoffset, GLint yoffset, GLint x, GLint y, GLsizei width, GLsizei height); -typedef void (APIENTRYP PFNGLCOPYTEXSUBIMAGE3DEXTPROC) (GLenum target, GLint level, GLint xoffset, GLint yoffset, GLint zoffset, GLint x, GLint y, GLsizei width, GLsizei height); -#endif - -#ifndef GL_EXT_histogram -#define GL_EXT_histogram 1 -#ifdef GL_GLEXT_PROTOTYPES -GLAPI void APIENTRY glGetHistogramEXT (GLenum, GLboolean, GLenum, GLenum, GLvoid *); -GLAPI void APIENTRY glGetHistogramParameterfvEXT (GLenum, GLenum, GLfloat *); -GLAPI void APIENTRY glGetHistogramParameterivEXT (GLenum, GLenum, GLint *); -GLAPI void APIENTRY glGetMinmaxEXT (GLenum, GLboolean, GLenum, GLenum, GLvoid *); -GLAPI void APIENTRY glGetMinmaxParameterfvEXT (GLenum, GLenum, GLfloat *); -GLAPI void APIENTRY glGetMinmaxParameterivEXT (GLenum, GLenum, GLint *); -GLAPI void APIENTRY glHistogramEXT (GLenum, GLsizei, GLenum, GLboolean); -GLAPI void APIENTRY glMinmaxEXT (GLenum, GLenum, GLboolean); -GLAPI void APIENTRY glResetHistogramEXT (GLenum); -GLAPI void APIENTRY glResetMinmaxEXT (GLenum); -#endif /* GL_GLEXT_PROTOTYPES */ -typedef void (APIENTRYP PFNGLGETHISTOGRAMEXTPROC) (GLenum target, GLboolean reset, GLenum format, GLenum type, GLvoid *values); -typedef void (APIENTRYP PFNGLGETHISTOGRAMPARAMETERFVEXTPROC) (GLenum target, GLenum pname, GLfloat *params); -typedef void (APIENTRYP PFNGLGETHISTOGRAMPARAMETERIVEXTPROC) (GLenum target, GLenum pname, GLint *params); -typedef void (APIENTRYP PFNGLGETMINMAXEXTPROC) (GLenum target, GLboolean reset, GLenum format, GLenum type, GLvoid *values); -typedef void (APIENTRYP PFNGLGETMINMAXPARAMETERFVEXTPROC) (GLenum target, GLenum pname, GLfloat *params); -typedef void (APIENTRYP PFNGLGETMINMAXPARAMETERIVEXTPROC) (GLenum target, GLenum pname, GLint *params); -typedef void (APIENTRYP PFNGLHISTOGRAMEXTPROC) (GLenum target, GLsizei width, GLenum internalformat, GLboolean sink); -typedef void (APIENTRYP PFNGLMINMAXEXTPROC) (GLenum target, GLenum internalformat, GLboolean sink); -typedef void (APIENTRYP PFNGLRESETHISTOGRAMEXTPROC) (GLenum target); -typedef void (APIENTRYP PFNGLRESETMINMAXEXTPROC) (GLenum target); -#endif - -#ifndef GL_EXT_convolution -#define GL_EXT_convolution 1 -#ifdef GL_GLEXT_PROTOTYPES -GLAPI void APIENTRY glConvolutionFilter1DEXT (GLenum, GLenum, GLsizei, GLenum, GLenum, const GLvoid *); -GLAPI void APIENTRY glConvolutionFilter2DEXT (GLenum, GLenum, GLsizei, GLsizei, GLenum, GLenum, const GLvoid *); -GLAPI void APIENTRY glConvolutionParameterfEXT (GLenum, GLenum, GLfloat); -GLAPI void APIENTRY glConvolutionParameterfvEXT (GLenum, GLenum, const GLfloat *); -GLAPI void APIENTRY glConvolutionParameteriEXT (GLenum, GLenum, GLint); -GLAPI void APIENTRY glConvolutionParameterivEXT (GLenum, GLenum, const GLint *); -GLAPI void APIENTRY glCopyConvolutionFilter1DEXT (GLenum, GLenum, GLint, GLint, GLsizei); -GLAPI void APIENTRY glCopyConvolutionFilter2DEXT (GLenum, GLenum, GLint, GLint, GLsizei, GLsizei); -GLAPI void APIENTRY glGetConvolutionFilterEXT (GLenum, GLenum, GLenum, GLvoid *); -GLAPI void APIENTRY glGetConvolutionParameterfvEXT (GLenum, GLenum, GLfloat *); -GLAPI void APIENTRY glGetConvolutionParameterivEXT (GLenum, GLenum, GLint *); -GLAPI void APIENTRY glGetSeparableFilterEXT (GLenum, GLenum, GLenum, GLvoid *, GLvoid *, GLvoid *); -GLAPI void APIENTRY glSeparableFilter2DEXT (GLenum, GLenum, GLsizei, GLsizei, GLenum, GLenum, const GLvoid *, const GLvoid *); -#endif /* GL_GLEXT_PROTOTYPES */ -typedef void (APIENTRYP PFNGLCONVOLUTIONFILTER1DEXTPROC) (GLenum target, GLenum internalformat, GLsizei width, GLenum format, GLenum type, const GLvoid *image); -typedef void (APIENTRYP PFNGLCONVOLUTIONFILTER2DEXTPROC) (GLenum target, GLenum internalformat, GLsizei width, GLsizei height, GLenum format, GLenum type, const GLvoid *image); -typedef void (APIENTRYP PFNGLCONVOLUTIONPARAMETERFEXTPROC) (GLenum target, GLenum pname, GLfloat params); -typedef void (APIENTRYP PFNGLCONVOLUTIONPARAMETERFVEXTPROC) (GLenum target, GLenum pname, const GLfloat *params); -typedef void (APIENTRYP PFNGLCONVOLUTIONPARAMETERIEXTPROC) (GLenum target, GLenum pname, GLint params); -typedef void (APIENTRYP PFNGLCONVOLUTIONPARAMETERIVEXTPROC) (GLenum target, GLenum pname, const GLint *params); -typedef void (APIENTRYP PFNGLCOPYCONVOLUTIONFILTER1DEXTPROC) (GLenum target, GLenum internalformat, GLint x, GLint y, GLsizei width); -typedef void (APIENTRYP PFNGLCOPYCONVOLUTIONFILTER2DEXTPROC) (GLenum target, GLenum internalformat, GLint x, GLint y, GLsizei width, GLsizei height); -typedef void (APIENTRYP PFNGLGETCONVOLUTIONFILTEREXTPROC) (GLenum target, GLenum format, GLenum type, GLvoid *image); -typedef void (APIENTRYP PFNGLGETCONVOLUTIONPARAMETERFVEXTPROC) (GLenum target, GLenum pname, GLfloat *params); -typedef void (APIENTRYP PFNGLGETCONVOLUTIONPARAMETERIVEXTPROC) (GLenum target, GLenum pname, GLint *params); -typedef void (APIENTRYP PFNGLGETSEPARABLEFILTEREXTPROC) (GLenum target, GLenum format, GLenum type, GLvoid *row, GLvoid *column, GLvoid *span); -typedef void (APIENTRYP PFNGLSEPARABLEFILTER2DEXTPROC) (GLenum target, GLenum internalformat, GLsizei width, GLsizei height, GLenum format, GLenum type, const GLvoid *row, const GLvoid *column); -#endif - -#ifndef GL_EXT_color_matrix -#define GL_EXT_color_matrix 1 -#endif - -#ifndef GL_SGI_color_table -#define GL_SGI_color_table 1 -#ifdef GL_GLEXT_PROTOTYPES -GLAPI void APIENTRY glColorTableSGI (GLenum, GLenum, GLsizei, GLenum, GLenum, const GLvoid *); -GLAPI void APIENTRY glColorTableParameterfvSGI (GLenum, GLenum, const GLfloat *); -GLAPI void APIENTRY glColorTableParameterivSGI (GLenum, GLenum, const GLint *); -GLAPI void APIENTRY glCopyColorTableSGI (GLenum, GLenum, GLint, GLint, GLsizei); -GLAPI void APIENTRY glGetColorTableSGI (GLenum, GLenum, GLenum, GLvoid *); -GLAPI void APIENTRY glGetColorTableParameterfvSGI (GLenum, GLenum, GLfloat *); -GLAPI void APIENTRY glGetColorTableParameterivSGI (GLenum, GLenum, GLint *); -#endif /* GL_GLEXT_PROTOTYPES */ -typedef void (APIENTRYP PFNGLCOLORTABLESGIPROC) (GLenum target, GLenum internalformat, GLsizei width, GLenum format, GLenum type, const GLvoid *table); -typedef void (APIENTRYP PFNGLCOLORTABLEPARAMETERFVSGIPROC) (GLenum target, GLenum pname, const GLfloat *params); -typedef void (APIENTRYP PFNGLCOLORTABLEPARAMETERIVSGIPROC) (GLenum target, GLenum pname, const GLint *params); -typedef void (APIENTRYP PFNGLCOPYCOLORTABLESGIPROC) (GLenum target, GLenum internalformat, GLint x, GLint y, GLsizei width); -typedef void (APIENTRYP PFNGLGETCOLORTABLESGIPROC) (GLenum target, GLenum format, GLenum type, GLvoid *table); -typedef void (APIENTRYP PFNGLGETCOLORTABLEPARAMETERFVSGIPROC) (GLenum target, GLenum pname, GLfloat *params); -typedef void (APIENTRYP PFNGLGETCOLORTABLEPARAMETERIVSGIPROC) (GLenum target, GLenum pname, GLint *params); -#endif - -#ifndef GL_SGIX_pixel_texture -#define GL_SGIX_pixel_texture 1 -#ifdef GL_GLEXT_PROTOTYPES -GLAPI void APIENTRY glPixelTexGenSGIX (GLenum); -#endif /* GL_GLEXT_PROTOTYPES */ -typedef void (APIENTRYP PFNGLPIXELTEXGENSGIXPROC) (GLenum mode); -#endif - -#ifndef GL_SGIS_pixel_texture -#define GL_SGIS_pixel_texture 1 -#ifdef GL_GLEXT_PROTOTYPES -GLAPI void APIENTRY glPixelTexGenParameteriSGIS (GLenum, GLint); -GLAPI void APIENTRY glPixelTexGenParameterivSGIS (GLenum, const GLint *); -GLAPI void APIENTRY glPixelTexGenParameterfSGIS (GLenum, GLfloat); -GLAPI void APIENTRY glPixelTexGenParameterfvSGIS (GLenum, const GLfloat *); -GLAPI void APIENTRY glGetPixelTexGenParameterivSGIS (GLenum, GLint *); -GLAPI void APIENTRY glGetPixelTexGenParameterfvSGIS (GLenum, GLfloat *); -#endif /* GL_GLEXT_PROTOTYPES */ -typedef void (APIENTRYP PFNGLPIXELTEXGENPARAMETERISGISPROC) (GLenum pname, GLint param); -typedef void (APIENTRYP PFNGLPIXELTEXGENPARAMETERIVSGISPROC) (GLenum pname, const GLint *params); -typedef void (APIENTRYP PFNGLPIXELTEXGENPARAMETERFSGISPROC) (GLenum pname, GLfloat param); -typedef void (APIENTRYP PFNGLPIXELTEXGENPARAMETERFVSGISPROC) (GLenum pname, const GLfloat *params); -typedef void (APIENTRYP PFNGLGETPIXELTEXGENPARAMETERIVSGISPROC) (GLenum pname, GLint *params); -typedef void (APIENTRYP PFNGLGETPIXELTEXGENPARAMETERFVSGISPROC) (GLenum pname, GLfloat *params); -#endif - -#ifndef GL_SGIS_texture4D -#define GL_SGIS_texture4D 1 -#ifdef GL_GLEXT_PROTOTYPES -GLAPI void APIENTRY glTexImage4DSGIS (GLenum, GLint, GLenum, GLsizei, GLsizei, GLsizei, GLsizei, GLint, GLenum, GLenum, const GLvoid *); -GLAPI void APIENTRY glTexSubImage4DSGIS (GLenum, GLint, GLint, GLint, GLint, GLint, GLsizei, GLsizei, GLsizei, GLsizei, GLenum, GLenum, const GLvoid *); -#endif /* GL_GLEXT_PROTOTYPES */ -typedef void (APIENTRYP PFNGLTEXIMAGE4DSGISPROC) (GLenum target, GLint level, GLenum internalformat, GLsizei width, GLsizei height, GLsizei depth, GLsizei size4d, GLint border, GLenum format, GLenum type, const GLvoid *pixels); -typedef void (APIENTRYP PFNGLTEXSUBIMAGE4DSGISPROC) (GLenum target, GLint level, GLint xoffset, GLint yoffset, GLint zoffset, GLint woffset, GLsizei width, GLsizei height, GLsizei depth, GLsizei size4d, GLenum format, GLenum type, const GLvoid *pixels); -#endif - -#ifndef GL_SGI_texture_color_table -#define GL_SGI_texture_color_table 1 -#endif - -#ifndef GL_EXT_cmyka -#define GL_EXT_cmyka 1 -#endif - -#ifndef GL_EXT_texture_object -#define GL_EXT_texture_object 1 -#ifdef GL_GLEXT_PROTOTYPES -GLAPI GLboolean APIENTRY glAreTexturesResidentEXT (GLsizei, const GLuint *, GLboolean *); -GLAPI void APIENTRY glBindTextureEXT (GLenum, GLuint); -GLAPI void APIENTRY glDeleteTexturesEXT (GLsizei, const GLuint *); -GLAPI void APIENTRY glGenTexturesEXT (GLsizei, GLuint *); -GLAPI GLboolean APIENTRY glIsTextureEXT (GLuint); -GLAPI void APIENTRY glPrioritizeTexturesEXT (GLsizei, const GLuint *, const GLclampf *); -#endif /* GL_GLEXT_PROTOTYPES */ -typedef GLboolean (APIENTRYP PFNGLARETEXTURESRESIDENTEXTPROC) (GLsizei n, const GLuint *textures, GLboolean *residences); -typedef void (APIENTRYP PFNGLBINDTEXTUREEXTPROC) (GLenum target, GLuint texture); -typedef void (APIENTRYP PFNGLDELETETEXTURESEXTPROC) (GLsizei n, const GLuint *textures); -typedef void (APIENTRYP PFNGLGENTEXTURESEXTPROC) (GLsizei n, GLuint *textures); -typedef GLboolean (APIENTRYP PFNGLISTEXTUREEXTPROC) (GLuint texture); -typedef void (APIENTRYP PFNGLPRIORITIZETEXTURESEXTPROC) (GLsizei n, const GLuint *textures, const GLclampf *priorities); -#endif - -#ifndef GL_SGIS_detail_texture -#define GL_SGIS_detail_texture 1 -#ifdef GL_GLEXT_PROTOTYPES -GLAPI void APIENTRY glDetailTexFuncSGIS (GLenum, GLsizei, const GLfloat *); -GLAPI void APIENTRY glGetDetailTexFuncSGIS (GLenum, GLfloat *); -#endif /* GL_GLEXT_PROTOTYPES */ -typedef void (APIENTRYP PFNGLDETAILTEXFUNCSGISPROC) (GLenum target, GLsizei n, const GLfloat *points); -typedef void (APIENTRYP PFNGLGETDETAILTEXFUNCSGISPROC) (GLenum target, GLfloat *points); -#endif - -#ifndef GL_SGIS_sharpen_texture -#define GL_SGIS_sharpen_texture 1 -#ifdef GL_GLEXT_PROTOTYPES -GLAPI void APIENTRY glSharpenTexFuncSGIS (GLenum, GLsizei, const GLfloat *); -GLAPI void APIENTRY glGetSharpenTexFuncSGIS (GLenum, GLfloat *); -#endif /* GL_GLEXT_PROTOTYPES */ -typedef void (APIENTRYP PFNGLSHARPENTEXFUNCSGISPROC) (GLenum target, GLsizei n, const GLfloat *points); -typedef void (APIENTRYP PFNGLGETSHARPENTEXFUNCSGISPROC) (GLenum target, GLfloat *points); -#endif - -#ifndef GL_EXT_packed_pixels -#define GL_EXT_packed_pixels 1 -#endif - -#ifndef GL_SGIS_texture_lod -#define GL_SGIS_texture_lod 1 -#endif - -#ifndef GL_SGIS_multisample -#define GL_SGIS_multisample 1 -#ifdef GL_GLEXT_PROTOTYPES -GLAPI void APIENTRY glSampleMaskSGIS (GLclampf, GLboolean); -GLAPI void APIENTRY glSamplePatternSGIS (GLenum); -#endif /* GL_GLEXT_PROTOTYPES */ -typedef void (APIENTRYP PFNGLSAMPLEMASKSGISPROC) (GLclampf value, GLboolean invert); -typedef void (APIENTRYP PFNGLSAMPLEPATTERNSGISPROC) (GLenum pattern); -#endif - -#ifndef GL_EXT_rescale_normal -#define GL_EXT_rescale_normal 1 -#endif - -#ifndef GL_EXT_vertex_array -#define GL_EXT_vertex_array 1 -#ifdef GL_GLEXT_PROTOTYPES -GLAPI void APIENTRY glArrayElementEXT (GLint); -GLAPI void APIENTRY glColorPointerEXT (GLint, GLenum, GLsizei, GLsizei, const GLvoid *); -GLAPI void APIENTRY glDrawArraysEXT (GLenum, GLint, GLsizei); -GLAPI void APIENTRY glEdgeFlagPointerEXT (GLsizei, GLsizei, const GLboolean *); -GLAPI void APIENTRY glGetPointervEXT (GLenum, GLvoid* *); -GLAPI void APIENTRY glIndexPointerEXT (GLenum, GLsizei, GLsizei, const GLvoid *); -GLAPI void APIENTRY glNormalPointerEXT (GLenum, GLsizei, GLsizei, const GLvoid *); -GLAPI void APIENTRY glTexCoordPointerEXT (GLint, GLenum, GLsizei, GLsizei, const GLvoid *); -GLAPI void APIENTRY glVertexPointerEXT (GLint, GLenum, GLsizei, GLsizei, const GLvoid *); -#endif /* GL_GLEXT_PROTOTYPES */ -typedef void (APIENTRYP PFNGLARRAYELEMENTEXTPROC) (GLint i); -typedef void (APIENTRYP PFNGLCOLORPOINTEREXTPROC) (GLint size, GLenum type, GLsizei stride, GLsizei count, const GLvoid *pointer); -typedef void (APIENTRYP PFNGLDRAWARRAYSEXTPROC) (GLenum mode, GLint first, GLsizei count); -typedef void (APIENTRYP PFNGLEDGEFLAGPOINTEREXTPROC) (GLsizei stride, GLsizei count, const GLboolean *pointer); -typedef void (APIENTRYP PFNGLGETPOINTERVEXTPROC) (GLenum pname, GLvoid* *params); -typedef void (APIENTRYP PFNGLINDEXPOINTEREXTPROC) (GLenum type, GLsizei stride, GLsizei count, const GLvoid *pointer); -typedef void (APIENTRYP PFNGLNORMALPOINTEREXTPROC) (GLenum type, GLsizei stride, GLsizei count, const GLvoid *pointer); -typedef void (APIENTRYP PFNGLTEXCOORDPOINTEREXTPROC) (GLint size, GLenum type, GLsizei stride, GLsizei count, const GLvoid *pointer); -typedef void (APIENTRYP PFNGLVERTEXPOINTEREXTPROC) (GLint size, GLenum type, GLsizei stride, GLsizei count, const GLvoid *pointer); -#endif - -#ifndef GL_EXT_misc_attribute -#define GL_EXT_misc_attribute 1 -#endif - -#ifndef GL_SGIS_generate_mipmap -#define GL_SGIS_generate_mipmap 1 -#endif - -#ifndef GL_SGIX_clipmap -#define GL_SGIX_clipmap 1 -#endif - -#ifndef GL_SGIX_shadow -#define GL_SGIX_shadow 1 -#endif - -#ifndef GL_SGIS_texture_edge_clamp -#define GL_SGIS_texture_edge_clamp 1 -#endif - -#ifndef GL_SGIS_texture_border_clamp -#define GL_SGIS_texture_border_clamp 1 -#endif - -#ifndef GL_EXT_blend_minmax -#define GL_EXT_blend_minmax 1 -#ifdef GL_GLEXT_PROTOTYPES -GLAPI void APIENTRY glBlendEquationEXT (GLenum); -#endif /* GL_GLEXT_PROTOTYPES */ -typedef void (APIENTRYP PFNGLBLENDEQUATIONEXTPROC) (GLenum mode); -#endif - -#ifndef GL_EXT_blend_subtract -#define GL_EXT_blend_subtract 1 -#endif - -#ifndef GL_EXT_blend_logic_op -#define GL_EXT_blend_logic_op 1 -#endif - -#ifndef GL_SGIX_interlace -#define GL_SGIX_interlace 1 -#endif - -#ifndef GL_SGIX_pixel_tiles -#define GL_SGIX_pixel_tiles 1 -#endif - -#ifndef GL_SGIX_texture_select -#define GL_SGIX_texture_select 1 -#endif - -#ifndef GL_SGIX_sprite -#define GL_SGIX_sprite 1 -#ifdef GL_GLEXT_PROTOTYPES -GLAPI void APIENTRY glSpriteParameterfSGIX (GLenum, GLfloat); -GLAPI void APIENTRY glSpriteParameterfvSGIX (GLenum, const GLfloat *); -GLAPI void APIENTRY glSpriteParameteriSGIX (GLenum, GLint); -GLAPI void APIENTRY glSpriteParameterivSGIX (GLenum, const GLint *); -#endif /* GL_GLEXT_PROTOTYPES */ -typedef void (APIENTRYP PFNGLSPRITEPARAMETERFSGIXPROC) (GLenum pname, GLfloat param); -typedef void (APIENTRYP PFNGLSPRITEPARAMETERFVSGIXPROC) (GLenum pname, const GLfloat *params); -typedef void (APIENTRYP PFNGLSPRITEPARAMETERISGIXPROC) (GLenum pname, GLint param); -typedef void (APIENTRYP PFNGLSPRITEPARAMETERIVSGIXPROC) (GLenum pname, const GLint *params); -#endif - -#ifndef GL_SGIX_texture_multi_buffer -#define GL_SGIX_texture_multi_buffer 1 -#endif - -#ifndef GL_EXT_point_parameters -#define GL_EXT_point_parameters 1 -#ifdef GL_GLEXT_PROTOTYPES -GLAPI void APIENTRY glPointParameterfEXT (GLenum, GLfloat); -GLAPI void APIENTRY glPointParameterfvEXT (GLenum, const GLfloat *); -#endif /* GL_GLEXT_PROTOTYPES */ -typedef void (APIENTRYP PFNGLPOINTPARAMETERFEXTPROC) (GLenum pname, GLfloat param); -typedef void (APIENTRYP PFNGLPOINTPARAMETERFVEXTPROC) (GLenum pname, const GLfloat *params); -#endif - -#ifndef GL_SGIS_point_parameters -#define GL_SGIS_point_parameters 1 -#ifdef GL_GLEXT_PROTOTYPES -GLAPI void APIENTRY glPointParameterfSGIS (GLenum, GLfloat); -GLAPI void APIENTRY glPointParameterfvSGIS (GLenum, const GLfloat *); -#endif /* GL_GLEXT_PROTOTYPES */ -typedef void (APIENTRYP PFNGLPOINTPARAMETERFSGISPROC) (GLenum pname, GLfloat param); -typedef void (APIENTRYP PFNGLPOINTPARAMETERFVSGISPROC) (GLenum pname, const GLfloat *params); -#endif - -#ifndef GL_SGIX_instruments -#define GL_SGIX_instruments 1 -#ifdef GL_GLEXT_PROTOTYPES -GLAPI GLint APIENTRY glGetInstrumentsSGIX (void); -GLAPI void APIENTRY glInstrumentsBufferSGIX (GLsizei, GLint *); -GLAPI GLint APIENTRY glPollInstrumentsSGIX (GLint *); -GLAPI void APIENTRY glReadInstrumentsSGIX (GLint); -GLAPI void APIENTRY glStartInstrumentsSGIX (void); -GLAPI void APIENTRY glStopInstrumentsSGIX (GLint); -#endif /* GL_GLEXT_PROTOTYPES */ -typedef GLint (APIENTRYP PFNGLGETINSTRUMENTSSGIXPROC) (void); -typedef void (APIENTRYP PFNGLINSTRUMENTSBUFFERSGIXPROC) (GLsizei size, GLint *buffer); -typedef GLint (APIENTRYP PFNGLPOLLINSTRUMENTSSGIXPROC) (GLint *marker_p); -typedef void (APIENTRYP PFNGLREADINSTRUMENTSSGIXPROC) (GLint marker); -typedef void (APIENTRYP PFNGLSTARTINSTRUMENTSSGIXPROC) (void); -typedef void (APIENTRYP PFNGLSTOPINSTRUMENTSSGIXPROC) (GLint marker); -#endif - -#ifndef GL_SGIX_texture_scale_bias -#define GL_SGIX_texture_scale_bias 1 -#endif - -#ifndef GL_SGIX_framezoom -#define GL_SGIX_framezoom 1 -#ifdef GL_GLEXT_PROTOTYPES -GLAPI void APIENTRY glFrameZoomSGIX (GLint); -#endif /* GL_GLEXT_PROTOTYPES */ -typedef void (APIENTRYP PFNGLFRAMEZOOMSGIXPROC) (GLint factor); -#endif - -#ifndef GL_SGIX_tag_sample_buffer -#define GL_SGIX_tag_sample_buffer 1 -#ifdef GL_GLEXT_PROTOTYPES -GLAPI void APIENTRY glTagSampleBufferSGIX (void); -#endif /* GL_GLEXT_PROTOTYPES */ -typedef void (APIENTRYP PFNGLTAGSAMPLEBUFFERSGIXPROC) (void); -#endif - -#ifndef GL_SGIX_polynomial_ffd -#define GL_SGIX_polynomial_ffd 1 -#ifdef GL_GLEXT_PROTOTYPES -GLAPI void APIENTRY glDeformationMap3dSGIX (GLenum, GLdouble, GLdouble, GLint, GLint, GLdouble, GLdouble, GLint, GLint, GLdouble, GLdouble, GLint, GLint, const GLdouble *); -GLAPI void APIENTRY glDeformationMap3fSGIX (GLenum, GLfloat, GLfloat, GLint, GLint, GLfloat, GLfloat, GLint, GLint, GLfloat, GLfloat, GLint, GLint, const GLfloat *); -GLAPI void APIENTRY glDeformSGIX (GLbitfield); -GLAPI void APIENTRY glLoadIdentityDeformationMapSGIX (GLbitfield); -#endif /* GL_GLEXT_PROTOTYPES */ -typedef void (APIENTRYP PFNGLDEFORMATIONMAP3DSGIXPROC) (GLenum target, GLdouble u1, GLdouble u2, GLint ustride, GLint uorder, GLdouble v1, GLdouble v2, GLint vstride, GLint vorder, GLdouble w1, GLdouble w2, GLint wstride, GLint worder, const GLdouble *points); -typedef void (APIENTRYP PFNGLDEFORMATIONMAP3FSGIXPROC) (GLenum target, GLfloat u1, GLfloat u2, GLint ustride, GLint uorder, GLfloat v1, GLfloat v2, GLint vstride, GLint vorder, GLfloat w1, GLfloat w2, GLint wstride, GLint worder, const GLfloat *points); -typedef void (APIENTRYP PFNGLDEFORMSGIXPROC) (GLbitfield mask); -typedef void (APIENTRYP PFNGLLOADIDENTITYDEFORMATIONMAPSGIXPROC) (GLbitfield mask); -#endif - -#ifndef GL_SGIX_reference_plane -#define GL_SGIX_reference_plane 1 -#ifdef GL_GLEXT_PROTOTYPES -GLAPI void APIENTRY glReferencePlaneSGIX (const GLdouble *); -#endif /* GL_GLEXT_PROTOTYPES */ -typedef void (APIENTRYP PFNGLREFERENCEPLANESGIXPROC) (const GLdouble *equation); -#endif - -#ifndef GL_SGIX_flush_raster -#define GL_SGIX_flush_raster 1 -#ifdef GL_GLEXT_PROTOTYPES -GLAPI void APIENTRY glFlushRasterSGIX (void); -#endif /* GL_GLEXT_PROTOTYPES */ -typedef void (APIENTRYP PFNGLFLUSHRASTERSGIXPROC) (void); -#endif - -#ifndef GL_SGIX_depth_texture -#define GL_SGIX_depth_texture 1 -#endif - -#ifndef GL_SGIS_fog_function -#define GL_SGIS_fog_function 1 -#ifdef GL_GLEXT_PROTOTYPES -GLAPI void APIENTRY glFogFuncSGIS (GLsizei, const GLfloat *); -GLAPI void APIENTRY glGetFogFuncSGIS (GLfloat *); -#endif /* GL_GLEXT_PROTOTYPES */ -typedef void (APIENTRYP PFNGLFOGFUNCSGISPROC) (GLsizei n, const GLfloat *points); -typedef void (APIENTRYP PFNGLGETFOGFUNCSGISPROC) (GLfloat *points); -#endif - -#ifndef GL_SGIX_fog_offset -#define GL_SGIX_fog_offset 1 -#endif - -#ifndef GL_HP_image_transform -#define GL_HP_image_transform 1 -#ifdef GL_GLEXT_PROTOTYPES -GLAPI void APIENTRY glImageTransformParameteriHP (GLenum, GLenum, GLint); -GLAPI void APIENTRY glImageTransformParameterfHP (GLenum, GLenum, GLfloat); -GLAPI void APIENTRY glImageTransformParameterivHP (GLenum, GLenum, const GLint *); -GLAPI void APIENTRY glImageTransformParameterfvHP (GLenum, GLenum, const GLfloat *); -GLAPI void APIENTRY glGetImageTransformParameterivHP (GLenum, GLenum, GLint *); -GLAPI void APIENTRY glGetImageTransformParameterfvHP (GLenum, GLenum, GLfloat *); -#endif /* GL_GLEXT_PROTOTYPES */ -typedef void (APIENTRYP PFNGLIMAGETRANSFORMPARAMETERIHPPROC) (GLenum target, GLenum pname, GLint param); -typedef void (APIENTRYP PFNGLIMAGETRANSFORMPARAMETERFHPPROC) (GLenum target, GLenum pname, GLfloat param); -typedef void (APIENTRYP PFNGLIMAGETRANSFORMPARAMETERIVHPPROC) (GLenum target, GLenum pname, const GLint *params); -typedef void (APIENTRYP PFNGLIMAGETRANSFORMPARAMETERFVHPPROC) (GLenum target, GLenum pname, const GLfloat *params); -typedef void (APIENTRYP PFNGLGETIMAGETRANSFORMPARAMETERIVHPPROC) (GLenum target, GLenum pname, GLint *params); -typedef void (APIENTRYP PFNGLGETIMAGETRANSFORMPARAMETERFVHPPROC) (GLenum target, GLenum pname, GLfloat *params); -#endif - -#ifndef GL_HP_convolution_border_modes -#define GL_HP_convolution_border_modes 1 -#endif - -#ifndef GL_SGIX_texture_add_env -#define GL_SGIX_texture_add_env 1 -#endif - -#ifndef GL_EXT_color_subtable -#define GL_EXT_color_subtable 1 -#ifdef GL_GLEXT_PROTOTYPES -GLAPI void APIENTRY glColorSubTableEXT (GLenum, GLsizei, GLsizei, GLenum, GLenum, const GLvoid *); -GLAPI void APIENTRY glCopyColorSubTableEXT (GLenum, GLsizei, GLint, GLint, GLsizei); -#endif /* GL_GLEXT_PROTOTYPES */ -typedef void (APIENTRYP PFNGLCOLORSUBTABLEEXTPROC) (GLenum target, GLsizei start, GLsizei count, GLenum format, GLenum type, const GLvoid *data); -typedef void (APIENTRYP PFNGLCOPYCOLORSUBTABLEEXTPROC) (GLenum target, GLsizei start, GLint x, GLint y, GLsizei width); -#endif - -#ifndef GL_PGI_vertex_hints -#define GL_PGI_vertex_hints 1 -#endif - -#ifndef GL_PGI_misc_hints -#define GL_PGI_misc_hints 1 -#ifdef GL_GLEXT_PROTOTYPES -GLAPI void APIENTRY glHintPGI (GLenum, GLint); -#endif /* GL_GLEXT_PROTOTYPES */ -typedef void (APIENTRYP PFNGLHINTPGIPROC) (GLenum target, GLint mode); -#endif - -#ifndef GL_EXT_paletted_texture -#define GL_EXT_paletted_texture 1 -#ifdef GL_GLEXT_PROTOTYPES -GLAPI void APIENTRY glColorTableEXT (GLenum, GLenum, GLsizei, GLenum, GLenum, const GLvoid *); -GLAPI void APIENTRY glGetColorTableEXT (GLenum, GLenum, GLenum, GLvoid *); -GLAPI void APIENTRY glGetColorTableParameterivEXT (GLenum, GLenum, GLint *); -GLAPI void APIENTRY glGetColorTableParameterfvEXT (GLenum, GLenum, GLfloat *); -#endif /* GL_GLEXT_PROTOTYPES */ -typedef void (APIENTRYP PFNGLCOLORTABLEEXTPROC) (GLenum target, GLenum internalFormat, GLsizei width, GLenum format, GLenum type, const GLvoid *table); -typedef void (APIENTRYP PFNGLGETCOLORTABLEEXTPROC) (GLenum target, GLenum format, GLenum type, GLvoid *data); -typedef void (APIENTRYP PFNGLGETCOLORTABLEPARAMETERIVEXTPROC) (GLenum target, GLenum pname, GLint *params); -typedef void (APIENTRYP PFNGLGETCOLORTABLEPARAMETERFVEXTPROC) (GLenum target, GLenum pname, GLfloat *params); -#endif - -#ifndef GL_EXT_clip_volume_hint -#define GL_EXT_clip_volume_hint 1 -#endif - -#ifndef GL_SGIX_list_priority -#define GL_SGIX_list_priority 1 -#ifdef GL_GLEXT_PROTOTYPES -GLAPI void APIENTRY glGetListParameterfvSGIX (GLuint, GLenum, GLfloat *); -GLAPI void APIENTRY glGetListParameterivSGIX (GLuint, GLenum, GLint *); -GLAPI void APIENTRY glListParameterfSGIX (GLuint, GLenum, GLfloat); -GLAPI void APIENTRY glListParameterfvSGIX (GLuint, GLenum, const GLfloat *); -GLAPI void APIENTRY glListParameteriSGIX (GLuint, GLenum, GLint); -GLAPI void APIENTRY glListParameterivSGIX (GLuint, GLenum, const GLint *); -#endif /* GL_GLEXT_PROTOTYPES */ -typedef void (APIENTRYP PFNGLGETLISTPARAMETERFVSGIXPROC) (GLuint list, GLenum pname, GLfloat *params); -typedef void (APIENTRYP PFNGLGETLISTPARAMETERIVSGIXPROC) (GLuint list, GLenum pname, GLint *params); -typedef void (APIENTRYP PFNGLLISTPARAMETERFSGIXPROC) (GLuint list, GLenum pname, GLfloat param); -typedef void (APIENTRYP PFNGLLISTPARAMETERFVSGIXPROC) (GLuint list, GLenum pname, const GLfloat *params); -typedef void (APIENTRYP PFNGLLISTPARAMETERISGIXPROC) (GLuint list, GLenum pname, GLint param); -typedef void (APIENTRYP PFNGLLISTPARAMETERIVSGIXPROC) (GLuint list, GLenum pname, const GLint *params); -#endif - -#ifndef GL_SGIX_ir_instrument1 -#define GL_SGIX_ir_instrument1 1 -#endif - -#ifndef GL_SGIX_calligraphic_fragment -#define GL_SGIX_calligraphic_fragment 1 -#endif - -#ifndef GL_SGIX_texture_lod_bias -#define GL_SGIX_texture_lod_bias 1 -#endif - -#ifndef GL_SGIX_shadow_ambient -#define GL_SGIX_shadow_ambient 1 -#endif - -#ifndef GL_EXT_index_texture -#define GL_EXT_index_texture 1 -#endif - -#ifndef GL_EXT_index_material -#define GL_EXT_index_material 1 -#ifdef GL_GLEXT_PROTOTYPES -GLAPI void APIENTRY glIndexMaterialEXT (GLenum, GLenum); -#endif /* GL_GLEXT_PROTOTYPES */ -typedef void (APIENTRYP PFNGLINDEXMATERIALEXTPROC) (GLenum face, GLenum mode); -#endif - -#ifndef GL_EXT_index_func -#define GL_EXT_index_func 1 -#ifdef GL_GLEXT_PROTOTYPES -GLAPI void APIENTRY glIndexFuncEXT (GLenum, GLclampf); -#endif /* GL_GLEXT_PROTOTYPES */ -typedef void (APIENTRYP PFNGLINDEXFUNCEXTPROC) (GLenum func, GLclampf ref); -#endif - -#ifndef GL_EXT_index_array_formats -#define GL_EXT_index_array_formats 1 -#endif - -#ifndef GL_EXT_compiled_vertex_array -#define GL_EXT_compiled_vertex_array 1 -#ifdef GL_GLEXT_PROTOTYPES -GLAPI void APIENTRY glLockArraysEXT (GLint, GLsizei); -GLAPI void APIENTRY glUnlockArraysEXT (void); -#endif /* GL_GLEXT_PROTOTYPES */ -typedef void (APIENTRYP PFNGLLOCKARRAYSEXTPROC) (GLint first, GLsizei count); -typedef void (APIENTRYP PFNGLUNLOCKARRAYSEXTPROC) (void); -#endif - -#ifndef GL_EXT_cull_vertex -#define GL_EXT_cull_vertex 1 -#ifdef GL_GLEXT_PROTOTYPES -GLAPI void APIENTRY glCullParameterdvEXT (GLenum, GLdouble *); -GLAPI void APIENTRY glCullParameterfvEXT (GLenum, GLfloat *); -#endif /* GL_GLEXT_PROTOTYPES */ -typedef void (APIENTRYP PFNGLCULLPARAMETERDVEXTPROC) (GLenum pname, GLdouble *params); -typedef void (APIENTRYP PFNGLCULLPARAMETERFVEXTPROC) (GLenum pname, GLfloat *params); -#endif - -#ifndef GL_SGIX_ycrcb -#define GL_SGIX_ycrcb 1 -#endif - -#ifndef GL_SGIX_fragment_lighting -#define GL_SGIX_fragment_lighting 1 -#ifdef GL_GLEXT_PROTOTYPES -GLAPI void APIENTRY glFragmentColorMaterialSGIX (GLenum, GLenum); -GLAPI void APIENTRY glFragmentLightfSGIX (GLenum, GLenum, GLfloat); -GLAPI void APIENTRY glFragmentLightfvSGIX (GLenum, GLenum, const GLfloat *); -GLAPI void APIENTRY glFragmentLightiSGIX (GLenum, GLenum, GLint); -GLAPI void APIENTRY glFragmentLightivSGIX (GLenum, GLenum, const GLint *); -GLAPI void APIENTRY glFragmentLightModelfSGIX (GLenum, GLfloat); -GLAPI void APIENTRY glFragmentLightModelfvSGIX (GLenum, const GLfloat *); -GLAPI void APIENTRY glFragmentLightModeliSGIX (GLenum, GLint); -GLAPI void APIENTRY glFragmentLightModelivSGIX (GLenum, const GLint *); -GLAPI void APIENTRY glFragmentMaterialfSGIX (GLenum, GLenum, GLfloat); -GLAPI void APIENTRY glFragmentMaterialfvSGIX (GLenum, GLenum, const GLfloat *); -GLAPI void APIENTRY glFragmentMaterialiSGIX (GLenum, GLenum, GLint); -GLAPI void APIENTRY glFragmentMaterialivSGIX (GLenum, GLenum, const GLint *); -GLAPI void APIENTRY glGetFragmentLightfvSGIX (GLenum, GLenum, GLfloat *); -GLAPI void APIENTRY glGetFragmentLightivSGIX (GLenum, GLenum, GLint *); -GLAPI void APIENTRY glGetFragmentMaterialfvSGIX (GLenum, GLenum, GLfloat *); -GLAPI void APIENTRY glGetFragmentMaterialivSGIX (GLenum, GLenum, GLint *); -GLAPI void APIENTRY glLightEnviSGIX (GLenum, GLint); -#endif /* GL_GLEXT_PROTOTYPES */ -typedef void (APIENTRYP PFNGLFRAGMENTCOLORMATERIALSGIXPROC) (GLenum face, GLenum mode); -typedef void (APIENTRYP PFNGLFRAGMENTLIGHTFSGIXPROC) (GLenum light, GLenum pname, GLfloat param); -typedef void (APIENTRYP PFNGLFRAGMENTLIGHTFVSGIXPROC) (GLenum light, GLenum pname, const GLfloat *params); -typedef void (APIENTRYP PFNGLFRAGMENTLIGHTISGIXPROC) (GLenum light, GLenum pname, GLint param); -typedef void (APIENTRYP PFNGLFRAGMENTLIGHTIVSGIXPROC) (GLenum light, GLenum pname, const GLint *params); -typedef void (APIENTRYP PFNGLFRAGMENTLIGHTMODELFSGIXPROC) (GLenum pname, GLfloat param); -typedef void (APIENTRYP PFNGLFRAGMENTLIGHTMODELFVSGIXPROC) (GLenum pname, const GLfloat *params); -typedef void (APIENTRYP PFNGLFRAGMENTLIGHTMODELISGIXPROC) (GLenum pname, GLint param); -typedef void (APIENTRYP PFNGLFRAGMENTLIGHTMODELIVSGIXPROC) (GLenum pname, const GLint *params); -typedef void (APIENTRYP PFNGLFRAGMENTMATERIALFSGIXPROC) (GLenum face, GLenum pname, GLfloat param); -typedef void (APIENTRYP PFNGLFRAGMENTMATERIALFVSGIXPROC) (GLenum face, GLenum pname, const GLfloat *params); -typedef void (APIENTRYP PFNGLFRAGMENTMATERIALISGIXPROC) (GLenum face, GLenum pname, GLint param); -typedef void (APIENTRYP PFNGLFRAGMENTMATERIALIVSGIXPROC) (GLenum face, GLenum pname, const GLint *params); -typedef void (APIENTRYP PFNGLGETFRAGMENTLIGHTFVSGIXPROC) (GLenum light, GLenum pname, GLfloat *params); -typedef void (APIENTRYP PFNGLGETFRAGMENTLIGHTIVSGIXPROC) (GLenum light, GLenum pname, GLint *params); -typedef void (APIENTRYP PFNGLGETFRAGMENTMATERIALFVSGIXPROC) (GLenum face, GLenum pname, GLfloat *params); -typedef void (APIENTRYP PFNGLGETFRAGMENTMATERIALIVSGIXPROC) (GLenum face, GLenum pname, GLint *params); -typedef void (APIENTRYP PFNGLLIGHTENVISGIXPROC) (GLenum pname, GLint param); -#endif - -#ifndef GL_IBM_rasterpos_clip -#define GL_IBM_rasterpos_clip 1 -#endif - -#ifndef GL_HP_texture_lighting -#define GL_HP_texture_lighting 1 -#endif - -#ifndef GL_EXT_draw_range_elements -#define GL_EXT_draw_range_elements 1 -#ifdef GL_GLEXT_PROTOTYPES -GLAPI void APIENTRY glDrawRangeElementsEXT (GLenum, GLuint, GLuint, GLsizei, GLenum, const GLvoid *); -#endif /* GL_GLEXT_PROTOTYPES */ -typedef void (APIENTRYP PFNGLDRAWRANGEELEMENTSEXTPROC) (GLenum mode, GLuint start, GLuint end, GLsizei count, GLenum type, const GLvoid *indices); -#endif - -#ifndef GL_WIN_phong_shading -#define GL_WIN_phong_shading 1 -#endif - -#ifndef GL_WIN_specular_fog -#define GL_WIN_specular_fog 1 -#endif - -#ifndef GL_EXT_light_texture -#define GL_EXT_light_texture 1 -#ifdef GL_GLEXT_PROTOTYPES -GLAPI void APIENTRY glApplyTextureEXT (GLenum); -GLAPI void APIENTRY glTextureLightEXT (GLenum); -GLAPI void APIENTRY glTextureMaterialEXT (GLenum, GLenum); -#endif /* GL_GLEXT_PROTOTYPES */ -typedef void (APIENTRYP PFNGLAPPLYTEXTUREEXTPROC) (GLenum mode); -typedef void (APIENTRYP PFNGLTEXTURELIGHTEXTPROC) (GLenum pname); -typedef void (APIENTRYP PFNGLTEXTUREMATERIALEXTPROC) (GLenum face, GLenum mode); -#endif - -#ifndef GL_SGIX_blend_alpha_minmax -#define GL_SGIX_blend_alpha_minmax 1 -#endif - -#ifndef GL_EXT_bgra -#define GL_EXT_bgra 1 -#endif - -#ifndef GL_SGIX_async -#define GL_SGIX_async 1 -#ifdef GL_GLEXT_PROTOTYPES -GLAPI void APIENTRY glAsyncMarkerSGIX (GLuint); -GLAPI GLint APIENTRY glFinishAsyncSGIX (GLuint *); -GLAPI GLint APIENTRY glPollAsyncSGIX (GLuint *); -GLAPI GLuint APIENTRY glGenAsyncMarkersSGIX (GLsizei); -GLAPI void APIENTRY glDeleteAsyncMarkersSGIX (GLuint, GLsizei); -GLAPI GLboolean APIENTRY glIsAsyncMarkerSGIX (GLuint); -#endif /* GL_GLEXT_PROTOTYPES */ -typedef void (APIENTRYP PFNGLASYNCMARKERSGIXPROC) (GLuint marker); -typedef GLint (APIENTRYP PFNGLFINISHASYNCSGIXPROC) (GLuint *markerp); -typedef GLint (APIENTRYP PFNGLPOLLASYNCSGIXPROC) (GLuint *markerp); -typedef GLuint (APIENTRYP PFNGLGENASYNCMARKERSSGIXPROC) (GLsizei range); -typedef void (APIENTRYP PFNGLDELETEASYNCMARKERSSGIXPROC) (GLuint marker, GLsizei range); -typedef GLboolean (APIENTRYP PFNGLISASYNCMARKERSGIXPROC) (GLuint marker); -#endif - -#ifndef GL_SGIX_async_pixel -#define GL_SGIX_async_pixel 1 -#endif - -#ifndef GL_SGIX_async_histogram -#define GL_SGIX_async_histogram 1 -#endif - -#ifndef GL_INTEL_parallel_arrays -#define GL_INTEL_parallel_arrays 1 -#ifdef GL_GLEXT_PROTOTYPES -GLAPI void APIENTRY glVertexPointervINTEL (GLint, GLenum, const GLvoid* *); -GLAPI void APIENTRY glNormalPointervINTEL (GLenum, const GLvoid* *); -GLAPI void APIENTRY glColorPointervINTEL (GLint, GLenum, const GLvoid* *); -GLAPI void APIENTRY glTexCoordPointervINTEL (GLint, GLenum, const GLvoid* *); -#endif /* GL_GLEXT_PROTOTYPES */ -typedef void (APIENTRYP PFNGLVERTEXPOINTERVINTELPROC) (GLint size, GLenum type, const GLvoid* *pointer); -typedef void (APIENTRYP PFNGLNORMALPOINTERVINTELPROC) (GLenum type, const GLvoid* *pointer); -typedef void (APIENTRYP PFNGLCOLORPOINTERVINTELPROC) (GLint size, GLenum type, const GLvoid* *pointer); -typedef void (APIENTRYP PFNGLTEXCOORDPOINTERVINTELPROC) (GLint size, GLenum type, const GLvoid* *pointer); -#endif - -#ifndef GL_HP_occlusion_test -#define GL_HP_occlusion_test 1 -#endif - -#ifndef GL_EXT_pixel_transform -#define GL_EXT_pixel_transform 1 -#ifdef GL_GLEXT_PROTOTYPES -GLAPI void APIENTRY glPixelTransformParameteriEXT (GLenum, GLenum, GLint); -GLAPI void APIENTRY glPixelTransformParameterfEXT (GLenum, GLenum, GLfloat); -GLAPI void APIENTRY glPixelTransformParameterivEXT (GLenum, GLenum, const GLint *); -GLAPI void APIENTRY glPixelTransformParameterfvEXT (GLenum, GLenum, const GLfloat *); -#endif /* GL_GLEXT_PROTOTYPES */ -typedef void (APIENTRYP PFNGLPIXELTRANSFORMPARAMETERIEXTPROC) (GLenum target, GLenum pname, GLint param); -typedef void (APIENTRYP PFNGLPIXELTRANSFORMPARAMETERFEXTPROC) (GLenum target, GLenum pname, GLfloat param); -typedef void (APIENTRYP PFNGLPIXELTRANSFORMPARAMETERIVEXTPROC) (GLenum target, GLenum pname, const GLint *params); -typedef void (APIENTRYP PFNGLPIXELTRANSFORMPARAMETERFVEXTPROC) (GLenum target, GLenum pname, const GLfloat *params); -#endif - -#ifndef GL_EXT_pixel_transform_color_table -#define GL_EXT_pixel_transform_color_table 1 -#endif - -#ifndef GL_EXT_shared_texture_palette -#define GL_EXT_shared_texture_palette 1 -#endif - -#ifndef GL_EXT_separate_specular_color -#define GL_EXT_separate_specular_color 1 -#endif - -#ifndef GL_EXT_secondary_color -#define GL_EXT_secondary_color 1 -#ifdef GL_GLEXT_PROTOTYPES -GLAPI void APIENTRY glSecondaryColor3bEXT (GLbyte, GLbyte, GLbyte); -GLAPI void APIENTRY glSecondaryColor3bvEXT (const GLbyte *); -GLAPI void APIENTRY glSecondaryColor3dEXT (GLdouble, GLdouble, GLdouble); -GLAPI void APIENTRY glSecondaryColor3dvEXT (const GLdouble *); -GLAPI void APIENTRY glSecondaryColor3fEXT (GLfloat, GLfloat, GLfloat); -GLAPI void APIENTRY glSecondaryColor3fvEXT (const GLfloat *); -GLAPI void APIENTRY glSecondaryColor3iEXT (GLint, GLint, GLint); -GLAPI void APIENTRY glSecondaryColor3ivEXT (const GLint *); -GLAPI void APIENTRY glSecondaryColor3sEXT (GLshort, GLshort, GLshort); -GLAPI void APIENTRY glSecondaryColor3svEXT (const GLshort *); -GLAPI void APIENTRY glSecondaryColor3ubEXT (GLubyte, GLubyte, GLubyte); -GLAPI void APIENTRY glSecondaryColor3ubvEXT (const GLubyte *); -GLAPI void APIENTRY glSecondaryColor3uiEXT (GLuint, GLuint, GLuint); -GLAPI void APIENTRY glSecondaryColor3uivEXT (const GLuint *); -GLAPI void APIENTRY glSecondaryColor3usEXT (GLushort, GLushort, GLushort); -GLAPI void APIENTRY glSecondaryColor3usvEXT (const GLushort *); -GLAPI void APIENTRY glSecondaryColorPointerEXT (GLint, GLenum, GLsizei, const GLvoid *); -#endif /* GL_GLEXT_PROTOTYPES */ -typedef void (APIENTRYP PFNGLSECONDARYCOLOR3BEXTPROC) (GLbyte red, GLbyte green, GLbyte blue); -typedef void (APIENTRYP PFNGLSECONDARYCOLOR3BVEXTPROC) (const GLbyte *v); -typedef void (APIENTRYP PFNGLSECONDARYCOLOR3DEXTPROC) (GLdouble red, GLdouble green, GLdouble blue); -typedef void (APIENTRYP PFNGLSECONDARYCOLOR3DVEXTPROC) (const GLdouble *v); -typedef void (APIENTRYP PFNGLSECONDARYCOLOR3FEXTPROC) (GLfloat red, GLfloat green, GLfloat blue); -typedef void (APIENTRYP PFNGLSECONDARYCOLOR3FVEXTPROC) (const GLfloat *v); -typedef void (APIENTRYP PFNGLSECONDARYCOLOR3IEXTPROC) (GLint red, GLint green, GLint blue); -typedef void (APIENTRYP PFNGLSECONDARYCOLOR3IVEXTPROC) (const GLint *v); -typedef void (APIENTRYP PFNGLSECONDARYCOLOR3SEXTPROC) (GLshort red, GLshort green, GLshort blue); -typedef void (APIENTRYP PFNGLSECONDARYCOLOR3SVEXTPROC) (const GLshort *v); -typedef void (APIENTRYP PFNGLSECONDARYCOLOR3UBEXTPROC) (GLubyte red, GLubyte green, GLubyte blue); -typedef void (APIENTRYP PFNGLSECONDARYCOLOR3UBVEXTPROC) (const GLubyte *v); -typedef void (APIENTRYP PFNGLSECONDARYCOLOR3UIEXTPROC) (GLuint red, GLuint green, GLuint blue); -typedef void (APIENTRYP PFNGLSECONDARYCOLOR3UIVEXTPROC) (const GLuint *v); -typedef void (APIENTRYP PFNGLSECONDARYCOLOR3USEXTPROC) (GLushort red, GLushort green, GLushort blue); -typedef void (APIENTRYP PFNGLSECONDARYCOLOR3USVEXTPROC) (const GLushort *v); -typedef void (APIENTRYP PFNGLSECONDARYCOLORPOINTEREXTPROC) (GLint size, GLenum type, GLsizei stride, const GLvoid *pointer); -#endif - -#ifndef GL_EXT_texture_perturb_normal -#define GL_EXT_texture_perturb_normal 1 -#ifdef GL_GLEXT_PROTOTYPES -GLAPI void APIENTRY glTextureNormalEXT (GLenum); -#endif /* GL_GLEXT_PROTOTYPES */ -typedef void (APIENTRYP PFNGLTEXTURENORMALEXTPROC) (GLenum mode); -#endif - -#ifndef GL_EXT_multi_draw_arrays -#define GL_EXT_multi_draw_arrays 1 -#ifdef GL_GLEXT_PROTOTYPES -GLAPI void APIENTRY glMultiDrawArraysEXT (GLenum, GLint *, GLsizei *, GLsizei); -GLAPI void APIENTRY glMultiDrawElementsEXT (GLenum, const GLsizei *, GLenum, const GLvoid* *, GLsizei); -#endif /* GL_GLEXT_PROTOTYPES */ -typedef void (APIENTRYP PFNGLMULTIDRAWARRAYSEXTPROC) (GLenum mode, GLint *first, GLsizei *count, GLsizei primcount); -typedef void (APIENTRYP PFNGLMULTIDRAWELEMENTSEXTPROC) (GLenum mode, const GLsizei *count, GLenum type, const GLvoid* *indices, GLsizei primcount); -#endif - -#ifndef GL_EXT_fog_coord -#define GL_EXT_fog_coord 1 -#ifdef GL_GLEXT_PROTOTYPES -GLAPI void APIENTRY glFogCoordfEXT (GLfloat); -GLAPI void APIENTRY glFogCoordfvEXT (const GLfloat *); -GLAPI void APIENTRY glFogCoorddEXT (GLdouble); -GLAPI void APIENTRY glFogCoorddvEXT (const GLdouble *); -GLAPI void APIENTRY glFogCoordPointerEXT (GLenum, GLsizei, const GLvoid *); -#endif /* GL_GLEXT_PROTOTYPES */ -typedef void (APIENTRYP PFNGLFOGCOORDFEXTPROC) (GLfloat coord); -typedef void (APIENTRYP PFNGLFOGCOORDFVEXTPROC) (const GLfloat *coord); -typedef void (APIENTRYP PFNGLFOGCOORDDEXTPROC) (GLdouble coord); -typedef void (APIENTRYP PFNGLFOGCOORDDVEXTPROC) (const GLdouble *coord); -typedef void (APIENTRYP PFNGLFOGCOORDPOINTEREXTPROC) (GLenum type, GLsizei stride, const GLvoid *pointer); -#endif - -#ifndef GL_REND_screen_coordinates -#define GL_REND_screen_coordinates 1 -#endif - -#ifndef GL_EXT_coordinate_frame -#define GL_EXT_coordinate_frame 1 -#ifdef GL_GLEXT_PROTOTYPES -GLAPI void APIENTRY glTangent3bEXT (GLbyte, GLbyte, GLbyte); -GLAPI void APIENTRY glTangent3bvEXT (const GLbyte *); -GLAPI void APIENTRY glTangent3dEXT (GLdouble, GLdouble, GLdouble); -GLAPI void APIENTRY glTangent3dvEXT (const GLdouble *); -GLAPI void APIENTRY glTangent3fEXT (GLfloat, GLfloat, GLfloat); -GLAPI void APIENTRY glTangent3fvEXT (const GLfloat *); -GLAPI void APIENTRY glTangent3iEXT (GLint, GLint, GLint); -GLAPI void APIENTRY glTangent3ivEXT (const GLint *); -GLAPI void APIENTRY glTangent3sEXT (GLshort, GLshort, GLshort); -GLAPI void APIENTRY glTangent3svEXT (const GLshort *); -GLAPI void APIENTRY glBinormal3bEXT (GLbyte, GLbyte, GLbyte); -GLAPI void APIENTRY glBinormal3bvEXT (const GLbyte *); -GLAPI void APIENTRY glBinormal3dEXT (GLdouble, GLdouble, GLdouble); -GLAPI void APIENTRY glBinormal3dvEXT (const GLdouble *); -GLAPI void APIENTRY glBinormal3fEXT (GLfloat, GLfloat, GLfloat); -GLAPI void APIENTRY glBinormal3fvEXT (const GLfloat *); -GLAPI void APIENTRY glBinormal3iEXT (GLint, GLint, GLint); -GLAPI void APIENTRY glBinormal3ivEXT (const GLint *); -GLAPI void APIENTRY glBinormal3sEXT (GLshort, GLshort, GLshort); -GLAPI void APIENTRY glBinormal3svEXT (const GLshort *); -GLAPI void APIENTRY glTangentPointerEXT (GLenum, GLsizei, const GLvoid *); -GLAPI void APIENTRY glBinormalPointerEXT (GLenum, GLsizei, const GLvoid *); -#endif /* GL_GLEXT_PROTOTYPES */ -typedef void (APIENTRYP PFNGLTANGENT3BEXTPROC) (GLbyte tx, GLbyte ty, GLbyte tz); -typedef void (APIENTRYP PFNGLTANGENT3BVEXTPROC) (const GLbyte *v); -typedef void (APIENTRYP PFNGLTANGENT3DEXTPROC) (GLdouble tx, GLdouble ty, GLdouble tz); -typedef void (APIENTRYP PFNGLTANGENT3DVEXTPROC) (const GLdouble *v); -typedef void (APIENTRYP PFNGLTANGENT3FEXTPROC) (GLfloat tx, GLfloat ty, GLfloat tz); -typedef void (APIENTRYP PFNGLTANGENT3FVEXTPROC) (const GLfloat *v); -typedef void (APIENTRYP PFNGLTANGENT3IEXTPROC) (GLint tx, GLint ty, GLint tz); -typedef void (APIENTRYP PFNGLTANGENT3IVEXTPROC) (const GLint *v); -typedef void (APIENTRYP PFNGLTANGENT3SEXTPROC) (GLshort tx, GLshort ty, GLshort tz); -typedef void (APIENTRYP PFNGLTANGENT3SVEXTPROC) (const GLshort *v); -typedef void (APIENTRYP PFNGLBINORMAL3BEXTPROC) (GLbyte bx, GLbyte by, GLbyte bz); -typedef void (APIENTRYP PFNGLBINORMAL3BVEXTPROC) (const GLbyte *v); -typedef void (APIENTRYP PFNGLBINORMAL3DEXTPROC) (GLdouble bx, GLdouble by, GLdouble bz); -typedef void (APIENTRYP PFNGLBINORMAL3DVEXTPROC) (const GLdouble *v); -typedef void (APIENTRYP PFNGLBINORMAL3FEXTPROC) (GLfloat bx, GLfloat by, GLfloat bz); -typedef void (APIENTRYP PFNGLBINORMAL3FVEXTPROC) (const GLfloat *v); -typedef void (APIENTRYP PFNGLBINORMAL3IEXTPROC) (GLint bx, GLint by, GLint bz); -typedef void (APIENTRYP PFNGLBINORMAL3IVEXTPROC) (const GLint *v); -typedef void (APIENTRYP PFNGLBINORMAL3SEXTPROC) (GLshort bx, GLshort by, GLshort bz); -typedef void (APIENTRYP PFNGLBINORMAL3SVEXTPROC) (const GLshort *v); -typedef void (APIENTRYP PFNGLTANGENTPOINTEREXTPROC) (GLenum type, GLsizei stride, const GLvoid *pointer); -typedef void (APIENTRYP PFNGLBINORMALPOINTEREXTPROC) (GLenum type, GLsizei stride, const GLvoid *pointer); -#endif - -#ifndef GL_EXT_texture_env_combine -#define GL_EXT_texture_env_combine 1 -#endif - -#ifndef GL_APPLE_specular_vector -#define GL_APPLE_specular_vector 1 -#endif - -#ifndef GL_APPLE_transform_hint -#define GL_APPLE_transform_hint 1 -#endif - -#ifndef GL_SGIX_fog_scale -#define GL_SGIX_fog_scale 1 -#endif - -#ifndef GL_SUNX_constant_data -#define GL_SUNX_constant_data 1 -#ifdef GL_GLEXT_PROTOTYPES -GLAPI void APIENTRY glFinishTextureSUNX (void); -#endif /* GL_GLEXT_PROTOTYPES */ -typedef void (APIENTRYP PFNGLFINISHTEXTURESUNXPROC) (void); -#endif - -#ifndef GL_SUN_global_alpha -#define GL_SUN_global_alpha 1 -#ifdef GL_GLEXT_PROTOTYPES -GLAPI void APIENTRY glGlobalAlphaFactorbSUN (GLbyte); -GLAPI void APIENTRY glGlobalAlphaFactorsSUN (GLshort); -GLAPI void APIENTRY glGlobalAlphaFactoriSUN (GLint); -GLAPI void APIENTRY glGlobalAlphaFactorfSUN (GLfloat); -GLAPI void APIENTRY glGlobalAlphaFactordSUN (GLdouble); -GLAPI void APIENTRY glGlobalAlphaFactorubSUN (GLubyte); -GLAPI void APIENTRY glGlobalAlphaFactorusSUN (GLushort); -GLAPI void APIENTRY glGlobalAlphaFactoruiSUN (GLuint); -#endif /* GL_GLEXT_PROTOTYPES */ -typedef void (APIENTRYP PFNGLGLOBALALPHAFACTORBSUNPROC) (GLbyte factor); -typedef void (APIENTRYP PFNGLGLOBALALPHAFACTORSSUNPROC) (GLshort factor); -typedef void (APIENTRYP PFNGLGLOBALALPHAFACTORISUNPROC) (GLint factor); -typedef void (APIENTRYP PFNGLGLOBALALPHAFACTORFSUNPROC) (GLfloat factor); -typedef void (APIENTRYP PFNGLGLOBALALPHAFACTORDSUNPROC) (GLdouble factor); -typedef void (APIENTRYP PFNGLGLOBALALPHAFACTORUBSUNPROC) (GLubyte factor); -typedef void (APIENTRYP PFNGLGLOBALALPHAFACTORUSSUNPROC) (GLushort factor); -typedef void (APIENTRYP PFNGLGLOBALALPHAFACTORUISUNPROC) (GLuint factor); -#endif - -#ifndef GL_SUN_triangle_list -#define GL_SUN_triangle_list 1 -#ifdef GL_GLEXT_PROTOTYPES -GLAPI void APIENTRY glReplacementCodeuiSUN (GLuint); -GLAPI void APIENTRY glReplacementCodeusSUN (GLushort); -GLAPI void APIENTRY glReplacementCodeubSUN (GLubyte); -GLAPI void APIENTRY glReplacementCodeuivSUN (const GLuint *); -GLAPI void APIENTRY glReplacementCodeusvSUN (const GLushort *); -GLAPI void APIENTRY glReplacementCodeubvSUN (const GLubyte *); -GLAPI void APIENTRY glReplacementCodePointerSUN (GLenum, GLsizei, const GLvoid* *); -#endif /* GL_GLEXT_PROTOTYPES */ -typedef void (APIENTRYP PFNGLREPLACEMENTCODEUISUNPROC) (GLuint code); -typedef void (APIENTRYP PFNGLREPLACEMENTCODEUSSUNPROC) (GLushort code); -typedef void (APIENTRYP PFNGLREPLACEMENTCODEUBSUNPROC) (GLubyte code); -typedef void (APIENTRYP PFNGLREPLACEMENTCODEUIVSUNPROC) (const GLuint *code); -typedef void (APIENTRYP PFNGLREPLACEMENTCODEUSVSUNPROC) (const GLushort *code); -typedef void (APIENTRYP PFNGLREPLACEMENTCODEUBVSUNPROC) (const GLubyte *code); -typedef void (APIENTRYP PFNGLREPLACEMENTCODEPOINTERSUNPROC) (GLenum type, GLsizei stride, const GLvoid* *pointer); -#endif - -#ifndef GL_SUN_vertex -#define GL_SUN_vertex 1 -#ifdef GL_GLEXT_PROTOTYPES -GLAPI void APIENTRY glColor4ubVertex2fSUN (GLubyte, GLubyte, GLubyte, GLubyte, GLfloat, GLfloat); -GLAPI void APIENTRY glColor4ubVertex2fvSUN (const GLubyte *, const GLfloat *); -GLAPI void APIENTRY glColor4ubVertex3fSUN (GLubyte, GLubyte, GLubyte, GLubyte, GLfloat, GLfloat, GLfloat); -GLAPI void APIENTRY glColor4ubVertex3fvSUN (const GLubyte *, const GLfloat *); -GLAPI void APIENTRY glColor3fVertex3fSUN (GLfloat, GLfloat, GLfloat, GLfloat, GLfloat, GLfloat); -GLAPI void APIENTRY glColor3fVertex3fvSUN (const GLfloat *, const GLfloat *); -GLAPI void APIENTRY glNormal3fVertex3fSUN (GLfloat, GLfloat, GLfloat, GLfloat, GLfloat, GLfloat); -GLAPI void APIENTRY glNormal3fVertex3fvSUN (const GLfloat *, const GLfloat *); -GLAPI void APIENTRY glColor4fNormal3fVertex3fSUN (GLfloat, GLfloat, GLfloat, GLfloat, GLfloat, GLfloat, GLfloat, GLfloat, GLfloat, GLfloat); -GLAPI void APIENTRY glColor4fNormal3fVertex3fvSUN (const GLfloat *, const GLfloat *, const GLfloat *); -GLAPI void APIENTRY glTexCoord2fVertex3fSUN (GLfloat, GLfloat, GLfloat, GLfloat, GLfloat); -GLAPI void APIENTRY glTexCoord2fVertex3fvSUN (const GLfloat *, const GLfloat *); -GLAPI void APIENTRY glTexCoord4fVertex4fSUN (GLfloat, GLfloat, GLfloat, GLfloat, GLfloat, GLfloat, GLfloat, GLfloat); -GLAPI void APIENTRY glTexCoord4fVertex4fvSUN (const GLfloat *, const GLfloat *); -GLAPI void APIENTRY glTexCoord2fColor4ubVertex3fSUN (GLfloat, GLfloat, GLubyte, GLubyte, GLubyte, GLubyte, GLfloat, GLfloat, GLfloat); -GLAPI void APIENTRY glTexCoord2fColor4ubVertex3fvSUN (const GLfloat *, const GLubyte *, const GLfloat *); -GLAPI void APIENTRY glTexCoord2fColor3fVertex3fSUN (GLfloat, GLfloat, GLfloat, GLfloat, GLfloat, GLfloat, GLfloat, GLfloat); -GLAPI void APIENTRY glTexCoord2fColor3fVertex3fvSUN (const GLfloat *, const GLfloat *, const GLfloat *); -GLAPI void APIENTRY glTexCoord2fNormal3fVertex3fSUN (GLfloat, GLfloat, GLfloat, GLfloat, GLfloat, GLfloat, GLfloat, GLfloat); -GLAPI void APIENTRY glTexCoord2fNormal3fVertex3fvSUN (const GLfloat *, const GLfloat *, const GLfloat *); -GLAPI void APIENTRY glTexCoord2fColor4fNormal3fVertex3fSUN (GLfloat, GLfloat, GLfloat, GLfloat, GLfloat, GLfloat, GLfloat, GLfloat, GLfloat, GLfloat, GLfloat, GLfloat); -GLAPI void APIENTRY glTexCoord2fColor4fNormal3fVertex3fvSUN (const GLfloat *, const GLfloat *, const GLfloat *, const GLfloat *); -GLAPI void APIENTRY glTexCoord4fColor4fNormal3fVertex4fSUN (GLfloat, GLfloat, GLfloat, GLfloat, GLfloat, GLfloat, GLfloat, GLfloat, GLfloat, GLfloat, GLfloat, GLfloat, GLfloat, GLfloat, GLfloat); -GLAPI void APIENTRY glTexCoord4fColor4fNormal3fVertex4fvSUN (const GLfloat *, const GLfloat *, const GLfloat *, const GLfloat *); -GLAPI void APIENTRY glReplacementCodeuiVertex3fSUN (GLuint, GLfloat, GLfloat, GLfloat); -GLAPI void APIENTRY glReplacementCodeuiVertex3fvSUN (const GLuint *, const GLfloat *); -GLAPI void APIENTRY glReplacementCodeuiColor4ubVertex3fSUN (GLuint, GLubyte, GLubyte, GLubyte, GLubyte, GLfloat, GLfloat, GLfloat); -GLAPI void APIENTRY glReplacementCodeuiColor4ubVertex3fvSUN (const GLuint *, const GLubyte *, const GLfloat *); -GLAPI void APIENTRY glReplacementCodeuiColor3fVertex3fSUN (GLuint, GLfloat, GLfloat, GLfloat, GLfloat, GLfloat, GLfloat); -GLAPI void APIENTRY glReplacementCodeuiColor3fVertex3fvSUN (const GLuint *, const GLfloat *, const GLfloat *); -GLAPI void APIENTRY glReplacementCodeuiNormal3fVertex3fSUN (GLuint, GLfloat, GLfloat, GLfloat, GLfloat, GLfloat, GLfloat); -GLAPI void APIENTRY glReplacementCodeuiNormal3fVertex3fvSUN (const GLuint *, const GLfloat *, const GLfloat *); -GLAPI void APIENTRY glReplacementCodeuiColor4fNormal3fVertex3fSUN (GLuint, GLfloat, GLfloat, GLfloat, GLfloat, GLfloat, GLfloat, GLfloat, GLfloat, GLfloat, GLfloat); -GLAPI void APIENTRY glReplacementCodeuiColor4fNormal3fVertex3fvSUN (const GLuint *, const GLfloat *, const GLfloat *, const GLfloat *); -GLAPI void APIENTRY glReplacementCodeuiTexCoord2fVertex3fSUN (GLuint, GLfloat, GLfloat, GLfloat, GLfloat, GLfloat); -GLAPI void APIENTRY glReplacementCodeuiTexCoord2fVertex3fvSUN (const GLuint *, const GLfloat *, const GLfloat *); -GLAPI void APIENTRY glReplacementCodeuiTexCoord2fNormal3fVertex3fSUN (GLuint, GLfloat, GLfloat, GLfloat, GLfloat, GLfloat, GLfloat, GLfloat, GLfloat); -GLAPI void APIENTRY glReplacementCodeuiTexCoord2fNormal3fVertex3fvSUN (const GLuint *, const GLfloat *, const GLfloat *, const GLfloat *); -GLAPI void APIENTRY glReplacementCodeuiTexCoord2fColor4fNormal3fVertex3fSUN (GLuint, GLfloat, GLfloat, GLfloat, GLfloat, GLfloat, GLfloat, GLfloat, GLfloat, GLfloat, GLfloat, GLfloat, GLfloat); -GLAPI void APIENTRY glReplacementCodeuiTexCoord2fColor4fNormal3fVertex3fvSUN (const GLuint *, const GLfloat *, const GLfloat *, const GLfloat *, const GLfloat *); -#endif /* GL_GLEXT_PROTOTYPES */ -typedef void (APIENTRYP PFNGLCOLOR4UBVERTEX2FSUNPROC) (GLubyte r, GLubyte g, GLubyte b, GLubyte a, GLfloat x, GLfloat y); -typedef void (APIENTRYP PFNGLCOLOR4UBVERTEX2FVSUNPROC) (const GLubyte *c, const GLfloat *v); -typedef void (APIENTRYP PFNGLCOLOR4UBVERTEX3FSUNPROC) (GLubyte r, GLubyte g, GLubyte b, GLubyte a, GLfloat x, GLfloat y, GLfloat z); -typedef void (APIENTRYP PFNGLCOLOR4UBVERTEX3FVSUNPROC) (const GLubyte *c, const GLfloat *v); -typedef void (APIENTRYP PFNGLCOLOR3FVERTEX3FSUNPROC) (GLfloat r, GLfloat g, GLfloat b, GLfloat x, GLfloat y, GLfloat z); -typedef void (APIENTRYP PFNGLCOLOR3FVERTEX3FVSUNPROC) (const GLfloat *c, const GLfloat *v); -typedef void (APIENTRYP PFNGLNORMAL3FVERTEX3FSUNPROC) (GLfloat nx, GLfloat ny, GLfloat nz, GLfloat x, GLfloat y, GLfloat z); -typedef void (APIENTRYP PFNGLNORMAL3FVERTEX3FVSUNPROC) (const GLfloat *n, const GLfloat *v); -typedef void (APIENTRYP PFNGLCOLOR4FNORMAL3FVERTEX3FSUNPROC) (GLfloat r, GLfloat g, GLfloat b, GLfloat a, GLfloat nx, GLfloat ny, GLfloat nz, GLfloat x, GLfloat y, GLfloat z); -typedef void (APIENTRYP PFNGLCOLOR4FNORMAL3FVERTEX3FVSUNPROC) (const GLfloat *c, const GLfloat *n, const GLfloat *v); -typedef void (APIENTRYP PFNGLTEXCOORD2FVERTEX3FSUNPROC) (GLfloat s, GLfloat t, GLfloat x, GLfloat y, GLfloat z); -typedef void (APIENTRYP PFNGLTEXCOORD2FVERTEX3FVSUNPROC) (const GLfloat *tc, const GLfloat *v); -typedef void (APIENTRYP PFNGLTEXCOORD4FVERTEX4FSUNPROC) (GLfloat s, GLfloat t, GLfloat p, GLfloat q, GLfloat x, GLfloat y, GLfloat z, GLfloat w); -typedef void (APIENTRYP PFNGLTEXCOORD4FVERTEX4FVSUNPROC) (const GLfloat *tc, const GLfloat *v); -typedef void (APIENTRYP PFNGLTEXCOORD2FCOLOR4UBVERTEX3FSUNPROC) (GLfloat s, GLfloat t, GLubyte r, GLubyte g, GLubyte b, GLubyte a, GLfloat x, GLfloat y, GLfloat z); -typedef void (APIENTRYP PFNGLTEXCOORD2FCOLOR4UBVERTEX3FVSUNPROC) (const GLfloat *tc, const GLubyte *c, const GLfloat *v); -typedef void (APIENTRYP PFNGLTEXCOORD2FCOLOR3FVERTEX3FSUNPROC) (GLfloat s, GLfloat t, GLfloat r, GLfloat g, GLfloat b, GLfloat x, GLfloat y, GLfloat z); -typedef void (APIENTRYP PFNGLTEXCOORD2FCOLOR3FVERTEX3FVSUNPROC) (const GLfloat *tc, const GLfloat *c, const GLfloat *v); -typedef void (APIENTRYP PFNGLTEXCOORD2FNORMAL3FVERTEX3FSUNPROC) (GLfloat s, GLfloat t, GLfloat nx, GLfloat ny, GLfloat nz, GLfloat x, GLfloat y, GLfloat z); -typedef void (APIENTRYP PFNGLTEXCOORD2FNORMAL3FVERTEX3FVSUNPROC) (const GLfloat *tc, const GLfloat *n, const GLfloat *v); -typedef void (APIENTRYP PFNGLTEXCOORD2FCOLOR4FNORMAL3FVERTEX3FSUNPROC) (GLfloat s, GLfloat t, GLfloat r, GLfloat g, GLfloat b, GLfloat a, GLfloat nx, GLfloat ny, GLfloat nz, GLfloat x, GLfloat y, GLfloat z); -typedef void (APIENTRYP PFNGLTEXCOORD2FCOLOR4FNORMAL3FVERTEX3FVSUNPROC) (const GLfloat *tc, const GLfloat *c, const GLfloat *n, const GLfloat *v); -typedef void (APIENTRYP PFNGLTEXCOORD4FCOLOR4FNORMAL3FVERTEX4FSUNPROC) (GLfloat s, GLfloat t, GLfloat p, GLfloat q, GLfloat r, GLfloat g, GLfloat b, GLfloat a, GLfloat nx, GLfloat ny, GLfloat nz, GLfloat x, GLfloat y, GLfloat z, GLfloat w); -typedef void (APIENTRYP PFNGLTEXCOORD4FCOLOR4FNORMAL3FVERTEX4FVSUNPROC) (const GLfloat *tc, const GLfloat *c, const GLfloat *n, const GLfloat *v); -typedef void (APIENTRYP PFNGLREPLACEMENTCODEUIVERTEX3FSUNPROC) (GLuint rc, GLfloat x, GLfloat y, GLfloat z); -typedef void (APIENTRYP PFNGLREPLACEMENTCODEUIVERTEX3FVSUNPROC) (const GLuint *rc, const GLfloat *v); -typedef void (APIENTRYP PFNGLREPLACEMENTCODEUICOLOR4UBVERTEX3FSUNPROC) (GLuint rc, GLubyte r, GLubyte g, GLubyte b, GLubyte a, GLfloat x, GLfloat y, GLfloat z); -typedef void (APIENTRYP PFNGLREPLACEMENTCODEUICOLOR4UBVERTEX3FVSUNPROC) (const GLuint *rc, const GLubyte *c, const GLfloat *v); -typedef void (APIENTRYP PFNGLREPLACEMENTCODEUICOLOR3FVERTEX3FSUNPROC) (GLuint rc, GLfloat r, GLfloat g, GLfloat b, GLfloat x, GLfloat y, GLfloat z); -typedef void (APIENTRYP PFNGLREPLACEMENTCODEUICOLOR3FVERTEX3FVSUNPROC) (const GLuint *rc, const GLfloat *c, const GLfloat *v); -typedef void (APIENTRYP PFNGLREPLACEMENTCODEUINORMAL3FVERTEX3FSUNPROC) (GLuint rc, GLfloat nx, GLfloat ny, GLfloat nz, GLfloat x, GLfloat y, GLfloat z); -typedef void (APIENTRYP PFNGLREPLACEMENTCODEUINORMAL3FVERTEX3FVSUNPROC) (const GLuint *rc, const GLfloat *n, const GLfloat *v); -typedef void (APIENTRYP PFNGLREPLACEMENTCODEUICOLOR4FNORMAL3FVERTEX3FSUNPROC) (GLuint rc, GLfloat r, GLfloat g, GLfloat b, GLfloat a, GLfloat nx, GLfloat ny, GLfloat nz, GLfloat x, GLfloat y, GLfloat z); -typedef void (APIENTRYP PFNGLREPLACEMENTCODEUICOLOR4FNORMAL3FVERTEX3FVSUNPROC) (const GLuint *rc, const GLfloat *c, const GLfloat *n, const GLfloat *v); -typedef void (APIENTRYP PFNGLREPLACEMENTCODEUITEXCOORD2FVERTEX3FSUNPROC) (GLuint rc, GLfloat s, GLfloat t, GLfloat x, GLfloat y, GLfloat z); -typedef void (APIENTRYP PFNGLREPLACEMENTCODEUITEXCOORD2FVERTEX3FVSUNPROC) (const GLuint *rc, const GLfloat *tc, const GLfloat *v); -typedef void (APIENTRYP PFNGLREPLACEMENTCODEUITEXCOORD2FNORMAL3FVERTEX3FSUNPROC) (GLuint rc, GLfloat s, GLfloat t, GLfloat nx, GLfloat ny, GLfloat nz, GLfloat x, GLfloat y, GLfloat z); -typedef void (APIENTRYP PFNGLREPLACEMENTCODEUITEXCOORD2FNORMAL3FVERTEX3FVSUNPROC) (const GLuint *rc, const GLfloat *tc, const GLfloat *n, const GLfloat *v); -typedef void (APIENTRYP PFNGLREPLACEMENTCODEUITEXCOORD2FCOLOR4FNORMAL3FVERTEX3FSUNPROC) (GLuint rc, GLfloat s, GLfloat t, GLfloat r, GLfloat g, GLfloat b, GLfloat a, GLfloat nx, GLfloat ny, GLfloat nz, GLfloat x, GLfloat y, GLfloat z); -typedef void (APIENTRYP PFNGLREPLACEMENTCODEUITEXCOORD2FCOLOR4FNORMAL3FVERTEX3FVSUNPROC) (const GLuint *rc, const GLfloat *tc, const GLfloat *c, const GLfloat *n, const GLfloat *v); -#endif - -#ifndef GL_EXT_blend_func_separate -#define GL_EXT_blend_func_separate 1 -#ifdef GL_GLEXT_PROTOTYPES -GLAPI void APIENTRY glBlendFuncSeparateEXT (GLenum, GLenum, GLenum, GLenum); -#endif /* GL_GLEXT_PROTOTYPES */ -typedef void (APIENTRYP PFNGLBLENDFUNCSEPARATEEXTPROC) (GLenum sfactorRGB, GLenum dfactorRGB, GLenum sfactorAlpha, GLenum dfactorAlpha); -#endif - -#ifndef GL_INGR_blend_func_separate -#define GL_INGR_blend_func_separate 1 -#ifdef GL_GLEXT_PROTOTYPES -GLAPI void APIENTRY glBlendFuncSeparateINGR (GLenum, GLenum, GLenum, GLenum); -#endif /* GL_GLEXT_PROTOTYPES */ -typedef void (APIENTRYP PFNGLBLENDFUNCSEPARATEINGRPROC) (GLenum sfactorRGB, GLenum dfactorRGB, GLenum sfactorAlpha, GLenum dfactorAlpha); -#endif - -#ifndef GL_INGR_color_clamp -#define GL_INGR_color_clamp 1 -#endif - -#ifndef GL_INGR_interlace_read -#define GL_INGR_interlace_read 1 -#endif - -#ifndef GL_EXT_stencil_wrap -#define GL_EXT_stencil_wrap 1 -#endif - -#ifndef GL_EXT_422_pixels -#define GL_EXT_422_pixels 1 -#endif - -#ifndef GL_NV_texgen_reflection -#define GL_NV_texgen_reflection 1 -#endif - -#ifndef GL_SUN_convolution_border_modes -#define GL_SUN_convolution_border_modes 1 -#endif - -#ifndef GL_EXT_texture_env_add -#define GL_EXT_texture_env_add 1 -#endif - -#ifndef GL_EXT_texture_lod_bias -#define GL_EXT_texture_lod_bias 1 -#endif - -#ifndef GL_EXT_texture_filter_anisotropic -#define GL_EXT_texture_filter_anisotropic 1 -#endif - -#ifndef GL_EXT_vertex_weighting -#define GL_EXT_vertex_weighting 1 -#ifdef GL_GLEXT_PROTOTYPES -GLAPI void APIENTRY glVertexWeightfEXT (GLfloat); -GLAPI void APIENTRY glVertexWeightfvEXT (const GLfloat *); -GLAPI void APIENTRY glVertexWeightPointerEXT (GLsizei, GLenum, GLsizei, const GLvoid *); -#endif /* GL_GLEXT_PROTOTYPES */ -typedef void (APIENTRYP PFNGLVERTEXWEIGHTFEXTPROC) (GLfloat weight); -typedef void (APIENTRYP PFNGLVERTEXWEIGHTFVEXTPROC) (const GLfloat *weight); -typedef void (APIENTRYP PFNGLVERTEXWEIGHTPOINTEREXTPROC) (GLsizei size, GLenum type, GLsizei stride, const GLvoid *pointer); -#endif - -#ifndef GL_NV_light_max_exponent -#define GL_NV_light_max_exponent 1 -#endif - -#ifndef GL_NV_vertex_array_range -#define GL_NV_vertex_array_range 1 -#ifdef GL_GLEXT_PROTOTYPES -GLAPI void APIENTRY glFlushVertexArrayRangeNV (void); -GLAPI void APIENTRY glVertexArrayRangeNV (GLsizei, const GLvoid *); -#endif /* GL_GLEXT_PROTOTYPES */ -typedef void (APIENTRYP PFNGLFLUSHVERTEXARRAYRANGENVPROC) (void); -typedef void (APIENTRYP PFNGLVERTEXARRAYRANGENVPROC) (GLsizei length, const GLvoid *pointer); -#endif - -#ifndef GL_NV_register_combiners -#define GL_NV_register_combiners 1 -#ifdef GL_GLEXT_PROTOTYPES -GLAPI void APIENTRY glCombinerParameterfvNV (GLenum, const GLfloat *); -GLAPI void APIENTRY glCombinerParameterfNV (GLenum, GLfloat); -GLAPI void APIENTRY glCombinerParameterivNV (GLenum, const GLint *); -GLAPI void APIENTRY glCombinerParameteriNV (GLenum, GLint); -GLAPI void APIENTRY glCombinerInputNV (GLenum, GLenum, GLenum, GLenum, GLenum, GLenum); -GLAPI void APIENTRY glCombinerOutputNV (GLenum, GLenum, GLenum, GLenum, GLenum, GLenum, GLenum, GLboolean, GLboolean, GLboolean); -GLAPI void APIENTRY glFinalCombinerInputNV (GLenum, GLenum, GLenum, GLenum); -GLAPI void APIENTRY glGetCombinerInputParameterfvNV (GLenum, GLenum, GLenum, GLenum, GLfloat *); -GLAPI void APIENTRY glGetCombinerInputParameterivNV (GLenum, GLenum, GLenum, GLenum, GLint *); -GLAPI void APIENTRY glGetCombinerOutputParameterfvNV (GLenum, GLenum, GLenum, GLfloat *); -GLAPI void APIENTRY glGetCombinerOutputParameterivNV (GLenum, GLenum, GLenum, GLint *); -GLAPI void APIENTRY glGetFinalCombinerInputParameterfvNV (GLenum, GLenum, GLfloat *); -GLAPI void APIENTRY glGetFinalCombinerInputParameterivNV (GLenum, GLenum, GLint *); -#endif /* GL_GLEXT_PROTOTYPES */ -typedef void (APIENTRYP PFNGLCOMBINERPARAMETERFVNVPROC) (GLenum pname, const GLfloat *params); -typedef void (APIENTRYP PFNGLCOMBINERPARAMETERFNVPROC) (GLenum pname, GLfloat param); -typedef void (APIENTRYP PFNGLCOMBINERPARAMETERIVNVPROC) (GLenum pname, const GLint *params); -typedef void (APIENTRYP PFNGLCOMBINERPARAMETERINVPROC) (GLenum pname, GLint param); -typedef void (APIENTRYP PFNGLCOMBINERINPUTNVPROC) (GLenum stage, GLenum portion, GLenum variable, GLenum input, GLenum mapping, GLenum componentUsage); -typedef void (APIENTRYP PFNGLCOMBINEROUTPUTNVPROC) (GLenum stage, GLenum portion, GLenum abOutput, GLenum cdOutput, GLenum sumOutput, GLenum scale, GLenum bias, GLboolean abDotProduct, GLboolean cdDotProduct, GLboolean muxSum); -typedef void (APIENTRYP PFNGLFINALCOMBINERINPUTNVPROC) (GLenum variable, GLenum input, GLenum mapping, GLenum componentUsage); -typedef void (APIENTRYP PFNGLGETCOMBINERINPUTPARAMETERFVNVPROC) (GLenum stage, GLenum portion, GLenum variable, GLenum pname, GLfloat *params); -typedef void (APIENTRYP PFNGLGETCOMBINERINPUTPARAMETERIVNVPROC) (GLenum stage, GLenum portion, GLenum variable, GLenum pname, GLint *params); -typedef void (APIENTRYP PFNGLGETCOMBINEROUTPUTPARAMETERFVNVPROC) (GLenum stage, GLenum portion, GLenum pname, GLfloat *params); -typedef void (APIENTRYP PFNGLGETCOMBINEROUTPUTPARAMETERIVNVPROC) (GLenum stage, GLenum portion, GLenum pname, GLint *params); -typedef void (APIENTRYP PFNGLGETFINALCOMBINERINPUTPARAMETERFVNVPROC) (GLenum variable, GLenum pname, GLfloat *params); -typedef void (APIENTRYP PFNGLGETFINALCOMBINERINPUTPARAMETERIVNVPROC) (GLenum variable, GLenum pname, GLint *params); -#endif - -#ifndef GL_NV_fog_distance -#define GL_NV_fog_distance 1 -#endif - -#ifndef GL_NV_texgen_emboss -#define GL_NV_texgen_emboss 1 -#endif - -#ifndef GL_NV_blend_square -#define GL_NV_blend_square 1 -#endif - -#ifndef GL_NV_texture_env_combine4 -#define GL_NV_texture_env_combine4 1 -#endif - -#ifndef GL_MESA_resize_buffers -#define GL_MESA_resize_buffers 1 -#ifdef GL_GLEXT_PROTOTYPES -GLAPI void APIENTRY glResizeBuffersMESA (void); -#endif /* GL_GLEXT_PROTOTYPES */ -typedef void (APIENTRYP PFNGLRESIZEBUFFERSMESAPROC) (void); -#endif - -#ifndef GL_MESA_window_pos -#define GL_MESA_window_pos 1 -#ifdef GL_GLEXT_PROTOTYPES -GLAPI void APIENTRY glWindowPos2dMESA (GLdouble, GLdouble); -GLAPI void APIENTRY glWindowPos2dvMESA (const GLdouble *); -GLAPI void APIENTRY glWindowPos2fMESA (GLfloat, GLfloat); -GLAPI void APIENTRY glWindowPos2fvMESA (const GLfloat *); -GLAPI void APIENTRY glWindowPos2iMESA (GLint, GLint); -GLAPI void APIENTRY glWindowPos2ivMESA (const GLint *); -GLAPI void APIENTRY glWindowPos2sMESA (GLshort, GLshort); -GLAPI void APIENTRY glWindowPos2svMESA (const GLshort *); -GLAPI void APIENTRY glWindowPos3dMESA (GLdouble, GLdouble, GLdouble); -GLAPI void APIENTRY glWindowPos3dvMESA (const GLdouble *); -GLAPI void APIENTRY glWindowPos3fMESA (GLfloat, GLfloat, GLfloat); -GLAPI void APIENTRY glWindowPos3fvMESA (const GLfloat *); -GLAPI void APIENTRY glWindowPos3iMESA (GLint, GLint, GLint); -GLAPI void APIENTRY glWindowPos3ivMESA (const GLint *); -GLAPI void APIENTRY glWindowPos3sMESA (GLshort, GLshort, GLshort); -GLAPI void APIENTRY glWindowPos3svMESA (const GLshort *); -GLAPI void APIENTRY glWindowPos4dMESA (GLdouble, GLdouble, GLdouble, GLdouble); -GLAPI void APIENTRY glWindowPos4dvMESA (const GLdouble *); -GLAPI void APIENTRY glWindowPos4fMESA (GLfloat, GLfloat, GLfloat, GLfloat); -GLAPI void APIENTRY glWindowPos4fvMESA (const GLfloat *); -GLAPI void APIENTRY glWindowPos4iMESA (GLint, GLint, GLint, GLint); -GLAPI void APIENTRY glWindowPos4ivMESA (const GLint *); -GLAPI void APIENTRY glWindowPos4sMESA (GLshort, GLshort, GLshort, GLshort); -GLAPI void APIENTRY glWindowPos4svMESA (const GLshort *); -#endif /* GL_GLEXT_PROTOTYPES */ -typedef void (APIENTRYP PFNGLWINDOWPOS2DMESAPROC) (GLdouble x, GLdouble y); -typedef void (APIENTRYP PFNGLWINDOWPOS2DVMESAPROC) (const GLdouble *v); -typedef void (APIENTRYP PFNGLWINDOWPOS2FMESAPROC) (GLfloat x, GLfloat y); -typedef void (APIENTRYP PFNGLWINDOWPOS2FVMESAPROC) (const GLfloat *v); -typedef void (APIENTRYP PFNGLWINDOWPOS2IMESAPROC) (GLint x, GLint y); -typedef void (APIENTRYP PFNGLWINDOWPOS2IVMESAPROC) (const GLint *v); -typedef void (APIENTRYP PFNGLWINDOWPOS2SMESAPROC) (GLshort x, GLshort y); -typedef void (APIENTRYP PFNGLWINDOWPOS2SVMESAPROC) (const GLshort *v); -typedef void (APIENTRYP PFNGLWINDOWPOS3DMESAPROC) (GLdouble x, GLdouble y, GLdouble z); -typedef void (APIENTRYP PFNGLWINDOWPOS3DVMESAPROC) (const GLdouble *v); -typedef void (APIENTRYP PFNGLWINDOWPOS3FMESAPROC) (GLfloat x, GLfloat y, GLfloat z); -typedef void (APIENTRYP PFNGLWINDOWPOS3FVMESAPROC) (const GLfloat *v); -typedef void (APIENTRYP PFNGLWINDOWPOS3IMESAPROC) (GLint x, GLint y, GLint z); -typedef void (APIENTRYP PFNGLWINDOWPOS3IVMESAPROC) (const GLint *v); -typedef void (APIENTRYP PFNGLWINDOWPOS3SMESAPROC) (GLshort x, GLshort y, GLshort z); -typedef void (APIENTRYP PFNGLWINDOWPOS3SVMESAPROC) (const GLshort *v); -typedef void (APIENTRYP PFNGLWINDOWPOS4DMESAPROC) (GLdouble x, GLdouble y, GLdouble z, GLdouble w); -typedef void (APIENTRYP PFNGLWINDOWPOS4DVMESAPROC) (const GLdouble *v); -typedef void (APIENTRYP PFNGLWINDOWPOS4FMESAPROC) (GLfloat x, GLfloat y, GLfloat z, GLfloat w); -typedef void (APIENTRYP PFNGLWINDOWPOS4FVMESAPROC) (const GLfloat *v); -typedef void (APIENTRYP PFNGLWINDOWPOS4IMESAPROC) (GLint x, GLint y, GLint z, GLint w); -typedef void (APIENTRYP PFNGLWINDOWPOS4IVMESAPROC) (const GLint *v); -typedef void (APIENTRYP PFNGLWINDOWPOS4SMESAPROC) (GLshort x, GLshort y, GLshort z, GLshort w); -typedef void (APIENTRYP PFNGLWINDOWPOS4SVMESAPROC) (const GLshort *v); -#endif - -#ifndef GL_IBM_cull_vertex -#define GL_IBM_cull_vertex 1 -#endif - -#ifndef GL_IBM_multimode_draw_arrays -#define GL_IBM_multimode_draw_arrays 1 -#ifdef GL_GLEXT_PROTOTYPES -GLAPI void APIENTRY glMultiModeDrawArraysIBM (const GLenum *, const GLint *, const GLsizei *, GLsizei, GLint); -GLAPI void APIENTRY glMultiModeDrawElementsIBM (const GLenum *, const GLsizei *, GLenum, const GLvoid* const *, GLsizei, GLint); -#endif /* GL_GLEXT_PROTOTYPES */ -typedef void (APIENTRYP PFNGLMULTIMODEDRAWARRAYSIBMPROC) (const GLenum *mode, const GLint *first, const GLsizei *count, GLsizei primcount, GLint modestride); -typedef void (APIENTRYP PFNGLMULTIMODEDRAWELEMENTSIBMPROC) (const GLenum *mode, const GLsizei *count, GLenum type, const GLvoid* const *indices, GLsizei primcount, GLint modestride); -#endif - -#ifndef GL_IBM_vertex_array_lists -#define GL_IBM_vertex_array_lists 1 -#ifdef GL_GLEXT_PROTOTYPES -GLAPI void APIENTRY glColorPointerListIBM (GLint, GLenum, GLint, const GLvoid* *, GLint); -GLAPI void APIENTRY glSecondaryColorPointerListIBM (GLint, GLenum, GLint, const GLvoid* *, GLint); -GLAPI void APIENTRY glEdgeFlagPointerListIBM (GLint, const GLboolean* *, GLint); -GLAPI void APIENTRY glFogCoordPointerListIBM (GLenum, GLint, const GLvoid* *, GLint); -GLAPI void APIENTRY glIndexPointerListIBM (GLenum, GLint, const GLvoid* *, GLint); -GLAPI void APIENTRY glNormalPointerListIBM (GLenum, GLint, const GLvoid* *, GLint); -GLAPI void APIENTRY glTexCoordPointerListIBM (GLint, GLenum, GLint, const GLvoid* *, GLint); -GLAPI void APIENTRY glVertexPointerListIBM (GLint, GLenum, GLint, const GLvoid* *, GLint); -#endif /* GL_GLEXT_PROTOTYPES */ -typedef void (APIENTRYP PFNGLCOLORPOINTERLISTIBMPROC) (GLint size, GLenum type, GLint stride, const GLvoid* *pointer, GLint ptrstride); -typedef void (APIENTRYP PFNGLSECONDARYCOLORPOINTERLISTIBMPROC) (GLint size, GLenum type, GLint stride, const GLvoid* *pointer, GLint ptrstride); -typedef void (APIENTRYP PFNGLEDGEFLAGPOINTERLISTIBMPROC) (GLint stride, const GLboolean* *pointer, GLint ptrstride); -typedef void (APIENTRYP PFNGLFOGCOORDPOINTERLISTIBMPROC) (GLenum type, GLint stride, const GLvoid* *pointer, GLint ptrstride); -typedef void (APIENTRYP PFNGLINDEXPOINTERLISTIBMPROC) (GLenum type, GLint stride, const GLvoid* *pointer, GLint ptrstride); -typedef void (APIENTRYP PFNGLNORMALPOINTERLISTIBMPROC) (GLenum type, GLint stride, const GLvoid* *pointer, GLint ptrstride); -typedef void (APIENTRYP PFNGLTEXCOORDPOINTERLISTIBMPROC) (GLint size, GLenum type, GLint stride, const GLvoid* *pointer, GLint ptrstride); -typedef void (APIENTRYP PFNGLVERTEXPOINTERLISTIBMPROC) (GLint size, GLenum type, GLint stride, const GLvoid* *pointer, GLint ptrstride); -#endif - -#ifndef GL_SGIX_subsample -#define GL_SGIX_subsample 1 -#endif - -#ifndef GL_SGIX_ycrcba -#define GL_SGIX_ycrcba 1 -#endif - -#ifndef GL_SGIX_ycrcb_subsample -#define GL_SGIX_ycrcb_subsample 1 -#endif - -#ifndef GL_SGIX_depth_pass_instrument -#define GL_SGIX_depth_pass_instrument 1 -#endif - -#ifndef GL_3DFX_texture_compression_FXT1 -#define GL_3DFX_texture_compression_FXT1 1 -#endif - -#ifndef GL_3DFX_multisample -#define GL_3DFX_multisample 1 -#endif - -#ifndef GL_3DFX_tbuffer -#define GL_3DFX_tbuffer 1 -#ifdef GL_GLEXT_PROTOTYPES -GLAPI void APIENTRY glTbufferMask3DFX (GLuint); -#endif /* GL_GLEXT_PROTOTYPES */ -typedef void (APIENTRYP PFNGLTBUFFERMASK3DFXPROC) (GLuint mask); -#endif - -#ifndef GL_EXT_multisample -#define GL_EXT_multisample 1 -#ifdef GL_GLEXT_PROTOTYPES -GLAPI void APIENTRY glSampleMaskEXT (GLclampf, GLboolean); -GLAPI void APIENTRY glSamplePatternEXT (GLenum); -#endif /* GL_GLEXT_PROTOTYPES */ -typedef void (APIENTRYP PFNGLSAMPLEMASKEXTPROC) (GLclampf value, GLboolean invert); -typedef void (APIENTRYP PFNGLSAMPLEPATTERNEXTPROC) (GLenum pattern); -#endif - -#ifndef GL_SGIX_vertex_preclip -#define GL_SGIX_vertex_preclip 1 -#endif - -#ifndef GL_SGIX_convolution_accuracy -#define GL_SGIX_convolution_accuracy 1 -#endif - -#ifndef GL_SGIX_resample -#define GL_SGIX_resample 1 -#endif - -#ifndef GL_SGIS_point_line_texgen -#define GL_SGIS_point_line_texgen 1 -#endif - -#ifndef GL_SGIS_texture_color_mask -#define GL_SGIS_texture_color_mask 1 -#ifdef GL_GLEXT_PROTOTYPES -GLAPI void APIENTRY glTextureColorMaskSGIS (GLboolean, GLboolean, GLboolean, GLboolean); -#endif /* GL_GLEXT_PROTOTYPES */ -typedef void (APIENTRYP PFNGLTEXTURECOLORMASKSGISPROC) (GLboolean red, GLboolean green, GLboolean blue, GLboolean alpha); -#endif - -#ifndef GL_SGIX_igloo_interface -#define GL_SGIX_igloo_interface 1 -#ifdef GL_GLEXT_PROTOTYPES -GLAPI void APIENTRY glIglooInterfaceSGIX (GLenum, const GLvoid *); -#endif /* GL_GLEXT_PROTOTYPES */ -typedef void (APIENTRYP PFNGLIGLOOINTERFACESGIXPROC) (GLenum pname, const GLvoid *params); -#endif - -#ifndef GL_EXT_texture_env_dot3 -#define GL_EXT_texture_env_dot3 1 -#endif - -#ifndef GL_ATI_texture_mirror_once -#define GL_ATI_texture_mirror_once 1 -#endif - -#ifndef GL_NV_fence -#define GL_NV_fence 1 -#ifdef GL_GLEXT_PROTOTYPES -GLAPI void APIENTRY glDeleteFencesNV (GLsizei, const GLuint *); -GLAPI void APIENTRY glGenFencesNV (GLsizei, GLuint *); -GLAPI GLboolean APIENTRY glIsFenceNV (GLuint); -GLAPI GLboolean APIENTRY glTestFenceNV (GLuint); -GLAPI void APIENTRY glGetFenceivNV (GLuint, GLenum, GLint *); -GLAPI void APIENTRY glFinishFenceNV (GLuint); -GLAPI void APIENTRY glSetFenceNV (GLuint, GLenum); -#endif /* GL_GLEXT_PROTOTYPES */ -typedef void (APIENTRYP PFNGLDELETEFENCESNVPROC) (GLsizei n, const GLuint *fences); -typedef void (APIENTRYP PFNGLGENFENCESNVPROC) (GLsizei n, GLuint *fences); -typedef GLboolean (APIENTRYP PFNGLISFENCENVPROC) (GLuint fence); -typedef GLboolean (APIENTRYP PFNGLTESTFENCENVPROC) (GLuint fence); -typedef void (APIENTRYP PFNGLGETFENCEIVNVPROC) (GLuint fence, GLenum pname, GLint *params); -typedef void (APIENTRYP PFNGLFINISHFENCENVPROC) (GLuint fence); -typedef void (APIENTRYP PFNGLSETFENCENVPROC) (GLuint fence, GLenum condition); -#endif - -#ifndef GL_NV_evaluators -#define GL_NV_evaluators 1 -#ifdef GL_GLEXT_PROTOTYPES -GLAPI void APIENTRY glMapControlPointsNV (GLenum, GLuint, GLenum, GLsizei, GLsizei, GLint, GLint, GLboolean, const GLvoid *); -GLAPI void APIENTRY glMapParameterivNV (GLenum, GLenum, const GLint *); -GLAPI void APIENTRY glMapParameterfvNV (GLenum, GLenum, const GLfloat *); -GLAPI void APIENTRY glGetMapControlPointsNV (GLenum, GLuint, GLenum, GLsizei, GLsizei, GLboolean, GLvoid *); -GLAPI void APIENTRY glGetMapParameterivNV (GLenum, GLenum, GLint *); -GLAPI void APIENTRY glGetMapParameterfvNV (GLenum, GLenum, GLfloat *); -GLAPI void APIENTRY glGetMapAttribParameterivNV (GLenum, GLuint, GLenum, GLint *); -GLAPI void APIENTRY glGetMapAttribParameterfvNV (GLenum, GLuint, GLenum, GLfloat *); -GLAPI void APIENTRY glEvalMapsNV (GLenum, GLenum); -#endif /* GL_GLEXT_PROTOTYPES */ -typedef void (APIENTRYP PFNGLMAPCONTROLPOINTSNVPROC) (GLenum target, GLuint index, GLenum type, GLsizei ustride, GLsizei vstride, GLint uorder, GLint vorder, GLboolean packed, const GLvoid *points); -typedef void (APIENTRYP PFNGLMAPPARAMETERIVNVPROC) (GLenum target, GLenum pname, const GLint *params); -typedef void (APIENTRYP PFNGLMAPPARAMETERFVNVPROC) (GLenum target, GLenum pname, const GLfloat *params); -typedef void (APIENTRYP PFNGLGETMAPCONTROLPOINTSNVPROC) (GLenum target, GLuint index, GLenum type, GLsizei ustride, GLsizei vstride, GLboolean packed, GLvoid *points); -typedef void (APIENTRYP PFNGLGETMAPPARAMETERIVNVPROC) (GLenum target, GLenum pname, GLint *params); -typedef void (APIENTRYP PFNGLGETMAPPARAMETERFVNVPROC) (GLenum target, GLenum pname, GLfloat *params); -typedef void (APIENTRYP PFNGLGETMAPATTRIBPARAMETERIVNVPROC) (GLenum target, GLuint index, GLenum pname, GLint *params); -typedef void (APIENTRYP PFNGLGETMAPATTRIBPARAMETERFVNVPROC) (GLenum target, GLuint index, GLenum pname, GLfloat *params); -typedef void (APIENTRYP PFNGLEVALMAPSNVPROC) (GLenum target, GLenum mode); -#endif - -#ifndef GL_NV_packed_depth_stencil -#define GL_NV_packed_depth_stencil 1 -#endif - -#ifndef GL_NV_register_combiners2 -#define GL_NV_register_combiners2 1 -#ifdef GL_GLEXT_PROTOTYPES -GLAPI void APIENTRY glCombinerStageParameterfvNV (GLenum, GLenum, const GLfloat *); -GLAPI void APIENTRY glGetCombinerStageParameterfvNV (GLenum, GLenum, GLfloat *); -#endif /* GL_GLEXT_PROTOTYPES */ -typedef void (APIENTRYP PFNGLCOMBINERSTAGEPARAMETERFVNVPROC) (GLenum stage, GLenum pname, const GLfloat *params); -typedef void (APIENTRYP PFNGLGETCOMBINERSTAGEPARAMETERFVNVPROC) (GLenum stage, GLenum pname, GLfloat *params); -#endif - -#ifndef GL_NV_texture_compression_vtc -#define GL_NV_texture_compression_vtc 1 -#endif - -#ifndef GL_NV_texture_rectangle -#define GL_NV_texture_rectangle 1 -#endif - -#ifndef GL_NV_texture_shader -#define GL_NV_texture_shader 1 -#endif - -#ifndef GL_NV_texture_shader2 -#define GL_NV_texture_shader2 1 -#endif - -#ifndef GL_NV_vertex_array_range2 -#define GL_NV_vertex_array_range2 1 -#endif - -#ifndef GL_NV_vertex_program -#define GL_NV_vertex_program 1 -#ifdef GL_GLEXT_PROTOTYPES -GLAPI GLboolean APIENTRY glAreProgramsResidentNV (GLsizei, const GLuint *, GLboolean *); -GLAPI void APIENTRY glBindProgramNV (GLenum, GLuint); -GLAPI void APIENTRY glDeleteProgramsNV (GLsizei, const GLuint *); -GLAPI void APIENTRY glExecuteProgramNV (GLenum, GLuint, const GLfloat *); -GLAPI void APIENTRY glGenProgramsNV (GLsizei, GLuint *); -GLAPI void APIENTRY glGetProgramParameterdvNV (GLenum, GLuint, GLenum, GLdouble *); -GLAPI void APIENTRY glGetProgramParameterfvNV (GLenum, GLuint, GLenum, GLfloat *); -GLAPI void APIENTRY glGetProgramivNV (GLuint, GLenum, GLint *); -GLAPI void APIENTRY glGetProgramStringNV (GLuint, GLenum, GLubyte *); -GLAPI void APIENTRY glGetTrackMatrixivNV (GLenum, GLuint, GLenum, GLint *); -GLAPI void APIENTRY glGetVertexAttribdvNV (GLuint, GLenum, GLdouble *); -GLAPI void APIENTRY glGetVertexAttribfvNV (GLuint, GLenum, GLfloat *); -GLAPI void APIENTRY glGetVertexAttribivNV (GLuint, GLenum, GLint *); -GLAPI void APIENTRY glGetVertexAttribPointervNV (GLuint, GLenum, GLvoid* *); -GLAPI GLboolean APIENTRY glIsProgramNV (GLuint); -GLAPI void APIENTRY glLoadProgramNV (GLenum, GLuint, GLsizei, const GLubyte *); -GLAPI void APIENTRY glProgramParameter4dNV (GLenum, GLuint, GLdouble, GLdouble, GLdouble, GLdouble); -GLAPI void APIENTRY glProgramParameter4dvNV (GLenum, GLuint, const GLdouble *); -GLAPI void APIENTRY glProgramParameter4fNV (GLenum, GLuint, GLfloat, GLfloat, GLfloat, GLfloat); -GLAPI void APIENTRY glProgramParameter4fvNV (GLenum, GLuint, const GLfloat *); -GLAPI void APIENTRY glProgramParameters4dvNV (GLenum, GLuint, GLuint, const GLdouble *); -GLAPI void APIENTRY glProgramParameters4fvNV (GLenum, GLuint, GLuint, const GLfloat *); -GLAPI void APIENTRY glRequestResidentProgramsNV (GLsizei, const GLuint *); -GLAPI void APIENTRY glTrackMatrixNV (GLenum, GLuint, GLenum, GLenum); -GLAPI void APIENTRY glVertexAttribPointerNV (GLuint, GLint, GLenum, GLsizei, const GLvoid *); -GLAPI void APIENTRY glVertexAttrib1dNV (GLuint, GLdouble); -GLAPI void APIENTRY glVertexAttrib1dvNV (GLuint, const GLdouble *); -GLAPI void APIENTRY glVertexAttrib1fNV (GLuint, GLfloat); -GLAPI void APIENTRY glVertexAttrib1fvNV (GLuint, const GLfloat *); -GLAPI void APIENTRY glVertexAttrib1sNV (GLuint, GLshort); -GLAPI void APIENTRY glVertexAttrib1svNV (GLuint, const GLshort *); -GLAPI void APIENTRY glVertexAttrib2dNV (GLuint, GLdouble, GLdouble); -GLAPI void APIENTRY glVertexAttrib2dvNV (GLuint, const GLdouble *); -GLAPI void APIENTRY glVertexAttrib2fNV (GLuint, GLfloat, GLfloat); -GLAPI void APIENTRY glVertexAttrib2fvNV (GLuint, const GLfloat *); -GLAPI void APIENTRY glVertexAttrib2sNV (GLuint, GLshort, GLshort); -GLAPI void APIENTRY glVertexAttrib2svNV (GLuint, const GLshort *); -GLAPI void APIENTRY glVertexAttrib3dNV (GLuint, GLdouble, GLdouble, GLdouble); -GLAPI void APIENTRY glVertexAttrib3dvNV (GLuint, const GLdouble *); -GLAPI void APIENTRY glVertexAttrib3fNV (GLuint, GLfloat, GLfloat, GLfloat); -GLAPI void APIENTRY glVertexAttrib3fvNV (GLuint, const GLfloat *); -GLAPI void APIENTRY glVertexAttrib3sNV (GLuint, GLshort, GLshort, GLshort); -GLAPI void APIENTRY glVertexAttrib3svNV (GLuint, const GLshort *); -GLAPI void APIENTRY glVertexAttrib4dNV (GLuint, GLdouble, GLdouble, GLdouble, GLdouble); -GLAPI void APIENTRY glVertexAttrib4dvNV (GLuint, const GLdouble *); -GLAPI void APIENTRY glVertexAttrib4fNV (GLuint, GLfloat, GLfloat, GLfloat, GLfloat); -GLAPI void APIENTRY glVertexAttrib4fvNV (GLuint, const GLfloat *); -GLAPI void APIENTRY glVertexAttrib4sNV (GLuint, GLshort, GLshort, GLshort, GLshort); -GLAPI void APIENTRY glVertexAttrib4svNV (GLuint, const GLshort *); -GLAPI void APIENTRY glVertexAttrib4ubNV (GLuint, GLubyte, GLubyte, GLubyte, GLubyte); -GLAPI void APIENTRY glVertexAttrib4ubvNV (GLuint, const GLubyte *); -GLAPI void APIENTRY glVertexAttribs1dvNV (GLuint, GLsizei, const GLdouble *); -GLAPI void APIENTRY glVertexAttribs1fvNV (GLuint, GLsizei, const GLfloat *); -GLAPI void APIENTRY glVertexAttribs1svNV (GLuint, GLsizei, const GLshort *); -GLAPI void APIENTRY glVertexAttribs2dvNV (GLuint, GLsizei, const GLdouble *); -GLAPI void APIENTRY glVertexAttribs2fvNV (GLuint, GLsizei, const GLfloat *); -GLAPI void APIENTRY glVertexAttribs2svNV (GLuint, GLsizei, const GLshort *); -GLAPI void APIENTRY glVertexAttribs3dvNV (GLuint, GLsizei, const GLdouble *); -GLAPI void APIENTRY glVertexAttribs3fvNV (GLuint, GLsizei, const GLfloat *); -GLAPI void APIENTRY glVertexAttribs3svNV (GLuint, GLsizei, const GLshort *); -GLAPI void APIENTRY glVertexAttribs4dvNV (GLuint, GLsizei, const GLdouble *); -GLAPI void APIENTRY glVertexAttribs4fvNV (GLuint, GLsizei, const GLfloat *); -GLAPI void APIENTRY glVertexAttribs4svNV (GLuint, GLsizei, const GLshort *); -GLAPI void APIENTRY glVertexAttribs4ubvNV (GLuint, GLsizei, const GLubyte *); -#endif /* GL_GLEXT_PROTOTYPES */ -typedef GLboolean (APIENTRYP PFNGLAREPROGRAMSRESIDENTNVPROC) (GLsizei n, const GLuint *programs, GLboolean *residences); -typedef void (APIENTRYP PFNGLBINDPROGRAMNVPROC) (GLenum target, GLuint id); -typedef void (APIENTRYP PFNGLDELETEPROGRAMSNVPROC) (GLsizei n, const GLuint *programs); -typedef void (APIENTRYP PFNGLEXECUTEPROGRAMNVPROC) (GLenum target, GLuint id, const GLfloat *params); -typedef void (APIENTRYP PFNGLGENPROGRAMSNVPROC) (GLsizei n, GLuint *programs); -typedef void (APIENTRYP PFNGLGETPROGRAMPARAMETERDVNVPROC) (GLenum target, GLuint index, GLenum pname, GLdouble *params); -typedef void (APIENTRYP PFNGLGETPROGRAMPARAMETERFVNVPROC) (GLenum target, GLuint index, GLenum pname, GLfloat *params); -typedef void (APIENTRYP PFNGLGETPROGRAMIVNVPROC) (GLuint id, GLenum pname, GLint *params); -typedef void (APIENTRYP PFNGLGETPROGRAMSTRINGNVPROC) (GLuint id, GLenum pname, GLubyte *program); -typedef void (APIENTRYP PFNGLGETTRACKMATRIXIVNVPROC) (GLenum target, GLuint address, GLenum pname, GLint *params); -typedef void (APIENTRYP PFNGLGETVERTEXATTRIBDVNVPROC) (GLuint index, GLenum pname, GLdouble *params); -typedef void (APIENTRYP PFNGLGETVERTEXATTRIBFVNVPROC) (GLuint index, GLenum pname, GLfloat *params); -typedef void (APIENTRYP PFNGLGETVERTEXATTRIBIVNVPROC) (GLuint index, GLenum pname, GLint *params); -typedef void (APIENTRYP PFNGLGETVERTEXATTRIBPOINTERVNVPROC) (GLuint index, GLenum pname, GLvoid* *pointer); -typedef GLboolean (APIENTRYP PFNGLISPROGRAMNVPROC) (GLuint id); -typedef void (APIENTRYP PFNGLLOADPROGRAMNVPROC) (GLenum target, GLuint id, GLsizei len, const GLubyte *program); -typedef void (APIENTRYP PFNGLPROGRAMPARAMETER4DNVPROC) (GLenum target, GLuint index, GLdouble x, GLdouble y, GLdouble z, GLdouble w); -typedef void (APIENTRYP PFNGLPROGRAMPARAMETER4DVNVPROC) (GLenum target, GLuint index, const GLdouble *v); -typedef void (APIENTRYP PFNGLPROGRAMPARAMETER4FNVPROC) (GLenum target, GLuint index, GLfloat x, GLfloat y, GLfloat z, GLfloat w); -typedef void (APIENTRYP PFNGLPROGRAMPARAMETER4FVNVPROC) (GLenum target, GLuint index, const GLfloat *v); -typedef void (APIENTRYP PFNGLPROGRAMPARAMETERS4DVNVPROC) (GLenum target, GLuint index, GLuint count, const GLdouble *v); -typedef void (APIENTRYP PFNGLPROGRAMPARAMETERS4FVNVPROC) (GLenum target, GLuint index, GLuint count, const GLfloat *v); -typedef void (APIENTRYP PFNGLREQUESTRESIDENTPROGRAMSNVPROC) (GLsizei n, const GLuint *programs); -typedef void (APIENTRYP PFNGLTRACKMATRIXNVPROC) (GLenum target, GLuint address, GLenum matrix, GLenum transform); -typedef void (APIENTRYP PFNGLVERTEXATTRIBPOINTERNVPROC) (GLuint index, GLint fsize, GLenum type, GLsizei stride, const GLvoid *pointer); -typedef void (APIENTRYP PFNGLVERTEXATTRIB1DNVPROC) (GLuint index, GLdouble x); -typedef void (APIENTRYP PFNGLVERTEXATTRIB1DVNVPROC) (GLuint index, const GLdouble *v); -typedef void (APIENTRYP PFNGLVERTEXATTRIB1FNVPROC) (GLuint index, GLfloat x); -typedef void (APIENTRYP PFNGLVERTEXATTRIB1FVNVPROC) (GLuint index, const GLfloat *v); -typedef void (APIENTRYP PFNGLVERTEXATTRIB1SNVPROC) (GLuint index, GLshort x); -typedef void (APIENTRYP PFNGLVERTEXATTRIB1SVNVPROC) (GLuint index, const GLshort *v); -typedef void (APIENTRYP PFNGLVERTEXATTRIB2DNVPROC) (GLuint index, GLdouble x, GLdouble y); -typedef void (APIENTRYP PFNGLVERTEXATTRIB2DVNVPROC) (GLuint index, const GLdouble *v); -typedef void (APIENTRYP PFNGLVERTEXATTRIB2FNVPROC) (GLuint index, GLfloat x, GLfloat y); -typedef void (APIENTRYP PFNGLVERTEXATTRIB2FVNVPROC) (GLuint index, const GLfloat *v); -typedef void (APIENTRYP PFNGLVERTEXATTRIB2SNVPROC) (GLuint index, GLshort x, GLshort y); -typedef void (APIENTRYP PFNGLVERTEXATTRIB2SVNVPROC) (GLuint index, const GLshort *v); -typedef void (APIENTRYP PFNGLVERTEXATTRIB3DNVPROC) (GLuint index, GLdouble x, GLdouble y, GLdouble z); -typedef void (APIENTRYP PFNGLVERTEXATTRIB3DVNVPROC) (GLuint index, const GLdouble *v); -typedef void (APIENTRYP PFNGLVERTEXATTRIB3FNVPROC) (GLuint index, GLfloat x, GLfloat y, GLfloat z); -typedef void (APIENTRYP PFNGLVERTEXATTRIB3FVNVPROC) (GLuint index, const GLfloat *v); -typedef void (APIENTRYP PFNGLVERTEXATTRIB3SNVPROC) (GLuint index, GLshort x, GLshort y, GLshort z); -typedef void (APIENTRYP PFNGLVERTEXATTRIB3SVNVPROC) (GLuint index, const GLshort *v); -typedef void (APIENTRYP PFNGLVERTEXATTRIB4DNVPROC) (GLuint index, GLdouble x, GLdouble y, GLdouble z, GLdouble w); -typedef void (APIENTRYP PFNGLVERTEXATTRIB4DVNVPROC) (GLuint index, const GLdouble *v); -typedef void (APIENTRYP PFNGLVERTEXATTRIB4FNVPROC) (GLuint index, GLfloat x, GLfloat y, GLfloat z, GLfloat w); -typedef void (APIENTRYP PFNGLVERTEXATTRIB4FVNVPROC) (GLuint index, const GLfloat *v); -typedef void (APIENTRYP PFNGLVERTEXATTRIB4SNVPROC) (GLuint index, GLshort x, GLshort y, GLshort z, GLshort w); -typedef void (APIENTRYP PFNGLVERTEXATTRIB4SVNVPROC) (GLuint index, const GLshort *v); -typedef void (APIENTRYP PFNGLVERTEXATTRIB4UBNVPROC) (GLuint index, GLubyte x, GLubyte y, GLubyte z, GLubyte w); -typedef void (APIENTRYP PFNGLVERTEXATTRIB4UBVNVPROC) (GLuint index, const GLubyte *v); -typedef void (APIENTRYP PFNGLVERTEXATTRIBS1DVNVPROC) (GLuint index, GLsizei count, const GLdouble *v); -typedef void (APIENTRYP PFNGLVERTEXATTRIBS1FVNVPROC) (GLuint index, GLsizei count, const GLfloat *v); -typedef void (APIENTRYP PFNGLVERTEXATTRIBS1SVNVPROC) (GLuint index, GLsizei count, const GLshort *v); -typedef void (APIENTRYP PFNGLVERTEXATTRIBS2DVNVPROC) (GLuint index, GLsizei count, const GLdouble *v); -typedef void (APIENTRYP PFNGLVERTEXATTRIBS2FVNVPROC) (GLuint index, GLsizei count, const GLfloat *v); -typedef void (APIENTRYP PFNGLVERTEXATTRIBS2SVNVPROC) (GLuint index, GLsizei count, const GLshort *v); -typedef void (APIENTRYP PFNGLVERTEXATTRIBS3DVNVPROC) (GLuint index, GLsizei count, const GLdouble *v); -typedef void (APIENTRYP PFNGLVERTEXATTRIBS3FVNVPROC) (GLuint index, GLsizei count, const GLfloat *v); -typedef void (APIENTRYP PFNGLVERTEXATTRIBS3SVNVPROC) (GLuint index, GLsizei count, const GLshort *v); -typedef void (APIENTRYP PFNGLVERTEXATTRIBS4DVNVPROC) (GLuint index, GLsizei count, const GLdouble *v); -typedef void (APIENTRYP PFNGLVERTEXATTRIBS4FVNVPROC) (GLuint index, GLsizei count, const GLfloat *v); -typedef void (APIENTRYP PFNGLVERTEXATTRIBS4SVNVPROC) (GLuint index, GLsizei count, const GLshort *v); -typedef void (APIENTRYP PFNGLVERTEXATTRIBS4UBVNVPROC) (GLuint index, GLsizei count, const GLubyte *v); -#endif - -#ifndef GL_SGIX_texture_coordinate_clamp -#define GL_SGIX_texture_coordinate_clamp 1 -#endif - -#ifndef GL_SGIX_scalebias_hint -#define GL_SGIX_scalebias_hint 1 -#endif - -#ifndef GL_OML_interlace -#define GL_OML_interlace 1 -#endif - -#ifndef GL_OML_subsample -#define GL_OML_subsample 1 -#endif - -#ifndef GL_OML_resample -#define GL_OML_resample 1 -#endif - -#ifndef GL_NV_copy_depth_to_color -#define GL_NV_copy_depth_to_color 1 -#endif - -#ifndef GL_ATI_envmap_bumpmap -#define GL_ATI_envmap_bumpmap 1 -#ifdef GL_GLEXT_PROTOTYPES -GLAPI void APIENTRY glTexBumpParameterivATI (GLenum, const GLint *); -GLAPI void APIENTRY glTexBumpParameterfvATI (GLenum, const GLfloat *); -GLAPI void APIENTRY glGetTexBumpParameterivATI (GLenum, GLint *); -GLAPI void APIENTRY glGetTexBumpParameterfvATI (GLenum, GLfloat *); -#endif /* GL_GLEXT_PROTOTYPES */ -typedef void (APIENTRYP PFNGLTEXBUMPPARAMETERIVATIPROC) (GLenum pname, const GLint *param); -typedef void (APIENTRYP PFNGLTEXBUMPPARAMETERFVATIPROC) (GLenum pname, const GLfloat *param); -typedef void (APIENTRYP PFNGLGETTEXBUMPPARAMETERIVATIPROC) (GLenum pname, GLint *param); -typedef void (APIENTRYP PFNGLGETTEXBUMPPARAMETERFVATIPROC) (GLenum pname, GLfloat *param); -#endif - -#ifndef GL_ATI_fragment_shader -#define GL_ATI_fragment_shader 1 -#ifdef GL_GLEXT_PROTOTYPES -GLAPI GLuint APIENTRY glGenFragmentShadersATI (GLuint); -GLAPI void APIENTRY glBindFragmentShaderATI (GLuint); -GLAPI void APIENTRY glDeleteFragmentShaderATI (GLuint); -GLAPI void APIENTRY glBeginFragmentShaderATI (void); -GLAPI void APIENTRY glEndFragmentShaderATI (void); -GLAPI void APIENTRY glPassTexCoordATI (GLuint, GLuint, GLenum); -GLAPI void APIENTRY glSampleMapATI (GLuint, GLuint, GLenum); -GLAPI void APIENTRY glColorFragmentOp1ATI (GLenum, GLuint, GLuint, GLuint, GLuint, GLuint, GLuint); -GLAPI void APIENTRY glColorFragmentOp2ATI (GLenum, GLuint, GLuint, GLuint, GLuint, GLuint, GLuint, GLuint, GLuint, GLuint); -GLAPI void APIENTRY glColorFragmentOp3ATI (GLenum, GLuint, GLuint, GLuint, GLuint, GLuint, GLuint, GLuint, GLuint, GLuint, GLuint, GLuint, GLuint); -GLAPI void APIENTRY glAlphaFragmentOp1ATI (GLenum, GLuint, GLuint, GLuint, GLuint, GLuint); -GLAPI void APIENTRY glAlphaFragmentOp2ATI (GLenum, GLuint, GLuint, GLuint, GLuint, GLuint, GLuint, GLuint, GLuint); -GLAPI void APIENTRY glAlphaFragmentOp3ATI (GLenum, GLuint, GLuint, GLuint, GLuint, GLuint, GLuint, GLuint, GLuint, GLuint, GLuint, GLuint); -GLAPI void APIENTRY glSetFragmentShaderConstantATI (GLuint, const GLfloat *); -#endif /* GL_GLEXT_PROTOTYPES */ -typedef GLuint (APIENTRYP PFNGLGENFRAGMENTSHADERSATIPROC) (GLuint range); -typedef void (APIENTRYP PFNGLBINDFRAGMENTSHADERATIPROC) (GLuint id); -typedef void (APIENTRYP PFNGLDELETEFRAGMENTSHADERATIPROC) (GLuint id); -typedef void (APIENTRYP PFNGLBEGINFRAGMENTSHADERATIPROC) (void); -typedef void (APIENTRYP PFNGLENDFRAGMENTSHADERATIPROC) (void); -typedef void (APIENTRYP PFNGLPASSTEXCOORDATIPROC) (GLuint dst, GLuint coord, GLenum swizzle); -typedef void (APIENTRYP PFNGLSAMPLEMAPATIPROC) (GLuint dst, GLuint interp, GLenum swizzle); -typedef void (APIENTRYP PFNGLCOLORFRAGMENTOP1ATIPROC) (GLenum op, GLuint dst, GLuint dstMask, GLuint dstMod, GLuint arg1, GLuint arg1Rep, GLuint arg1Mod); -typedef void (APIENTRYP PFNGLCOLORFRAGMENTOP2ATIPROC) (GLenum op, GLuint dst, GLuint dstMask, GLuint dstMod, GLuint arg1, GLuint arg1Rep, GLuint arg1Mod, GLuint arg2, GLuint arg2Rep, GLuint arg2Mod); -typedef void (APIENTRYP PFNGLCOLORFRAGMENTOP3ATIPROC) (GLenum op, GLuint dst, GLuint dstMask, GLuint dstMod, GLuint arg1, GLuint arg1Rep, GLuint arg1Mod, GLuint arg2, GLuint arg2Rep, GLuint arg2Mod, GLuint arg3, GLuint arg3Rep, GLuint arg3Mod); -typedef void (APIENTRYP PFNGLALPHAFRAGMENTOP1ATIPROC) (GLenum op, GLuint dst, GLuint dstMod, GLuint arg1, GLuint arg1Rep, GLuint arg1Mod); -typedef void (APIENTRYP PFNGLALPHAFRAGMENTOP2ATIPROC) (GLenum op, GLuint dst, GLuint dstMod, GLuint arg1, GLuint arg1Rep, GLuint arg1Mod, GLuint arg2, GLuint arg2Rep, GLuint arg2Mod); -typedef void (APIENTRYP PFNGLALPHAFRAGMENTOP3ATIPROC) (GLenum op, GLuint dst, GLuint dstMod, GLuint arg1, GLuint arg1Rep, GLuint arg1Mod, GLuint arg2, GLuint arg2Rep, GLuint arg2Mod, GLuint arg3, GLuint arg3Rep, GLuint arg3Mod); -typedef void (APIENTRYP PFNGLSETFRAGMENTSHADERCONSTANTATIPROC) (GLuint dst, const GLfloat *value); -#endif - -#ifndef GL_ATI_pn_triangles -#define GL_ATI_pn_triangles 1 -#ifdef GL_GLEXT_PROTOTYPES -GLAPI void APIENTRY glPNTrianglesiATI (GLenum, GLint); -GLAPI void APIENTRY glPNTrianglesfATI (GLenum, GLfloat); -#endif /* GL_GLEXT_PROTOTYPES */ -typedef void (APIENTRYP PFNGLPNTRIANGLESIATIPROC) (GLenum pname, GLint param); -typedef void (APIENTRYP PFNGLPNTRIANGLESFATIPROC) (GLenum pname, GLfloat param); -#endif - -#ifndef GL_ATI_vertex_array_object -#define GL_ATI_vertex_array_object 1 -#ifdef GL_GLEXT_PROTOTYPES -GLAPI GLuint APIENTRY glNewObjectBufferATI (GLsizei, const GLvoid *, GLenum); -GLAPI GLboolean APIENTRY glIsObjectBufferATI (GLuint); -GLAPI void APIENTRY glUpdateObjectBufferATI (GLuint, GLuint, GLsizei, const GLvoid *, GLenum); -GLAPI void APIENTRY glGetObjectBufferfvATI (GLuint, GLenum, GLfloat *); -GLAPI void APIENTRY glGetObjectBufferivATI (GLuint, GLenum, GLint *); -GLAPI void APIENTRY glFreeObjectBufferATI (GLuint); -GLAPI void APIENTRY glArrayObjectATI (GLenum, GLint, GLenum, GLsizei, GLuint, GLuint); -GLAPI void APIENTRY glGetArrayObjectfvATI (GLenum, GLenum, GLfloat *); -GLAPI void APIENTRY glGetArrayObjectivATI (GLenum, GLenum, GLint *); -GLAPI void APIENTRY glVariantArrayObjectATI (GLuint, GLenum, GLsizei, GLuint, GLuint); -GLAPI void APIENTRY glGetVariantArrayObjectfvATI (GLuint, GLenum, GLfloat *); -GLAPI void APIENTRY glGetVariantArrayObjectivATI (GLuint, GLenum, GLint *); -#endif /* GL_GLEXT_PROTOTYPES */ -typedef GLuint (APIENTRYP PFNGLNEWOBJECTBUFFERATIPROC) (GLsizei size, const GLvoid *pointer, GLenum usage); -typedef GLboolean (APIENTRYP PFNGLISOBJECTBUFFERATIPROC) (GLuint buffer); -typedef void (APIENTRYP PFNGLUPDATEOBJECTBUFFERATIPROC) (GLuint buffer, GLuint offset, GLsizei size, const GLvoid *pointer, GLenum preserve); -typedef void (APIENTRYP PFNGLGETOBJECTBUFFERFVATIPROC) (GLuint buffer, GLenum pname, GLfloat *params); -typedef void (APIENTRYP PFNGLGETOBJECTBUFFERIVATIPROC) (GLuint buffer, GLenum pname, GLint *params); -typedef void (APIENTRYP PFNGLFREEOBJECTBUFFERATIPROC) (GLuint buffer); -typedef void (APIENTRYP PFNGLARRAYOBJECTATIPROC) (GLenum array, GLint size, GLenum type, GLsizei stride, GLuint buffer, GLuint offset); -typedef void (APIENTRYP PFNGLGETARRAYOBJECTFVATIPROC) (GLenum array, GLenum pname, GLfloat *params); -typedef void (APIENTRYP PFNGLGETARRAYOBJECTIVATIPROC) (GLenum array, GLenum pname, GLint *params); -typedef void (APIENTRYP PFNGLVARIANTARRAYOBJECTATIPROC) (GLuint id, GLenum type, GLsizei stride, GLuint buffer, GLuint offset); -typedef void (APIENTRYP PFNGLGETVARIANTARRAYOBJECTFVATIPROC) (GLuint id, GLenum pname, GLfloat *params); -typedef void (APIENTRYP PFNGLGETVARIANTARRAYOBJECTIVATIPROC) (GLuint id, GLenum pname, GLint *params); -#endif - -#ifndef GL_EXT_vertex_shader -#define GL_EXT_vertex_shader 1 -#ifdef GL_GLEXT_PROTOTYPES -GLAPI void APIENTRY glBeginVertexShaderEXT (void); -GLAPI void APIENTRY glEndVertexShaderEXT (void); -GLAPI void APIENTRY glBindVertexShaderEXT (GLuint); -GLAPI GLuint APIENTRY glGenVertexShadersEXT (GLuint); -GLAPI void APIENTRY glDeleteVertexShaderEXT (GLuint); -GLAPI void APIENTRY glShaderOp1EXT (GLenum, GLuint, GLuint); -GLAPI void APIENTRY glShaderOp2EXT (GLenum, GLuint, GLuint, GLuint); -GLAPI void APIENTRY glShaderOp3EXT (GLenum, GLuint, GLuint, GLuint, GLuint); -GLAPI void APIENTRY glSwizzleEXT (GLuint, GLuint, GLenum, GLenum, GLenum, GLenum); -GLAPI void APIENTRY glWriteMaskEXT (GLuint, GLuint, GLenum, GLenum, GLenum, GLenum); -GLAPI void APIENTRY glInsertComponentEXT (GLuint, GLuint, GLuint); -GLAPI void APIENTRY glExtractComponentEXT (GLuint, GLuint, GLuint); -GLAPI GLuint APIENTRY glGenSymbolsEXT (GLenum, GLenum, GLenum, GLuint); -GLAPI void APIENTRY glSetInvariantEXT (GLuint, GLenum, const GLvoid *); -GLAPI void APIENTRY glSetLocalConstantEXT (GLuint, GLenum, const GLvoid *); -GLAPI void APIENTRY glVariantbvEXT (GLuint, const GLbyte *); -GLAPI void APIENTRY glVariantsvEXT (GLuint, const GLshort *); -GLAPI void APIENTRY glVariantivEXT (GLuint, const GLint *); -GLAPI void APIENTRY glVariantfvEXT (GLuint, const GLfloat *); -GLAPI void APIENTRY glVariantdvEXT (GLuint, const GLdouble *); -GLAPI void APIENTRY glVariantubvEXT (GLuint, const GLubyte *); -GLAPI void APIENTRY glVariantusvEXT (GLuint, const GLushort *); -GLAPI void APIENTRY glVariantuivEXT (GLuint, const GLuint *); -GLAPI void APIENTRY glVariantPointerEXT (GLuint, GLenum, GLuint, const GLvoid *); -GLAPI void APIENTRY glEnableVariantClientStateEXT (GLuint); -GLAPI void APIENTRY glDisableVariantClientStateEXT (GLuint); -GLAPI GLuint APIENTRY glBindLightParameterEXT (GLenum, GLenum); -GLAPI GLuint APIENTRY glBindMaterialParameterEXT (GLenum, GLenum); -GLAPI GLuint APIENTRY glBindTexGenParameterEXT (GLenum, GLenum, GLenum); -GLAPI GLuint APIENTRY glBindTextureUnitParameterEXT (GLenum, GLenum); -GLAPI GLuint APIENTRY glBindParameterEXT (GLenum); -GLAPI GLboolean APIENTRY glIsVariantEnabledEXT (GLuint, GLenum); -GLAPI void APIENTRY glGetVariantBooleanvEXT (GLuint, GLenum, GLboolean *); -GLAPI void APIENTRY glGetVariantIntegervEXT (GLuint, GLenum, GLint *); -GLAPI void APIENTRY glGetVariantFloatvEXT (GLuint, GLenum, GLfloat *); -GLAPI void APIENTRY glGetVariantPointervEXT (GLuint, GLenum, GLvoid* *); -GLAPI void APIENTRY glGetInvariantBooleanvEXT (GLuint, GLenum, GLboolean *); -GLAPI void APIENTRY glGetInvariantIntegervEXT (GLuint, GLenum, GLint *); -GLAPI void APIENTRY glGetInvariantFloatvEXT (GLuint, GLenum, GLfloat *); -GLAPI void APIENTRY glGetLocalConstantBooleanvEXT (GLuint, GLenum, GLboolean *); -GLAPI void APIENTRY glGetLocalConstantIntegervEXT (GLuint, GLenum, GLint *); -GLAPI void APIENTRY glGetLocalConstantFloatvEXT (GLuint, GLenum, GLfloat *); -#endif /* GL_GLEXT_PROTOTYPES */ -typedef void (APIENTRYP PFNGLBEGINVERTEXSHADEREXTPROC) (void); -typedef void (APIENTRYP PFNGLENDVERTEXSHADEREXTPROC) (void); -typedef void (APIENTRYP PFNGLBINDVERTEXSHADEREXTPROC) (GLuint id); -typedef GLuint (APIENTRYP PFNGLGENVERTEXSHADERSEXTPROC) (GLuint range); -typedef void (APIENTRYP PFNGLDELETEVERTEXSHADEREXTPROC) (GLuint id); -typedef void (APIENTRYP PFNGLSHADEROP1EXTPROC) (GLenum op, GLuint res, GLuint arg1); -typedef void (APIENTRYP PFNGLSHADEROP2EXTPROC) (GLenum op, GLuint res, GLuint arg1, GLuint arg2); -typedef void (APIENTRYP PFNGLSHADEROP3EXTPROC) (GLenum op, GLuint res, GLuint arg1, GLuint arg2, GLuint arg3); -typedef void (APIENTRYP PFNGLSWIZZLEEXTPROC) (GLuint res, GLuint in, GLenum outX, GLenum outY, GLenum outZ, GLenum outW); -typedef void (APIENTRYP PFNGLWRITEMASKEXTPROC) (GLuint res, GLuint in, GLenum outX, GLenum outY, GLenum outZ, GLenum outW); -typedef void (APIENTRYP PFNGLINSERTCOMPONENTEXTPROC) (GLuint res, GLuint src, GLuint num); -typedef void (APIENTRYP PFNGLEXTRACTCOMPONENTEXTPROC) (GLuint res, GLuint src, GLuint num); -typedef GLuint (APIENTRYP PFNGLGENSYMBOLSEXTPROC) (GLenum datatype, GLenum storagetype, GLenum range, GLuint components); -typedef void (APIENTRYP PFNGLSETINVARIANTEXTPROC) (GLuint id, GLenum type, const GLvoid *addr); -typedef void (APIENTRYP PFNGLSETLOCALCONSTANTEXTPROC) (GLuint id, GLenum type, const GLvoid *addr); -typedef void (APIENTRYP PFNGLVARIANTBVEXTPROC) (GLuint id, const GLbyte *addr); -typedef void (APIENTRYP PFNGLVARIANTSVEXTPROC) (GLuint id, const GLshort *addr); -typedef void (APIENTRYP PFNGLVARIANTIVEXTPROC) (GLuint id, const GLint *addr); -typedef void (APIENTRYP PFNGLVARIANTFVEXTPROC) (GLuint id, const GLfloat *addr); -typedef void (APIENTRYP PFNGLVARIANTDVEXTPROC) (GLuint id, const GLdouble *addr); -typedef void (APIENTRYP PFNGLVARIANTUBVEXTPROC) (GLuint id, const GLubyte *addr); -typedef void (APIENTRYP PFNGLVARIANTUSVEXTPROC) (GLuint id, const GLushort *addr); -typedef void (APIENTRYP PFNGLVARIANTUIVEXTPROC) (GLuint id, const GLuint *addr); -typedef void (APIENTRYP PFNGLVARIANTPOINTEREXTPROC) (GLuint id, GLenum type, GLuint stride, const GLvoid *addr); -typedef void (APIENTRYP PFNGLENABLEVARIANTCLIENTSTATEEXTPROC) (GLuint id); -typedef void (APIENTRYP PFNGLDISABLEVARIANTCLIENTSTATEEXTPROC) (GLuint id); -typedef GLuint (APIENTRYP PFNGLBINDLIGHTPARAMETEREXTPROC) (GLenum light, GLenum value); -typedef GLuint (APIENTRYP PFNGLBINDMATERIALPARAMETEREXTPROC) (GLenum face, GLenum value); -typedef GLuint (APIENTRYP PFNGLBINDTEXGENPARAMETEREXTPROC) (GLenum unit, GLenum coord, GLenum value); -typedef GLuint (APIENTRYP PFNGLBINDTEXTUREUNITPARAMETEREXTPROC) (GLenum unit, GLenum value); -typedef GLuint (APIENTRYP PFNGLBINDPARAMETEREXTPROC) (GLenum value); -typedef GLboolean (APIENTRYP PFNGLISVARIANTENABLEDEXTPROC) (GLuint id, GLenum cap); -typedef void (APIENTRYP PFNGLGETVARIANTBOOLEANVEXTPROC) (GLuint id, GLenum value, GLboolean *data); -typedef void (APIENTRYP PFNGLGETVARIANTINTEGERVEXTPROC) (GLuint id, GLenum value, GLint *data); -typedef void (APIENTRYP PFNGLGETVARIANTFLOATVEXTPROC) (GLuint id, GLenum value, GLfloat *data); -typedef void (APIENTRYP PFNGLGETVARIANTPOINTERVEXTPROC) (GLuint id, GLenum value, GLvoid* *data); -typedef void (APIENTRYP PFNGLGETINVARIANTBOOLEANVEXTPROC) (GLuint id, GLenum value, GLboolean *data); -typedef void (APIENTRYP PFNGLGETINVARIANTINTEGERVEXTPROC) (GLuint id, GLenum value, GLint *data); -typedef void (APIENTRYP PFNGLGETINVARIANTFLOATVEXTPROC) (GLuint id, GLenum value, GLfloat *data); -typedef void (APIENTRYP PFNGLGETLOCALCONSTANTBOOLEANVEXTPROC) (GLuint id, GLenum value, GLboolean *data); -typedef void (APIENTRYP PFNGLGETLOCALCONSTANTINTEGERVEXTPROC) (GLuint id, GLenum value, GLint *data); -typedef void (APIENTRYP PFNGLGETLOCALCONSTANTFLOATVEXTPROC) (GLuint id, GLenum value, GLfloat *data); -#endif - -#ifndef GL_ATI_vertex_streams -#define GL_ATI_vertex_streams 1 -#ifdef GL_GLEXT_PROTOTYPES -GLAPI void APIENTRY glVertexStream1sATI (GLenum, GLshort); -GLAPI void APIENTRY glVertexStream1svATI (GLenum, const GLshort *); -GLAPI void APIENTRY glVertexStream1iATI (GLenum, GLint); -GLAPI void APIENTRY glVertexStream1ivATI (GLenum, const GLint *); -GLAPI void APIENTRY glVertexStream1fATI (GLenum, GLfloat); -GLAPI void APIENTRY glVertexStream1fvATI (GLenum, const GLfloat *); -GLAPI void APIENTRY glVertexStream1dATI (GLenum, GLdouble); -GLAPI void APIENTRY glVertexStream1dvATI (GLenum, const GLdouble *); -GLAPI void APIENTRY glVertexStream2sATI (GLenum, GLshort, GLshort); -GLAPI void APIENTRY glVertexStream2svATI (GLenum, const GLshort *); -GLAPI void APIENTRY glVertexStream2iATI (GLenum, GLint, GLint); -GLAPI void APIENTRY glVertexStream2ivATI (GLenum, const GLint *); -GLAPI void APIENTRY glVertexStream2fATI (GLenum, GLfloat, GLfloat); -GLAPI void APIENTRY glVertexStream2fvATI (GLenum, const GLfloat *); -GLAPI void APIENTRY glVertexStream2dATI (GLenum, GLdouble, GLdouble); -GLAPI void APIENTRY glVertexStream2dvATI (GLenum, const GLdouble *); -GLAPI void APIENTRY glVertexStream3sATI (GLenum, GLshort, GLshort, GLshort); -GLAPI void APIENTRY glVertexStream3svATI (GLenum, const GLshort *); -GLAPI void APIENTRY glVertexStream3iATI (GLenum, GLint, GLint, GLint); -GLAPI void APIENTRY glVertexStream3ivATI (GLenum, const GLint *); -GLAPI void APIENTRY glVertexStream3fATI (GLenum, GLfloat, GLfloat, GLfloat); -GLAPI void APIENTRY glVertexStream3fvATI (GLenum, const GLfloat *); -GLAPI void APIENTRY glVertexStream3dATI (GLenum, GLdouble, GLdouble, GLdouble); -GLAPI void APIENTRY glVertexStream3dvATI (GLenum, const GLdouble *); -GLAPI void APIENTRY glVertexStream4sATI (GLenum, GLshort, GLshort, GLshort, GLshort); -GLAPI void APIENTRY glVertexStream4svATI (GLenum, const GLshort *); -GLAPI void APIENTRY glVertexStream4iATI (GLenum, GLint, GLint, GLint, GLint); -GLAPI void APIENTRY glVertexStream4ivATI (GLenum, const GLint *); -GLAPI void APIENTRY glVertexStream4fATI (GLenum, GLfloat, GLfloat, GLfloat, GLfloat); -GLAPI void APIENTRY glVertexStream4fvATI (GLenum, const GLfloat *); -GLAPI void APIENTRY glVertexStream4dATI (GLenum, GLdouble, GLdouble, GLdouble, GLdouble); -GLAPI void APIENTRY glVertexStream4dvATI (GLenum, const GLdouble *); -GLAPI void APIENTRY glNormalStream3bATI (GLenum, GLbyte, GLbyte, GLbyte); -GLAPI void APIENTRY glNormalStream3bvATI (GLenum, const GLbyte *); -GLAPI void APIENTRY glNormalStream3sATI (GLenum, GLshort, GLshort, GLshort); -GLAPI void APIENTRY glNormalStream3svATI (GLenum, const GLshort *); -GLAPI void APIENTRY glNormalStream3iATI (GLenum, GLint, GLint, GLint); -GLAPI void APIENTRY glNormalStream3ivATI (GLenum, const GLint *); -GLAPI void APIENTRY glNormalStream3fATI (GLenum, GLfloat, GLfloat, GLfloat); -GLAPI void APIENTRY glNormalStream3fvATI (GLenum, const GLfloat *); -GLAPI void APIENTRY glNormalStream3dATI (GLenum, GLdouble, GLdouble, GLdouble); -GLAPI void APIENTRY glNormalStream3dvATI (GLenum, const GLdouble *); -GLAPI void APIENTRY glClientActiveVertexStreamATI (GLenum); -GLAPI void APIENTRY glVertexBlendEnviATI (GLenum, GLint); -GLAPI void APIENTRY glVertexBlendEnvfATI (GLenum, GLfloat); -#endif /* GL_GLEXT_PROTOTYPES */ -typedef void (APIENTRYP PFNGLVERTEXSTREAM1SATIPROC) (GLenum stream, GLshort x); -typedef void (APIENTRYP PFNGLVERTEXSTREAM1SVATIPROC) (GLenum stream, const GLshort *coords); -typedef void (APIENTRYP PFNGLVERTEXSTREAM1IATIPROC) (GLenum stream, GLint x); -typedef void (APIENTRYP PFNGLVERTEXSTREAM1IVATIPROC) (GLenum stream, const GLint *coords); -typedef void (APIENTRYP PFNGLVERTEXSTREAM1FATIPROC) (GLenum stream, GLfloat x); -typedef void (APIENTRYP PFNGLVERTEXSTREAM1FVATIPROC) (GLenum stream, const GLfloat *coords); -typedef void (APIENTRYP PFNGLVERTEXSTREAM1DATIPROC) (GLenum stream, GLdouble x); -typedef void (APIENTRYP PFNGLVERTEXSTREAM1DVATIPROC) (GLenum stream, const GLdouble *coords); -typedef void (APIENTRYP PFNGLVERTEXSTREAM2SATIPROC) (GLenum stream, GLshort x, GLshort y); -typedef void (APIENTRYP PFNGLVERTEXSTREAM2SVATIPROC) (GLenum stream, const GLshort *coords); -typedef void (APIENTRYP PFNGLVERTEXSTREAM2IATIPROC) (GLenum stream, GLint x, GLint y); -typedef void (APIENTRYP PFNGLVERTEXSTREAM2IVATIPROC) (GLenum stream, const GLint *coords); -typedef void (APIENTRYP PFNGLVERTEXSTREAM2FATIPROC) (GLenum stream, GLfloat x, GLfloat y); -typedef void (APIENTRYP PFNGLVERTEXSTREAM2FVATIPROC) (GLenum stream, const GLfloat *coords); -typedef void (APIENTRYP PFNGLVERTEXSTREAM2DATIPROC) (GLenum stream, GLdouble x, GLdouble y); -typedef void (APIENTRYP PFNGLVERTEXSTREAM2DVATIPROC) (GLenum stream, const GLdouble *coords); -typedef void (APIENTRYP PFNGLVERTEXSTREAM3SATIPROC) (GLenum stream, GLshort x, GLshort y, GLshort z); -typedef void (APIENTRYP PFNGLVERTEXSTREAM3SVATIPROC) (GLenum stream, const GLshort *coords); -typedef void (APIENTRYP PFNGLVERTEXSTREAM3IATIPROC) (GLenum stream, GLint x, GLint y, GLint z); -typedef void (APIENTRYP PFNGLVERTEXSTREAM3IVATIPROC) (GLenum stream, const GLint *coords); -typedef void (APIENTRYP PFNGLVERTEXSTREAM3FATIPROC) (GLenum stream, GLfloat x, GLfloat y, GLfloat z); -typedef void (APIENTRYP PFNGLVERTEXSTREAM3FVATIPROC) (GLenum stream, const GLfloat *coords); -typedef void (APIENTRYP PFNGLVERTEXSTREAM3DATIPROC) (GLenum stream, GLdouble x, GLdouble y, GLdouble z); -typedef void (APIENTRYP PFNGLVERTEXSTREAM3DVATIPROC) (GLenum stream, const GLdouble *coords); -typedef void (APIENTRYP PFNGLVERTEXSTREAM4SATIPROC) (GLenum stream, GLshort x, GLshort y, GLshort z, GLshort w); -typedef void (APIENTRYP PFNGLVERTEXSTREAM4SVATIPROC) (GLenum stream, const GLshort *coords); -typedef void (APIENTRYP PFNGLVERTEXSTREAM4IATIPROC) (GLenum stream, GLint x, GLint y, GLint z, GLint w); -typedef void (APIENTRYP PFNGLVERTEXSTREAM4IVATIPROC) (GLenum stream, const GLint *coords); -typedef void (APIENTRYP PFNGLVERTEXSTREAM4FATIPROC) (GLenum stream, GLfloat x, GLfloat y, GLfloat z, GLfloat w); -typedef void (APIENTRYP PFNGLVERTEXSTREAM4FVATIPROC) (GLenum stream, const GLfloat *coords); -typedef void (APIENTRYP PFNGLVERTEXSTREAM4DATIPROC) (GLenum stream, GLdouble x, GLdouble y, GLdouble z, GLdouble w); -typedef void (APIENTRYP PFNGLVERTEXSTREAM4DVATIPROC) (GLenum stream, const GLdouble *coords); -typedef void (APIENTRYP PFNGLNORMALSTREAM3BATIPROC) (GLenum stream, GLbyte nx, GLbyte ny, GLbyte nz); -typedef void (APIENTRYP PFNGLNORMALSTREAM3BVATIPROC) (GLenum stream, const GLbyte *coords); -typedef void (APIENTRYP PFNGLNORMALSTREAM3SATIPROC) (GLenum stream, GLshort nx, GLshort ny, GLshort nz); -typedef void (APIENTRYP PFNGLNORMALSTREAM3SVATIPROC) (GLenum stream, const GLshort *coords); -typedef void (APIENTRYP PFNGLNORMALSTREAM3IATIPROC) (GLenum stream, GLint nx, GLint ny, GLint nz); -typedef void (APIENTRYP PFNGLNORMALSTREAM3IVATIPROC) (GLenum stream, const GLint *coords); -typedef void (APIENTRYP PFNGLNORMALSTREAM3FATIPROC) (GLenum stream, GLfloat nx, GLfloat ny, GLfloat nz); -typedef void (APIENTRYP PFNGLNORMALSTREAM3FVATIPROC) (GLenum stream, const GLfloat *coords); -typedef void (APIENTRYP PFNGLNORMALSTREAM3DATIPROC) (GLenum stream, GLdouble nx, GLdouble ny, GLdouble nz); -typedef void (APIENTRYP PFNGLNORMALSTREAM3DVATIPROC) (GLenum stream, const GLdouble *coords); -typedef void (APIENTRYP PFNGLCLIENTACTIVEVERTEXSTREAMATIPROC) (GLenum stream); -typedef void (APIENTRYP PFNGLVERTEXBLENDENVIATIPROC) (GLenum pname, GLint param); -typedef void (APIENTRYP PFNGLVERTEXBLENDENVFATIPROC) (GLenum pname, GLfloat param); -#endif - -#ifndef GL_ATI_element_array -#define GL_ATI_element_array 1 -#ifdef GL_GLEXT_PROTOTYPES -GLAPI void APIENTRY glElementPointerATI (GLenum, const GLvoid *); -GLAPI void APIENTRY glDrawElementArrayATI (GLenum, GLsizei); -GLAPI void APIENTRY glDrawRangeElementArrayATI (GLenum, GLuint, GLuint, GLsizei); -#endif /* GL_GLEXT_PROTOTYPES */ -typedef void (APIENTRYP PFNGLELEMENTPOINTERATIPROC) (GLenum type, const GLvoid *pointer); -typedef void (APIENTRYP PFNGLDRAWELEMENTARRAYATIPROC) (GLenum mode, GLsizei count); -typedef void (APIENTRYP PFNGLDRAWRANGEELEMENTARRAYATIPROC) (GLenum mode, GLuint start, GLuint end, GLsizei count); -#endif - -#ifndef GL_SUN_mesh_array -#define GL_SUN_mesh_array 1 -#ifdef GL_GLEXT_PROTOTYPES -GLAPI void APIENTRY glDrawMeshArraysSUN (GLenum, GLint, GLsizei, GLsizei); -#endif /* GL_GLEXT_PROTOTYPES */ -typedef void (APIENTRYP PFNGLDRAWMESHARRAYSSUNPROC) (GLenum mode, GLint first, GLsizei count, GLsizei width); -#endif - -#ifndef GL_SUN_slice_accum -#define GL_SUN_slice_accum 1 -#endif - -#ifndef GL_NV_multisample_filter_hint -#define GL_NV_multisample_filter_hint 1 -#endif - -#ifndef GL_NV_depth_clamp -#define GL_NV_depth_clamp 1 -#endif - -#ifndef GL_NV_occlusion_query -#define GL_NV_occlusion_query 1 -#ifdef GL_GLEXT_PROTOTYPES -GLAPI void APIENTRY glGenOcclusionQueriesNV (GLsizei, GLuint *); -GLAPI void APIENTRY glDeleteOcclusionQueriesNV (GLsizei, const GLuint *); -GLAPI GLboolean APIENTRY glIsOcclusionQueryNV (GLuint); -GLAPI void APIENTRY glBeginOcclusionQueryNV (GLuint); -GLAPI void APIENTRY glEndOcclusionQueryNV (void); -GLAPI void APIENTRY glGetOcclusionQueryivNV (GLuint, GLenum, GLint *); -GLAPI void APIENTRY glGetOcclusionQueryuivNV (GLuint, GLenum, GLuint *); -#endif /* GL_GLEXT_PROTOTYPES */ -typedef void (APIENTRYP PFNGLGENOCCLUSIONQUERIESNVPROC) (GLsizei n, GLuint *ids); -typedef void (APIENTRYP PFNGLDELETEOCCLUSIONQUERIESNVPROC) (GLsizei n, const GLuint *ids); -typedef GLboolean (APIENTRYP PFNGLISOCCLUSIONQUERYNVPROC) (GLuint id); -typedef void (APIENTRYP PFNGLBEGINOCCLUSIONQUERYNVPROC) (GLuint id); -typedef void (APIENTRYP PFNGLENDOCCLUSIONQUERYNVPROC) (void); -typedef void (APIENTRYP PFNGLGETOCCLUSIONQUERYIVNVPROC) (GLuint id, GLenum pname, GLint *params); -typedef void (APIENTRYP PFNGLGETOCCLUSIONQUERYUIVNVPROC) (GLuint id, GLenum pname, GLuint *params); -#endif - -#ifndef GL_NV_point_sprite -#define GL_NV_point_sprite 1 -#ifdef GL_GLEXT_PROTOTYPES -GLAPI void APIENTRY glPointParameteriNV (GLenum, GLint); -GLAPI void APIENTRY glPointParameterivNV (GLenum, const GLint *); -#endif /* GL_GLEXT_PROTOTYPES */ -typedef void (APIENTRYP PFNGLPOINTPARAMETERINVPROC) (GLenum pname, GLint param); -typedef void (APIENTRYP PFNGLPOINTPARAMETERIVNVPROC) (GLenum pname, const GLint *params); -#endif - -#ifndef GL_NV_texture_shader3 -#define GL_NV_texture_shader3 1 -#endif - -#ifndef GL_NV_vertex_program1_1 -#define GL_NV_vertex_program1_1 1 -#endif - -#ifndef GL_EXT_shadow_funcs -#define GL_EXT_shadow_funcs 1 -#endif - -#ifndef GL_EXT_stencil_two_side -#define GL_EXT_stencil_two_side 1 -#ifdef GL_GLEXT_PROTOTYPES -GLAPI void APIENTRY glActiveStencilFaceEXT (GLenum); -#endif /* GL_GLEXT_PROTOTYPES */ -typedef void (APIENTRYP PFNGLACTIVESTENCILFACEEXTPROC) (GLenum face); -#endif - -#ifndef GL_ATI_text_fragment_shader -#define GL_ATI_text_fragment_shader 1 -#endif - -#ifndef GL_APPLE_client_storage -#define GL_APPLE_client_storage 1 -#endif - -#ifndef GL_APPLE_element_array -#define GL_APPLE_element_array 1 -#ifdef GL_GLEXT_PROTOTYPES -GLAPI void APIENTRY glElementPointerAPPLE (GLenum, const GLvoid *); -GLAPI void APIENTRY glDrawElementArrayAPPLE (GLenum, GLint, GLsizei); -GLAPI void APIENTRY glDrawRangeElementArrayAPPLE (GLenum, GLuint, GLuint, GLint, GLsizei); -GLAPI void APIENTRY glMultiDrawElementArrayAPPLE (GLenum, const GLint *, const GLsizei *, GLsizei); -GLAPI void APIENTRY glMultiDrawRangeElementArrayAPPLE (GLenum, GLuint, GLuint, const GLint *, const GLsizei *, GLsizei); -#endif /* GL_GLEXT_PROTOTYPES */ -typedef void (APIENTRYP PFNGLELEMENTPOINTERAPPLEPROC) (GLenum type, const GLvoid *pointer); -typedef void (APIENTRYP PFNGLDRAWELEMENTARRAYAPPLEPROC) (GLenum mode, GLint first, GLsizei count); -typedef void (APIENTRYP PFNGLDRAWRANGEELEMENTARRAYAPPLEPROC) (GLenum mode, GLuint start, GLuint end, GLint first, GLsizei count); -typedef void (APIENTRYP PFNGLMULTIDRAWELEMENTARRAYAPPLEPROC) (GLenum mode, const GLint *first, const GLsizei *count, GLsizei primcount); -typedef void (APIENTRYP PFNGLMULTIDRAWRANGEELEMENTARRAYAPPLEPROC) (GLenum mode, GLuint start, GLuint end, const GLint *first, const GLsizei *count, GLsizei primcount); -#endif - -#ifndef GL_APPLE_fence -#define GL_APPLE_fence 1 -#ifdef GL_GLEXT_PROTOTYPES -GLAPI void APIENTRY glGenFencesAPPLE (GLsizei, GLuint *); -GLAPI void APIENTRY glDeleteFencesAPPLE (GLsizei, const GLuint *); -GLAPI void APIENTRY glSetFenceAPPLE (GLuint); -GLAPI GLboolean APIENTRY glIsFenceAPPLE (GLuint); -GLAPI GLboolean APIENTRY glTestFenceAPPLE (GLuint); -GLAPI void APIENTRY glFinishFenceAPPLE (GLuint); -GLAPI GLboolean APIENTRY glTestObjectAPPLE (GLenum, GLuint); -GLAPI void APIENTRY glFinishObjectAPPLE (GLenum, GLint); -#endif /* GL_GLEXT_PROTOTYPES */ -typedef void (APIENTRYP PFNGLGENFENCESAPPLEPROC) (GLsizei n, GLuint *fences); -typedef void (APIENTRYP PFNGLDELETEFENCESAPPLEPROC) (GLsizei n, const GLuint *fences); -typedef void (APIENTRYP PFNGLSETFENCEAPPLEPROC) (GLuint fence); -typedef GLboolean (APIENTRYP PFNGLISFENCEAPPLEPROC) (GLuint fence); -typedef GLboolean (APIENTRYP PFNGLTESTFENCEAPPLEPROC) (GLuint fence); -typedef void (APIENTRYP PFNGLFINISHFENCEAPPLEPROC) (GLuint fence); -typedef GLboolean (APIENTRYP PFNGLTESTOBJECTAPPLEPROC) (GLenum object, GLuint name); -typedef void (APIENTRYP PFNGLFINISHOBJECTAPPLEPROC) (GLenum object, GLint name); -#endif - -#ifndef GL_APPLE_vertex_array_object -#define GL_APPLE_vertex_array_object 1 -#ifdef GL_GLEXT_PROTOTYPES -GLAPI void APIENTRY glBindVertexArrayAPPLE (GLuint); -GLAPI void APIENTRY glDeleteVertexArraysAPPLE (GLsizei, const GLuint *); -GLAPI void APIENTRY glGenVertexArraysAPPLE (GLsizei, const GLuint *); -GLAPI GLboolean APIENTRY glIsVertexArrayAPPLE (GLuint); -#endif /* GL_GLEXT_PROTOTYPES */ -typedef void (APIENTRYP PFNGLBINDVERTEXARRAYAPPLEPROC) (GLuint array); -typedef void (APIENTRYP PFNGLDELETEVERTEXARRAYSAPPLEPROC) (GLsizei n, const GLuint *arrays); -typedef void (APIENTRYP PFNGLGENVERTEXARRAYSAPPLEPROC) (GLsizei n, const GLuint *arrays); -typedef GLboolean (APIENTRYP PFNGLISVERTEXARRAYAPPLEPROC) (GLuint array); -#endif - -#ifndef GL_APPLE_vertex_array_range -#define GL_APPLE_vertex_array_range 1 -#ifdef GL_GLEXT_PROTOTYPES -GLAPI void APIENTRY glVertexArrayRangeAPPLE (GLsizei, GLvoid *); -GLAPI void APIENTRY glFlushVertexArrayRangeAPPLE (GLsizei, GLvoid *); -GLAPI void APIENTRY glVertexArrayParameteriAPPLE (GLenum, GLint); -#endif /* GL_GLEXT_PROTOTYPES */ -typedef void (APIENTRYP PFNGLVERTEXARRAYRANGEAPPLEPROC) (GLsizei length, GLvoid *pointer); -typedef void (APIENTRYP PFNGLFLUSHVERTEXARRAYRANGEAPPLEPROC) (GLsizei length, GLvoid *pointer); -typedef void (APIENTRYP PFNGLVERTEXARRAYPARAMETERIAPPLEPROC) (GLenum pname, GLint param); -#endif - -#ifndef GL_APPLE_ycbcr_422 -#define GL_APPLE_ycbcr_422 1 -#endif - -#ifndef GL_S3_s3tc -#define GL_S3_s3tc 1 -#endif - -#ifndef GL_ATI_draw_buffers -#define GL_ATI_draw_buffers 1 -#ifdef GL_GLEXT_PROTOTYPES -GLAPI void APIENTRY glDrawBuffersATI (GLsizei, const GLenum *); -#endif /* GL_GLEXT_PROTOTYPES */ -typedef void (APIENTRYP PFNGLDRAWBUFFERSATIPROC) (GLsizei n, const GLenum *bufs); -#endif - -#ifndef GL_ATI_pixel_format_float -#define GL_ATI_pixel_format_float 1 -/* This is really a WGL extension, but defines some associated GL enums. - * ATI does not export "GL_ATI_pixel_format_float" in the GL_EXTENSIONS string. - */ -#endif - -#ifndef GL_ATI_texture_env_combine3 -#define GL_ATI_texture_env_combine3 1 -#endif - -#ifndef GL_ATI_texture_float -#define GL_ATI_texture_float 1 -#endif - -#ifndef GL_NV_float_buffer -#define GL_NV_float_buffer 1 -#endif - -#ifndef GL_NV_fragment_program -#define GL_NV_fragment_program 1 -/* Some NV_fragment_program entry points are shared with ARB_vertex_program. */ -#ifdef GL_GLEXT_PROTOTYPES -GLAPI void APIENTRY glProgramNamedParameter4fNV (GLuint, GLsizei, const GLubyte *, GLfloat, GLfloat, GLfloat, GLfloat); -GLAPI void APIENTRY glProgramNamedParameter4dNV (GLuint, GLsizei, const GLubyte *, GLdouble, GLdouble, GLdouble, GLdouble); -GLAPI void APIENTRY glProgramNamedParameter4fvNV (GLuint, GLsizei, const GLubyte *, const GLfloat *); -GLAPI void APIENTRY glProgramNamedParameter4dvNV (GLuint, GLsizei, const GLubyte *, const GLdouble *); -GLAPI void APIENTRY glGetProgramNamedParameterfvNV (GLuint, GLsizei, const GLubyte *, GLfloat *); -GLAPI void APIENTRY glGetProgramNamedParameterdvNV (GLuint, GLsizei, const GLubyte *, GLdouble *); -#endif /* GL_GLEXT_PROTOTYPES */ -typedef void (APIENTRYP PFNGLPROGRAMNAMEDPARAMETER4FNVPROC) (GLuint id, GLsizei len, const GLubyte *name, GLfloat x, GLfloat y, GLfloat z, GLfloat w); -typedef void (APIENTRYP PFNGLPROGRAMNAMEDPARAMETER4DNVPROC) (GLuint id, GLsizei len, const GLubyte *name, GLdouble x, GLdouble y, GLdouble z, GLdouble w); -typedef void (APIENTRYP PFNGLPROGRAMNAMEDPARAMETER4FVNVPROC) (GLuint id, GLsizei len, const GLubyte *name, const GLfloat *v); -typedef void (APIENTRYP PFNGLPROGRAMNAMEDPARAMETER4DVNVPROC) (GLuint id, GLsizei len, const GLubyte *name, const GLdouble *v); -typedef void (APIENTRYP PFNGLGETPROGRAMNAMEDPARAMETERFVNVPROC) (GLuint id, GLsizei len, const GLubyte *name, GLfloat *params); -typedef void (APIENTRYP PFNGLGETPROGRAMNAMEDPARAMETERDVNVPROC) (GLuint id, GLsizei len, const GLubyte *name, GLdouble *params); -#endif - -#ifndef GL_NV_half_float -#define GL_NV_half_float 1 -#ifdef GL_GLEXT_PROTOTYPES -GLAPI void APIENTRY glVertex2hNV (GLhalfNV, GLhalfNV); -GLAPI void APIENTRY glVertex2hvNV (const GLhalfNV *); -GLAPI void APIENTRY glVertex3hNV (GLhalfNV, GLhalfNV, GLhalfNV); -GLAPI void APIENTRY glVertex3hvNV (const GLhalfNV *); -GLAPI void APIENTRY glVertex4hNV (GLhalfNV, GLhalfNV, GLhalfNV, GLhalfNV); -GLAPI void APIENTRY glVertex4hvNV (const GLhalfNV *); -GLAPI void APIENTRY glNormal3hNV (GLhalfNV, GLhalfNV, GLhalfNV); -GLAPI void APIENTRY glNormal3hvNV (const GLhalfNV *); -GLAPI void APIENTRY glColor3hNV (GLhalfNV, GLhalfNV, GLhalfNV); -GLAPI void APIENTRY glColor3hvNV (const GLhalfNV *); -GLAPI void APIENTRY glColor4hNV (GLhalfNV, GLhalfNV, GLhalfNV, GLhalfNV); -GLAPI void APIENTRY glColor4hvNV (const GLhalfNV *); -GLAPI void APIENTRY glTexCoord1hNV (GLhalfNV); -GLAPI void APIENTRY glTexCoord1hvNV (const GLhalfNV *); -GLAPI void APIENTRY glTexCoord2hNV (GLhalfNV, GLhalfNV); -GLAPI void APIENTRY glTexCoord2hvNV (const GLhalfNV *); -GLAPI void APIENTRY glTexCoord3hNV (GLhalfNV, GLhalfNV, GLhalfNV); -GLAPI void APIENTRY glTexCoord3hvNV (const GLhalfNV *); -GLAPI void APIENTRY glTexCoord4hNV (GLhalfNV, GLhalfNV, GLhalfNV, GLhalfNV); -GLAPI void APIENTRY glTexCoord4hvNV (const GLhalfNV *); -GLAPI void APIENTRY glMultiTexCoord1hNV (GLenum, GLhalfNV); -GLAPI void APIENTRY glMultiTexCoord1hvNV (GLenum, const GLhalfNV *); -GLAPI void APIENTRY glMultiTexCoord2hNV (GLenum, GLhalfNV, GLhalfNV); -GLAPI void APIENTRY glMultiTexCoord2hvNV (GLenum, const GLhalfNV *); -GLAPI void APIENTRY glMultiTexCoord3hNV (GLenum, GLhalfNV, GLhalfNV, GLhalfNV); -GLAPI void APIENTRY glMultiTexCoord3hvNV (GLenum, const GLhalfNV *); -GLAPI void APIENTRY glMultiTexCoord4hNV (GLenum, GLhalfNV, GLhalfNV, GLhalfNV, GLhalfNV); -GLAPI void APIENTRY glMultiTexCoord4hvNV (GLenum, const GLhalfNV *); -GLAPI void APIENTRY glFogCoordhNV (GLhalfNV); -GLAPI void APIENTRY glFogCoordhvNV (const GLhalfNV *); -GLAPI void APIENTRY glSecondaryColor3hNV (GLhalfNV, GLhalfNV, GLhalfNV); -GLAPI void APIENTRY glSecondaryColor3hvNV (const GLhalfNV *); -GLAPI void APIENTRY glVertexWeighthNV (GLhalfNV); -GLAPI void APIENTRY glVertexWeighthvNV (const GLhalfNV *); -GLAPI void APIENTRY glVertexAttrib1hNV (GLuint, GLhalfNV); -GLAPI void APIENTRY glVertexAttrib1hvNV (GLuint, const GLhalfNV *); -GLAPI void APIENTRY glVertexAttrib2hNV (GLuint, GLhalfNV, GLhalfNV); -GLAPI void APIENTRY glVertexAttrib2hvNV (GLuint, const GLhalfNV *); -GLAPI void APIENTRY glVertexAttrib3hNV (GLuint, GLhalfNV, GLhalfNV, GLhalfNV); -GLAPI void APIENTRY glVertexAttrib3hvNV (GLuint, const GLhalfNV *); -GLAPI void APIENTRY glVertexAttrib4hNV (GLuint, GLhalfNV, GLhalfNV, GLhalfNV, GLhalfNV); -GLAPI void APIENTRY glVertexAttrib4hvNV (GLuint, const GLhalfNV *); -GLAPI void APIENTRY glVertexAttribs1hvNV (GLuint, GLsizei, const GLhalfNV *); -GLAPI void APIENTRY glVertexAttribs2hvNV (GLuint, GLsizei, const GLhalfNV *); -GLAPI void APIENTRY glVertexAttribs3hvNV (GLuint, GLsizei, const GLhalfNV *); -GLAPI void APIENTRY glVertexAttribs4hvNV (GLuint, GLsizei, const GLhalfNV *); -#endif /* GL_GLEXT_PROTOTYPES */ -typedef void (APIENTRYP PFNGLVERTEX2HNVPROC) (GLhalfNV x, GLhalfNV y); -typedef void (APIENTRYP PFNGLVERTEX2HVNVPROC) (const GLhalfNV *v); -typedef void (APIENTRYP PFNGLVERTEX3HNVPROC) (GLhalfNV x, GLhalfNV y, GLhalfNV z); -typedef void (APIENTRYP PFNGLVERTEX3HVNVPROC) (const GLhalfNV *v); -typedef void (APIENTRYP PFNGLVERTEX4HNVPROC) (GLhalfNV x, GLhalfNV y, GLhalfNV z, GLhalfNV w); -typedef void (APIENTRYP PFNGLVERTEX4HVNVPROC) (const GLhalfNV *v); -typedef void (APIENTRYP PFNGLNORMAL3HNVPROC) (GLhalfNV nx, GLhalfNV ny, GLhalfNV nz); -typedef void (APIENTRYP PFNGLNORMAL3HVNVPROC) (const GLhalfNV *v); -typedef void (APIENTRYP PFNGLCOLOR3HNVPROC) (GLhalfNV red, GLhalfNV green, GLhalfNV blue); -typedef void (APIENTRYP PFNGLCOLOR3HVNVPROC) (const GLhalfNV *v); -typedef void (APIENTRYP PFNGLCOLOR4HNVPROC) (GLhalfNV red, GLhalfNV green, GLhalfNV blue, GLhalfNV alpha); -typedef void (APIENTRYP PFNGLCOLOR4HVNVPROC) (const GLhalfNV *v); -typedef void (APIENTRYP PFNGLTEXCOORD1HNVPROC) (GLhalfNV s); -typedef void (APIENTRYP PFNGLTEXCOORD1HVNVPROC) (const GLhalfNV *v); -typedef void (APIENTRYP PFNGLTEXCOORD2HNVPROC) (GLhalfNV s, GLhalfNV t); -typedef void (APIENTRYP PFNGLTEXCOORD2HVNVPROC) (const GLhalfNV *v); -typedef void (APIENTRYP PFNGLTEXCOORD3HNVPROC) (GLhalfNV s, GLhalfNV t, GLhalfNV r); -typedef void (APIENTRYP PFNGLTEXCOORD3HVNVPROC) (const GLhalfNV *v); -typedef void (APIENTRYP PFNGLTEXCOORD4HNVPROC) (GLhalfNV s, GLhalfNV t, GLhalfNV r, GLhalfNV q); -typedef void (APIENTRYP PFNGLTEXCOORD4HVNVPROC) (const GLhalfNV *v); -typedef void (APIENTRYP PFNGLMULTITEXCOORD1HNVPROC) (GLenum target, GLhalfNV s); -typedef void (APIENTRYP PFNGLMULTITEXCOORD1HVNVPROC) (GLenum target, const GLhalfNV *v); -typedef void (APIENTRYP PFNGLMULTITEXCOORD2HNVPROC) (GLenum target, GLhalfNV s, GLhalfNV t); -typedef void (APIENTRYP PFNGLMULTITEXCOORD2HVNVPROC) (GLenum target, const GLhalfNV *v); -typedef void (APIENTRYP PFNGLMULTITEXCOORD3HNVPROC) (GLenum target, GLhalfNV s, GLhalfNV t, GLhalfNV r); -typedef void (APIENTRYP PFNGLMULTITEXCOORD3HVNVPROC) (GLenum target, const GLhalfNV *v); -typedef void (APIENTRYP PFNGLMULTITEXCOORD4HNVPROC) (GLenum target, GLhalfNV s, GLhalfNV t, GLhalfNV r, GLhalfNV q); -typedef void (APIENTRYP PFNGLMULTITEXCOORD4HVNVPROC) (GLenum target, const GLhalfNV *v); -typedef void (APIENTRYP PFNGLFOGCOORDHNVPROC) (GLhalfNV fog); -typedef void (APIENTRYP PFNGLFOGCOORDHVNVPROC) (const GLhalfNV *fog); -typedef void (APIENTRYP PFNGLSECONDARYCOLOR3HNVPROC) (GLhalfNV red, GLhalfNV green, GLhalfNV blue); -typedef void (APIENTRYP PFNGLSECONDARYCOLOR3HVNVPROC) (const GLhalfNV *v); -typedef void (APIENTRYP PFNGLVERTEXWEIGHTHNVPROC) (GLhalfNV weight); -typedef void (APIENTRYP PFNGLVERTEXWEIGHTHVNVPROC) (const GLhalfNV *weight); -typedef void (APIENTRYP PFNGLVERTEXATTRIB1HNVPROC) (GLuint index, GLhalfNV x); -typedef void (APIENTRYP PFNGLVERTEXATTRIB1HVNVPROC) (GLuint index, const GLhalfNV *v); -typedef void (APIENTRYP PFNGLVERTEXATTRIB2HNVPROC) (GLuint index, GLhalfNV x, GLhalfNV y); -typedef void (APIENTRYP PFNGLVERTEXATTRIB2HVNVPROC) (GLuint index, const GLhalfNV *v); -typedef void (APIENTRYP PFNGLVERTEXATTRIB3HNVPROC) (GLuint index, GLhalfNV x, GLhalfNV y, GLhalfNV z); -typedef void (APIENTRYP PFNGLVERTEXATTRIB3HVNVPROC) (GLuint index, const GLhalfNV *v); -typedef void (APIENTRYP PFNGLVERTEXATTRIB4HNVPROC) (GLuint index, GLhalfNV x, GLhalfNV y, GLhalfNV z, GLhalfNV w); -typedef void (APIENTRYP PFNGLVERTEXATTRIB4HVNVPROC) (GLuint index, const GLhalfNV *v); -typedef void (APIENTRYP PFNGLVERTEXATTRIBS1HVNVPROC) (GLuint index, GLsizei n, const GLhalfNV *v); -typedef void (APIENTRYP PFNGLVERTEXATTRIBS2HVNVPROC) (GLuint index, GLsizei n, const GLhalfNV *v); -typedef void (APIENTRYP PFNGLVERTEXATTRIBS3HVNVPROC) (GLuint index, GLsizei n, const GLhalfNV *v); -typedef void (APIENTRYP PFNGLVERTEXATTRIBS4HVNVPROC) (GLuint index, GLsizei n, const GLhalfNV *v); -#endif - -#ifndef GL_NV_pixel_data_range -#define GL_NV_pixel_data_range 1 -#ifdef GL_GLEXT_PROTOTYPES -GLAPI void APIENTRY glPixelDataRangeNV (GLenum, GLsizei, GLvoid *); -GLAPI void APIENTRY glFlushPixelDataRangeNV (GLenum); -#endif /* GL_GLEXT_PROTOTYPES */ -typedef void (APIENTRYP PFNGLPIXELDATARANGENVPROC) (GLenum target, GLsizei length, GLvoid *pointer); -typedef void (APIENTRYP PFNGLFLUSHPIXELDATARANGENVPROC) (GLenum target); -#endif - -#ifndef GL_NV_primitive_restart -#define GL_NV_primitive_restart 1 -#ifdef GL_GLEXT_PROTOTYPES -GLAPI void APIENTRY glPrimitiveRestartNV (void); -GLAPI void APIENTRY glPrimitiveRestartIndexNV (GLuint); -#endif /* GL_GLEXT_PROTOTYPES */ -typedef void (APIENTRYP PFNGLPRIMITIVERESTARTNVPROC) (void); -typedef void (APIENTRYP PFNGLPRIMITIVERESTARTINDEXNVPROC) (GLuint index); -#endif - -#ifndef GL_NV_texture_expand_normal -#define GL_NV_texture_expand_normal 1 -#endif - -#ifndef GL_NV_vertex_program2 -#define GL_NV_vertex_program2 1 -#endif - -#ifndef GL_ATI_map_object_buffer -#define GL_ATI_map_object_buffer 1 -#ifdef GL_GLEXT_PROTOTYPES -GLAPI GLvoid* APIENTRY glMapObjectBufferATI (GLuint); -GLAPI void APIENTRY glUnmapObjectBufferATI (GLuint); -#endif /* GL_GLEXT_PROTOTYPES */ -typedef GLvoid* (APIENTRYP PFNGLMAPOBJECTBUFFERATIPROC) (GLuint buffer); -typedef void (APIENTRYP PFNGLUNMAPOBJECTBUFFERATIPROC) (GLuint buffer); -#endif - -#ifndef GL_ATI_separate_stencil -#define GL_ATI_separate_stencil 1 -#ifdef GL_GLEXT_PROTOTYPES -GLAPI void APIENTRY glStencilOpSeparateATI (GLenum, GLenum, GLenum, GLenum); -GLAPI void APIENTRY glStencilFuncSeparateATI (GLenum, GLenum, GLint, GLuint); -#endif /* GL_GLEXT_PROTOTYPES */ -typedef void (APIENTRYP PFNGLSTENCILOPSEPARATEATIPROC) (GLenum face, GLenum sfail, GLenum dpfail, GLenum dppass); -typedef void (APIENTRYP PFNGLSTENCILFUNCSEPARATEATIPROC) (GLenum frontfunc, GLenum backfunc, GLint ref, GLuint mask); -#endif - -#ifndef GL_ATI_vertex_attrib_array_object -#define GL_ATI_vertex_attrib_array_object 1 -#ifdef GL_GLEXT_PROTOTYPES -GLAPI void APIENTRY glVertexAttribArrayObjectATI (GLuint, GLint, GLenum, GLboolean, GLsizei, GLuint, GLuint); -GLAPI void APIENTRY glGetVertexAttribArrayObjectfvATI (GLuint, GLenum, GLfloat *); -GLAPI void APIENTRY glGetVertexAttribArrayObjectivATI (GLuint, GLenum, GLint *); -#endif /* GL_GLEXT_PROTOTYPES */ -typedef void (APIENTRYP PFNGLVERTEXATTRIBARRAYOBJECTATIPROC) (GLuint index, GLint size, GLenum type, GLboolean normalized, GLsizei stride, GLuint buffer, GLuint offset); -typedef void (APIENTRYP PFNGLGETVERTEXATTRIBARRAYOBJECTFVATIPROC) (GLuint index, GLenum pname, GLfloat *params); -typedef void (APIENTRYP PFNGLGETVERTEXATTRIBARRAYOBJECTIVATIPROC) (GLuint index, GLenum pname, GLint *params); -#endif - -#ifndef GL_OES_read_format -#define GL_OES_read_format 1 -#endif - -#ifndef GL_EXT_depth_bounds_test -#define GL_EXT_depth_bounds_test 1 -#ifdef GL_GLEXT_PROTOTYPES -GLAPI void APIENTRY glDepthBoundsEXT (GLclampd, GLclampd); -#endif /* GL_GLEXT_PROTOTYPES */ -typedef void (APIENTRYP PFNGLDEPTHBOUNDSEXTPROC) (GLclampd zmin, GLclampd zmax); -#endif - -#ifndef GL_EXT_texture_mirror_clamp -#define GL_EXT_texture_mirror_clamp 1 -#endif - -#ifndef GL_EXT_blend_equation_separate -#define GL_EXT_blend_equation_separate 1 -#ifdef GL_GLEXT_PROTOTYPES -GLAPI void APIENTRY glBlendEquationSeparateEXT (GLenum, GLenum); -#endif /* GL_GLEXT_PROTOTYPES */ -typedef void (APIENTRYP PFNGLBLENDEQUATIONSEPARATEEXTPROC) (GLenum modeRGB, GLenum modeAlpha); -#endif - -#ifndef GL_MESA_pack_invert -#define GL_MESA_pack_invert 1 -#endif - -#ifndef GL_MESA_ycbcr_texture -#define GL_MESA_ycbcr_texture 1 -#endif - -#ifndef GL_EXT_pixel_buffer_object -#define GL_EXT_pixel_buffer_object 1 -#endif - -#ifndef GL_NV_fragment_program_option -#define GL_NV_fragment_program_option 1 -#endif - -#ifndef GL_NV_fragment_program2 -#define GL_NV_fragment_program2 1 -#endif - -#ifndef GL_NV_vertex_program2_option -#define GL_NV_vertex_program2_option 1 -#endif - -#ifndef GL_NV_vertex_program3 -#define GL_NV_vertex_program3 1 -#endif - -#ifndef GL_EXT_framebuffer_object -#define GL_EXT_framebuffer_object 1 -#ifdef GL_GLEXT_PROTOTYPES -GLAPI GLboolean APIENTRY glIsRenderbufferEXT (GLuint); -GLAPI void APIENTRY glBindRenderbufferEXT (GLenum, GLuint); -GLAPI void APIENTRY glDeleteRenderbuffersEXT (GLsizei, const GLuint *); -GLAPI void APIENTRY glGenRenderbuffersEXT (GLsizei, GLuint *); -GLAPI void APIENTRY glRenderbufferStorageEXT (GLenum, GLenum, GLsizei, GLsizei); -GLAPI void APIENTRY glGetRenderbufferParameterivEXT (GLenum, GLenum, GLint *); -GLAPI GLboolean APIENTRY glIsFramebufferEXT (GLuint); -GLAPI void APIENTRY glBindFramebufferEXT (GLenum, GLuint); -GLAPI void APIENTRY glDeleteFramebuffersEXT (GLsizei, const GLuint *); -GLAPI void APIENTRY glGenFramebuffersEXT (GLsizei, GLuint *); -GLAPI GLenum APIENTRY glCheckFramebufferStatusEXT (GLenum); -GLAPI void APIENTRY glFramebufferTexture1DEXT (GLenum, GLenum, GLenum, GLuint, GLint); -GLAPI void APIENTRY glFramebufferTexture2DEXT (GLenum, GLenum, GLenum, GLuint, GLint); -GLAPI void APIENTRY glFramebufferTexture3DEXT (GLenum, GLenum, GLenum, GLuint, GLint, GLint); -GLAPI void APIENTRY glFramebufferRenderbufferEXT (GLenum, GLenum, GLenum, GLuint); -GLAPI void APIENTRY glGetFramebufferAttachmentParameterivEXT (GLenum, GLenum, GLenum, GLint *); -GLAPI void APIENTRY glGenerateMipmapEXT (GLenum); -#endif /* GL_GLEXT_PROTOTYPES */ -typedef GLboolean (APIENTRYP PFNGLISRENDERBUFFEREXTPROC) (GLuint renderbuffer); -typedef void (APIENTRYP PFNGLBINDRENDERBUFFEREXTPROC) (GLenum target, GLuint renderbuffer); -typedef void (APIENTRYP PFNGLDELETERENDERBUFFERSEXTPROC) (GLsizei n, const GLuint *renderbuffers); -typedef void (APIENTRYP PFNGLGENRENDERBUFFERSEXTPROC) (GLsizei n, GLuint *renderbuffers); -typedef void (APIENTRYP PFNGLRENDERBUFFERSTORAGEEXTPROC) (GLenum target, GLenum internalformat, GLsizei width, GLsizei height); -typedef void (APIENTRYP PFNGLGETRENDERBUFFERPARAMETERIVEXTPROC) (GLenum target, GLenum pname, GLint *params); -typedef GLboolean (APIENTRYP PFNGLISFRAMEBUFFEREXTPROC) (GLuint framebuffer); -typedef void (APIENTRYP PFNGLBINDFRAMEBUFFEREXTPROC) (GLenum target, GLuint framebuffer); -typedef void (APIENTRYP PFNGLDELETEFRAMEBUFFERSEXTPROC) (GLsizei n, const GLuint *framebuffers); -typedef void (APIENTRYP PFNGLGENFRAMEBUFFERSEXTPROC) (GLsizei n, GLuint *framebuffers); -typedef GLenum (APIENTRYP PFNGLCHECKFRAMEBUFFERSTATUSEXTPROC) (GLenum target); -typedef void (APIENTRYP PFNGLFRAMEBUFFERTEXTURE1DEXTPROC) (GLenum target, GLenum attachment, GLenum textarget, GLuint texture, GLint level); -typedef void (APIENTRYP PFNGLFRAMEBUFFERTEXTURE2DEXTPROC) (GLenum target, GLenum attachment, GLenum textarget, GLuint texture, GLint level); -typedef void (APIENTRYP PFNGLFRAMEBUFFERTEXTURE3DEXTPROC) (GLenum target, GLenum attachment, GLenum textarget, GLuint texture, GLint level, GLint zoffset); -typedef void (APIENTRYP PFNGLFRAMEBUFFERRENDERBUFFEREXTPROC) (GLenum target, GLenum attachment, GLenum renderbuffertarget, GLuint renderbuffer); -typedef void (APIENTRYP PFNGLGETFRAMEBUFFERATTACHMENTPARAMETERIVEXTPROC) (GLenum target, GLenum attachment, GLenum pname, GLint *params); -typedef void (APIENTRYP PFNGLGENERATEMIPMAPEXTPROC) (GLenum target); -#endif - -#ifndef GL_GREMEDY_string_marker -#define GL_GREMEDY_string_marker 1 -#ifdef GL_GLEXT_PROTOTYPES -GLAPI void APIENTRY glStringMarkerGREMEDY (GLsizei, const GLvoid *); -#endif /* GL_GLEXT_PROTOTYPES */ -typedef void (APIENTRYP PFNGLSTRINGMARKERGREMEDYPROC) (GLsizei len, const GLvoid *string); -#endif - - -#ifdef __cplusplus -} -#endif - -#endif -#endif /* NO_SDL_GLEXT */ -/*@}*/ diff --git a/dji_sdk_manifold_read_cam/include/sdl/SDL_platform.h b/dji_sdk_manifold_read_cam/include/sdl/SDL_platform.h deleted file mode 100644 index 48540a8..0000000 --- a/dji_sdk_manifold_read_cam/include/sdl/SDL_platform.h +++ /dev/null @@ -1,110 +0,0 @@ -/* - SDL - Simple DirectMedia Layer - Copyright (C) 1997-2012 Sam Lantinga - - This library is free software; you can redistribute it and/or - modify it under the terms of the GNU Lesser General Public - License as published by the Free Software Foundation; either - version 2.1 of the License, or (at your option) any later version. - - This library is distributed in the hope that it will be useful, - but WITHOUT ANY WARRANTY; without even the implied warranty of - MERCHANTABILITY or FITNESS FOR A PARTICULAR PURPOSE. See the GNU - Lesser General Public License for more details. - - You should have received a copy of the GNU Lesser General Public - License along with this library; if not, write to the Free Software - Foundation, Inc., 51 Franklin St, Fifth Floor, Boston, MA 02110-1301 USA - - Sam Lantinga - slouken@libsdl.org -*/ - -/** @file SDL_platform.h - * Try to get a standard set of platform defines - */ - -#ifndef _SDL_platform_h -#define _SDL_platform_h - -#if defined(_AIX) -#undef __AIX__ -#define __AIX__ 1 -#endif -#if defined(__BEOS__) -#undef __BEOS__ -#define __BEOS__ 1 -#endif -#if defined(__HAIKU__) -#undef __HAIKU__ -#define __HAIKU__ 1 -#endif -#if defined(bsdi) || defined(__bsdi) || defined(__bsdi__) -#undef __BSDI__ -#define __BSDI__ 1 -#endif -#if defined(_arch_dreamcast) -#undef __DREAMCAST__ -#define __DREAMCAST__ 1 -#endif -#if defined(__FreeBSD__) || defined(__FreeBSD_kernel__) || defined(__DragonFly__) -#undef __FREEBSD__ -#define __FREEBSD__ 1 -#endif -#if defined(__HAIKU__) -#undef __HAIKU__ -#define __HAIKU__ 1 -#endif -#if defined(hpux) || defined(__hpux) || defined(__hpux__) -#undef __HPUX__ -#define __HPUX__ 1 -#endif -#if defined(sgi) || defined(__sgi) || defined(__sgi__) || defined(_SGI_SOURCE) -#undef __IRIX__ -#define __IRIX__ 1 -#endif -#if defined(linux) || defined(__linux) || defined(__linux__) -#undef __LINUX__ -#define __LINUX__ 1 -#endif -#if defined(__APPLE__) -#undef __MACOSX__ -#define __MACOSX__ 1 -#elif defined(macintosh) -#undef __MACOS__ -#define __MACOS__ 1 -#endif -#if defined(__NetBSD__) -#undef __NETBSD__ -#define __NETBSD__ 1 -#endif -#if defined(__OpenBSD__) -#undef __OPENBSD__ -#define __OPENBSD__ 1 -#endif -#if defined(__OS2__) -#undef __OS2__ -#define __OS2__ 1 -#endif -#if defined(osf) || defined(__osf) || defined(__osf__) || defined(_OSF_SOURCE) -#undef __OSF__ -#define __OSF__ 1 -#endif -#if defined(__QNXNTO__) -#undef __QNXNTO__ -#define __QNXNTO__ 1 -#endif -#if defined(riscos) || defined(__riscos) || defined(__riscos__) -#undef __RISCOS__ -#define __RISCOS__ 1 -#endif -#if defined(__SVR4) -#undef __SOLARIS__ -#define __SOLARIS__ 1 -#endif -#if defined(WIN32) || defined(_WIN32) -#undef __WIN32__ -#define __WIN32__ 1 -#endif - -#endif /* _SDL_platform_h */ diff --git a/dji_sdk_manifold_read_cam/include/sdl/SDL_quit.h b/dji_sdk_manifold_read_cam/include/sdl/SDL_quit.h deleted file mode 100644 index abd2ec6..0000000 --- a/dji_sdk_manifold_read_cam/include/sdl/SDL_quit.h +++ /dev/null @@ -1,55 +0,0 @@ -/* - SDL - Simple DirectMedia Layer - Copyright (C) 1997-2012 Sam Lantinga - - This library is free software; you can redistribute it and/or - modify it under the terms of the GNU Lesser General Public - License as published by the Free Software Foundation; either - version 2.1 of the License, or (at your option) any later version. - - This library is distributed in the hope that it will be useful, - but WITHOUT ANY WARRANTY; without even the implied warranty of - MERCHANTABILITY or FITNESS FOR A PARTICULAR PURPOSE. See the GNU - Lesser General Public License for more details. - - You should have received a copy of the GNU Lesser General Public - License along with this library; if not, write to the Free Software - Foundation, Inc., 51 Franklin St, Fifth Floor, Boston, MA 02110-1301 USA - - Sam Lantinga - slouken@libsdl.org -*/ - -/** @file SDL_quit.h - * Include file for SDL quit event handling - */ - -#ifndef _SDL_quit_h -#define _SDL_quit_h - -#include "SDL_stdinc.h" -#include "SDL_error.h" - -/** @file SDL_quit.h - * An SDL_QUITEVENT is generated when the user tries to close the application - * window. If it is ignored or filtered out, the window will remain open. - * If it is not ignored or filtered, it is queued normally and the window - * is allowed to close. When the window is closed, screen updates will - * complete, but have no effect. - * - * SDL_Init() installs signal handlers for SIGINT (keyboard interrupt) - * and SIGTERM (system termination request), if handlers do not already - * exist, that generate SDL_QUITEVENT events as well. There is no way - * to determine the cause of an SDL_QUITEVENT, but setting a signal - * handler in your application will override the default generation of - * quit events for that signal. - */ - -/** @file SDL_quit.h - * There are no functions directly affecting the quit event - */ - -#define SDL_QuitRequested() \ - (SDL_PumpEvents(), SDL_PeepEvents(NULL,0,SDL_PEEKEVENT,SDL_QUITMASK)) - -#endif /* _SDL_quit_h */ diff --git a/dji_sdk_manifold_read_cam/include/sdl/SDL_rwops.h b/dji_sdk_manifold_read_cam/include/sdl/SDL_rwops.h deleted file mode 100644 index 98361d7..0000000 --- a/dji_sdk_manifold_read_cam/include/sdl/SDL_rwops.h +++ /dev/null @@ -1,155 +0,0 @@ -/* - SDL - Simple DirectMedia Layer - Copyright (C) 1997-2012 Sam Lantinga - - This library is free software; you can redistribute it and/or - modify it under the terms of the GNU Lesser General Public - License as published by the Free Software Foundation; either - version 2.1 of the License, or (at your option) any later version. - - This library is distributed in the hope that it will be useful, - but WITHOUT ANY WARRANTY; without even the implied warranty of - MERCHANTABILITY or FITNESS FOR A PARTICULAR PURPOSE. See the GNU - Lesser General Public License for more details. - - You should have received a copy of the GNU Lesser General Public - License along with this library; if not, write to the Free Software - Foundation, Inc., 51 Franklin St, Fifth Floor, Boston, MA 02110-1301 USA - - Sam Lantinga - slouken@libsdl.org -*/ - -/** @file SDL_rwops.h - * This file provides a general interface for SDL to read and write - * data sources. It can easily be extended to files, memory, etc. - */ - -#ifndef _SDL_rwops_h -#define _SDL_rwops_h - -#include "SDL_stdinc.h" -#include "SDL_error.h" - -#include "begin_code.h" -/* Set up for C function definitions, even when using C++ */ -#ifdef __cplusplus -extern "C" { -#endif - -/** This is the read/write operation structure -- very basic */ - -typedef struct SDL_RWops { - /** Seek to 'offset' relative to whence, one of stdio's whence values: - * SEEK_SET, SEEK_CUR, SEEK_END - * Returns the final offset in the data source. - */ - int (SDLCALL *seek)(struct SDL_RWops *context, int offset, int whence); - - /** Read up to 'maxnum' objects each of size 'size' from the data - * source to the area pointed at by 'ptr'. - * Returns the number of objects read, or -1 if the read failed. - */ - int (SDLCALL *read)(struct SDL_RWops *context, void *ptr, int size, int maxnum); - - /** Write exactly 'num' objects each of size 'objsize' from the area - * pointed at by 'ptr' to data source. - * Returns 'num', or -1 if the write failed. - */ - int (SDLCALL *write)(struct SDL_RWops *context, const void *ptr, int size, int num); - - /** Close and free an allocated SDL_FSops structure */ - int (SDLCALL *close)(struct SDL_RWops *context); - - Uint32 type; - union { -#if defined(__WIN32__) && !defined(__SYMBIAN32__) - struct { - int append; - void *h; - struct { - void *data; - int size; - int left; - } buffer; - } win32io; -#endif -#ifdef HAVE_STDIO_H - struct { - int autoclose; - FILE *fp; - } stdio; -#endif - struct { - Uint8 *base; - Uint8 *here; - Uint8 *stop; - } mem; - struct { - void *data1; - } unknown; - } hidden; - -} SDL_RWops; - - -/** @name Functions to create SDL_RWops structures from various data sources */ -/*@{*/ - -extern DECLSPEC SDL_RWops * SDLCALL SDL_RWFromFile(const char *file, const char *mode); - -#ifdef HAVE_STDIO_H -extern DECLSPEC SDL_RWops * SDLCALL SDL_RWFromFP(FILE *fp, int autoclose); -#endif - -extern DECLSPEC SDL_RWops * SDLCALL SDL_RWFromMem(void *mem, int size); -extern DECLSPEC SDL_RWops * SDLCALL SDL_RWFromConstMem(const void *mem, int size); - -extern DECLSPEC SDL_RWops * SDLCALL SDL_AllocRW(void); -extern DECLSPEC void SDLCALL SDL_FreeRW(SDL_RWops *area); - -/*@}*/ - -/** @name Seek Reference Points */ -/*@{*/ -#define RW_SEEK_SET 0 /**< Seek from the beginning of data */ -#define RW_SEEK_CUR 1 /**< Seek relative to current read point */ -#define RW_SEEK_END 2 /**< Seek relative to the end of data */ -/*@}*/ - -/** @name Macros to easily read and write from an SDL_RWops structure */ -/*@{*/ -#define SDL_RWseek(ctx, offset, whence) (ctx)->seek(ctx, offset, whence) -#define SDL_RWtell(ctx) (ctx)->seek(ctx, 0, RW_SEEK_CUR) -#define SDL_RWread(ctx, ptr, size, n) (ctx)->read(ctx, ptr, size, n) -#define SDL_RWwrite(ctx, ptr, size, n) (ctx)->write(ctx, ptr, size, n) -#define SDL_RWclose(ctx) (ctx)->close(ctx) -/*@}*/ - -/** @name Read an item of the specified endianness and return in native format */ -/*@{*/ -extern DECLSPEC Uint16 SDLCALL SDL_ReadLE16(SDL_RWops *src); -extern DECLSPEC Uint16 SDLCALL SDL_ReadBE16(SDL_RWops *src); -extern DECLSPEC Uint32 SDLCALL SDL_ReadLE32(SDL_RWops *src); -extern DECLSPEC Uint32 SDLCALL SDL_ReadBE32(SDL_RWops *src); -extern DECLSPEC Uint64 SDLCALL SDL_ReadLE64(SDL_RWops *src); -extern DECLSPEC Uint64 SDLCALL SDL_ReadBE64(SDL_RWops *src); -/*@}*/ - -/** @name Write an item of native format to the specified endianness */ -/*@{*/ -extern DECLSPEC int SDLCALL SDL_WriteLE16(SDL_RWops *dst, Uint16 value); -extern DECLSPEC int SDLCALL SDL_WriteBE16(SDL_RWops *dst, Uint16 value); -extern DECLSPEC int SDLCALL SDL_WriteLE32(SDL_RWops *dst, Uint32 value); -extern DECLSPEC int SDLCALL SDL_WriteBE32(SDL_RWops *dst, Uint32 value); -extern DECLSPEC int SDLCALL SDL_WriteLE64(SDL_RWops *dst, Uint64 value); -extern DECLSPEC int SDLCALL SDL_WriteBE64(SDL_RWops *dst, Uint64 value); -/*@}*/ - -/* Ends C function definitions when using C++ */ -#ifdef __cplusplus -} -#endif -#include "close_code.h" - -#endif /* _SDL_rwops_h */ diff --git a/dji_sdk_manifold_read_cam/include/sdl/SDL_stdinc.h b/dji_sdk_manifold_read_cam/include/sdl/SDL_stdinc.h deleted file mode 100644 index 35a4fdd..0000000 --- a/dji_sdk_manifold_read_cam/include/sdl/SDL_stdinc.h +++ /dev/null @@ -1,620 +0,0 @@ -/* - SDL - Simple DirectMedia Layer - Copyright (C) 1997-2012 Sam Lantinga - - This library is free software; you can redistribute it and/or - modify it under the terms of the GNU Lesser General Public - License as published by the Free Software Foundation; either - version 2.1 of the License, or (at your option) any later version. - - This library is distributed in the hope that it will be useful, - but WITHOUT ANY WARRANTY; without even the implied warranty of - MERCHANTABILITY or FITNESS FOR A PARTICULAR PURPOSE. See the GNU - Lesser General Public License for more details. - - You should have received a copy of the GNU Lesser General Public - License along with this library; if not, write to the Free Software - Foundation, Inc., 51 Franklin St, Fifth Floor, Boston, MA 02110-1301 USA - - Sam Lantinga - slouken@libsdl.org -*/ - -/** @file SDL_stdinc.h - * This is a general header that includes C language support - */ - -#ifndef _SDL_stdinc_h -#define _SDL_stdinc_h - -#include "SDL_config.h" - - -#ifdef HAVE_SYS_TYPES_H -#include -#endif -#ifdef HAVE_STDIO_H -#include -#endif -#if defined(STDC_HEADERS) -# include -# include -# include -#else -# if defined(HAVE_STDLIB_H) -# include -# elif defined(HAVE_MALLOC_H) -# include -# endif -# if defined(HAVE_STDDEF_H) -# include -# endif -# if defined(HAVE_STDARG_H) -# include -# endif -#endif -#ifdef HAVE_STRING_H -# if !defined(STDC_HEADERS) && defined(HAVE_MEMORY_H) -# include -# endif -# include -#endif -#ifdef HAVE_STRINGS_H -# include -#endif -#if defined(HAVE_INTTYPES_H) -# include -#elif defined(HAVE_STDINT_H) -# include -#endif -#ifdef HAVE_CTYPE_H -# include -#endif -#if defined(HAVE_ICONV) && defined(HAVE_ICONV_H) -# include -#endif - -/** The number of elements in an array */ -#define SDL_arraysize(array) (sizeof(array)/sizeof(array[0])) -#define SDL_TABLESIZE(table) SDL_arraysize(table) - -/* Use proper C++ casts when compiled as C++ to be compatible with the option - -Wold-style-cast of GCC (and -Werror=old-style-cast in GCC 4.2 and above. */ -#ifdef __cplusplus -#define SDL_reinterpret_cast(type, expression) reinterpret_cast(expression) -#define SDL_static_cast(type, expression) static_cast(expression) -#else -#define SDL_reinterpret_cast(type, expression) ((type)(expression)) -#define SDL_static_cast(type, expression) ((type)(expression)) -#endif - -/** @name Basic data types */ -/*@{*/ -typedef enum { - SDL_FALSE = 0, - SDL_TRUE = 1 -} SDL_bool; - -typedef int8_t Sint8; -typedef uint8_t Uint8; -typedef int16_t Sint16; -typedef uint16_t Uint16; -typedef int32_t Sint32; -typedef uint32_t Uint32; - -#ifdef SDL_HAS_64BIT_TYPE -typedef int64_t Sint64; -#ifndef SYMBIAN32_GCCE -typedef uint64_t Uint64; -#endif -#else -/* This is really just a hack to prevent the compiler from complaining */ -typedef struct { - Uint32 hi; - Uint32 lo; -} Uint64, Sint64; -#endif - -/*@}*/ - -/** @name Make sure the types really have the right sizes */ -/*@{*/ -#define SDL_COMPILE_TIME_ASSERT(name, x) \ - typedef int SDL_dummy_ ## name[(x) * 2 - 1] - -SDL_COMPILE_TIME_ASSERT(uint8, sizeof(Uint8) == 1); -SDL_COMPILE_TIME_ASSERT(sint8, sizeof(Sint8) == 1); -SDL_COMPILE_TIME_ASSERT(uint16, sizeof(Uint16) == 2); -SDL_COMPILE_TIME_ASSERT(sint16, sizeof(Sint16) == 2); -SDL_COMPILE_TIME_ASSERT(uint32, sizeof(Uint32) == 4); -SDL_COMPILE_TIME_ASSERT(sint32, sizeof(Sint32) == 4); -SDL_COMPILE_TIME_ASSERT(uint64, sizeof(Uint64) == 8); -SDL_COMPILE_TIME_ASSERT(sint64, sizeof(Sint64) == 8); -/*@}*/ - -/** @name Enum Size Check - * Check to make sure enums are the size of ints, for structure packing. - * For both Watcom C/C++ and Borland C/C++ the compiler option that makes - * enums having the size of an int must be enabled. - * This is "-b" for Borland C/C++ and "-ei" for Watcom C/C++ (v11). - */ -/* Enable enums always int in CodeWarrior (for MPW use "-enum int") */ -#ifdef __MWERKS__ -#pragma enumsalwaysint on -#endif - -typedef enum { - DUMMY_ENUM_VALUE -} SDL_DUMMY_ENUM; - -#ifndef __NDS__ -SDL_COMPILE_TIME_ASSERT(enum, sizeof(SDL_DUMMY_ENUM) == sizeof(int)); -#endif -/*@}*/ - -#include "begin_code.h" -/* Set up for C function definitions, even when using C++ */ -#ifdef __cplusplus -extern "C" { -#endif - -#ifdef HAVE_MALLOC -#define SDL_malloc malloc -#else -extern DECLSPEC void * SDLCALL SDL_malloc(size_t size); -#endif - -#ifdef HAVE_CALLOC -#define SDL_calloc calloc -#else -extern DECLSPEC void * SDLCALL SDL_calloc(size_t nmemb, size_t size); -#endif - -#ifdef HAVE_REALLOC -#define SDL_realloc realloc -#else -extern DECLSPEC void * SDLCALL SDL_realloc(void *mem, size_t size); -#endif - -#ifdef HAVE_FREE -#define SDL_free free -#else -extern DECLSPEC void SDLCALL SDL_free(void *mem); -#endif - -#if defined(HAVE_ALLOCA) && !defined(alloca) -# if defined(HAVE_ALLOCA_H) -# include -# elif defined(__GNUC__) -# define alloca __builtin_alloca -# elif defined(_MSC_VER) -# include -# define alloca _alloca -# elif defined(__WATCOMC__) -# include -# elif defined(__BORLANDC__) -# include -# elif defined(__DMC__) -# include -# elif defined(__AIX__) - #pragma alloca -# elif defined(__MRC__) - void *alloca (unsigned); -# else - char *alloca (); -# endif -#endif -#ifdef HAVE_ALLOCA -#define SDL_stack_alloc(type, count) (type*)alloca(sizeof(type)*(count)) -#define SDL_stack_free(data) -#else -#define SDL_stack_alloc(type, count) (type*)SDL_malloc(sizeof(type)*(count)) -#define SDL_stack_free(data) SDL_free(data) -#endif - -#ifdef HAVE_GETENV -#define SDL_getenv getenv -#else -extern DECLSPEC char * SDLCALL SDL_getenv(const char *name); -#endif - -#ifdef HAVE_PUTENV -#define SDL_putenv putenv -#else -extern DECLSPEC int SDLCALL SDL_putenv(const char *variable); -#endif - -#ifdef HAVE_QSORT -#define SDL_qsort qsort -#else -extern DECLSPEC void SDLCALL SDL_qsort(void *base, size_t nmemb, size_t size, - int (*compare)(const void *, const void *)); -#endif - -#ifdef HAVE_ABS -#define SDL_abs abs -#else -#define SDL_abs(X) ((X) < 0 ? -(X) : (X)) -#endif - -#define SDL_min(x, y) (((x) < (y)) ? (x) : (y)) -#define SDL_max(x, y) (((x) > (y)) ? (x) : (y)) - -#ifdef HAVE_CTYPE_H -#define SDL_isdigit(X) isdigit(X) -#define SDL_isspace(X) isspace(X) -#define SDL_toupper(X) toupper(X) -#define SDL_tolower(X) tolower(X) -#else -#define SDL_isdigit(X) (((X) >= '0') && ((X) <= '9')) -#define SDL_isspace(X) (((X) == ' ') || ((X) == '\t') || ((X) == '\r') || ((X) == '\n')) -#define SDL_toupper(X) (((X) >= 'a') && ((X) <= 'z') ? ('A'+((X)-'a')) : (X)) -#define SDL_tolower(X) (((X) >= 'A') && ((X) <= 'Z') ? ('a'+((X)-'A')) : (X)) -#endif - -#ifdef HAVE_MEMSET -#define SDL_memset memset -#else -extern DECLSPEC void * SDLCALL SDL_memset(void *dst, int c, size_t len); -#endif - -#if defined(__GNUC__) && defined(i386) -#define SDL_memset4(dst, val, len) \ -do { \ - int u0, u1, u2; \ - __asm__ __volatile__ ( \ - "cld\n\t" \ - "rep ; stosl\n\t" \ - : "=&D" (u0), "=&a" (u1), "=&c" (u2) \ - : "0" (dst), "1" (val), "2" (SDL_static_cast(Uint32, len)) \ - : "memory" ); \ -} while(0) -#endif -#ifndef SDL_memset4 -#define SDL_memset4(dst, val, len) \ -do { \ - unsigned _count = (len); \ - unsigned _n = (_count + 3) / 4; \ - Uint32 *_p = SDL_static_cast(Uint32 *, dst); \ - Uint32 _val = (val); \ - if (len == 0) break; \ - switch (_count % 4) { \ - case 0: do { *_p++ = _val; \ - case 3: *_p++ = _val; \ - case 2: *_p++ = _val; \ - case 1: *_p++ = _val; \ - } while ( --_n ); \ - } \ -} while(0) -#endif - -/* We can count on memcpy existing on Mac OS X and being well-tuned. */ -#if defined(__MACH__) && defined(__APPLE__) -#define SDL_memcpy(dst, src, len) memcpy(dst, src, len) -#elif defined(__GNUC__) && defined(i386) -#define SDL_memcpy(dst, src, len) \ -do { \ - int u0, u1, u2; \ - __asm__ __volatile__ ( \ - "cld\n\t" \ - "rep ; movsl\n\t" \ - "testb $2,%b4\n\t" \ - "je 1f\n\t" \ - "movsw\n" \ - "1:\ttestb $1,%b4\n\t" \ - "je 2f\n\t" \ - "movsb\n" \ - "2:" \ - : "=&c" (u0), "=&D" (u1), "=&S" (u2) \ - : "0" (SDL_static_cast(unsigned, len)/4), "q" (len), "1" (dst),"2" (src) \ - : "memory" ); \ -} while(0) -#endif -#ifndef SDL_memcpy -#ifdef HAVE_MEMCPY -#define SDL_memcpy memcpy -#elif defined(HAVE_BCOPY) -#define SDL_memcpy(d, s, n) bcopy((s), (d), (n)) -#else -extern DECLSPEC void * SDLCALL SDL_memcpy(void *dst, const void *src, size_t len); -#endif -#endif - -/* We can count on memcpy existing on Mac OS X and being well-tuned. */ -#if defined(__MACH__) && defined(__APPLE__) -#define SDL_memcpy4(dst, src, len) memcpy(dst, src, (len)*4) -#elif defined(__GNUC__) && defined(i386) -#define SDL_memcpy4(dst, src, len) \ -do { \ - int ecx, edi, esi; \ - __asm__ __volatile__ ( \ - "cld\n\t" \ - "rep ; movsl" \ - : "=&c" (ecx), "=&D" (edi), "=&S" (esi) \ - : "0" (SDL_static_cast(unsigned, len)), "1" (dst), "2" (src) \ - : "memory" ); \ -} while(0) -#endif -#ifndef SDL_memcpy4 -#define SDL_memcpy4(dst, src, len) SDL_memcpy(dst, src, (len) << 2) -#endif - -#if defined(__GNUC__) && defined(i386) -#define SDL_revcpy(dst, src, len) \ -do { \ - int u0, u1, u2; \ - char *dstp = SDL_static_cast(char *, dst); \ - char *srcp = SDL_static_cast(char *, src); \ - int n = (len); \ - if ( n >= 4 ) { \ - __asm__ __volatile__ ( \ - "std\n\t" \ - "rep ; movsl\n\t" \ - "cld\n\t" \ - : "=&c" (u0), "=&D" (u1), "=&S" (u2) \ - : "0" (n >> 2), \ - "1" (dstp+(n-4)), "2" (srcp+(n-4)) \ - : "memory" ); \ - } \ - switch (n & 3) { \ - case 3: dstp[2] = srcp[2]; \ - case 2: dstp[1] = srcp[1]; \ - case 1: dstp[0] = srcp[0]; \ - break; \ - default: \ - break; \ - } \ -} while(0) -#endif -#ifndef SDL_revcpy -extern DECLSPEC void * SDLCALL SDL_revcpy(void *dst, const void *src, size_t len); -#endif - -#ifdef HAVE_MEMMOVE -#define SDL_memmove memmove -#elif defined(HAVE_BCOPY) -#define SDL_memmove(d, s, n) bcopy((s), (d), (n)) -#else -#define SDL_memmove(dst, src, len) \ -do { \ - if ( dst < src ) { \ - SDL_memcpy(dst, src, len); \ - } else { \ - SDL_revcpy(dst, src, len); \ - } \ -} while(0) -#endif - -#ifdef HAVE_MEMCMP -#define SDL_memcmp memcmp -#else -extern DECLSPEC int SDLCALL SDL_memcmp(const void *s1, const void *s2, size_t len); -#endif - -#ifdef HAVE_STRLEN -#define SDL_strlen strlen -#else -extern DECLSPEC size_t SDLCALL SDL_strlen(const char *string); -#endif - -#ifdef HAVE_STRLCPY -#define SDL_strlcpy strlcpy -#else -extern DECLSPEC size_t SDLCALL SDL_strlcpy(char *dst, const char *src, size_t maxlen); -#endif - -#ifdef HAVE_STRLCAT -#define SDL_strlcat strlcat -#else -extern DECLSPEC size_t SDLCALL SDL_strlcat(char *dst, const char *src, size_t maxlen); -#endif - -#ifdef HAVE_STRDUP -#define SDL_strdup strdup -#else -extern DECLSPEC char * SDLCALL SDL_strdup(const char *string); -#endif - -#ifdef HAVE__STRREV -#define SDL_strrev _strrev -#else -extern DECLSPEC char * SDLCALL SDL_strrev(char *string); -#endif - -#ifdef HAVE__STRUPR -#define SDL_strupr _strupr -#else -extern DECLSPEC char * SDLCALL SDL_strupr(char *string); -#endif - -#ifdef HAVE__STRLWR -#define SDL_strlwr _strlwr -#else -extern DECLSPEC char * SDLCALL SDL_strlwr(char *string); -#endif - -#ifdef HAVE_STRCHR -#define SDL_strchr strchr -#elif defined(HAVE_INDEX) -#define SDL_strchr index -#else -extern DECLSPEC char * SDLCALL SDL_strchr(const char *string, int c); -#endif - -#ifdef HAVE_STRRCHR -#define SDL_strrchr strrchr -#elif defined(HAVE_RINDEX) -#define SDL_strrchr rindex -#else -extern DECLSPEC char * SDLCALL SDL_strrchr(const char *string, int c); -#endif - -#ifdef HAVE_STRSTR -#define SDL_strstr strstr -#else -extern DECLSPEC char * SDLCALL SDL_strstr(const char *haystack, const char *needle); -#endif - -#ifdef HAVE_ITOA -#define SDL_itoa itoa -#else -#define SDL_itoa(value, string, radix) SDL_ltoa((long)value, string, radix) -#endif - -#ifdef HAVE__LTOA -#define SDL_ltoa _ltoa -#else -extern DECLSPEC char * SDLCALL SDL_ltoa(long value, char *string, int radix); -#endif - -#ifdef HAVE__UITOA -#define SDL_uitoa _uitoa -#else -#define SDL_uitoa(value, string, radix) SDL_ultoa((long)value, string, radix) -#endif - -#ifdef HAVE__ULTOA -#define SDL_ultoa _ultoa -#else -extern DECLSPEC char * SDLCALL SDL_ultoa(unsigned long value, char *string, int radix); -#endif - -#ifdef HAVE_STRTOL -#define SDL_strtol strtol -#else -extern DECLSPEC long SDLCALL SDL_strtol(const char *string, char **endp, int base); -#endif - -#ifdef HAVE_STRTOUL -#define SDL_strtoul strtoul -#else -extern DECLSPEC unsigned long SDLCALL SDL_strtoul(const char *string, char **endp, int base); -#endif - -#ifdef SDL_HAS_64BIT_TYPE - -#ifdef HAVE__I64TOA -#define SDL_lltoa _i64toa -#else -extern DECLSPEC char* SDLCALL SDL_lltoa(Sint64 value, char *string, int radix); -#endif - -#ifdef HAVE__UI64TOA -#define SDL_ulltoa _ui64toa -#else -extern DECLSPEC char* SDLCALL SDL_ulltoa(Uint64 value, char *string, int radix); -#endif - -#ifdef HAVE_STRTOLL -#define SDL_strtoll strtoll -#else -extern DECLSPEC Sint64 SDLCALL SDL_strtoll(const char *string, char **endp, int base); -#endif - -#ifdef HAVE_STRTOULL -#define SDL_strtoull strtoull -#else -extern DECLSPEC Uint64 SDLCALL SDL_strtoull(const char *string, char **endp, int base); -#endif - -#endif /* SDL_HAS_64BIT_TYPE */ - -#ifdef HAVE_STRTOD -#define SDL_strtod strtod -#else -extern DECLSPEC double SDLCALL SDL_strtod(const char *string, char **endp); -#endif - -#ifdef HAVE_ATOI -#define SDL_atoi atoi -#else -#define SDL_atoi(X) SDL_strtol(X, NULL, 0) -#endif - -#ifdef HAVE_ATOF -#define SDL_atof atof -#else -#define SDL_atof(X) SDL_strtod(X, NULL) -#endif - -#ifdef HAVE_STRCMP -#define SDL_strcmp strcmp -#else -extern DECLSPEC int SDLCALL SDL_strcmp(const char *str1, const char *str2); -#endif - -#ifdef HAVE_STRNCMP -#define SDL_strncmp strncmp -#else -extern DECLSPEC int SDLCALL SDL_strncmp(const char *str1, const char *str2, size_t maxlen); -#endif - -#ifdef HAVE_STRCASECMP -#define SDL_strcasecmp strcasecmp -#elif defined(HAVE__STRICMP) -#define SDL_strcasecmp _stricmp -#else -extern DECLSPEC int SDLCALL SDL_strcasecmp(const char *str1, const char *str2); -#endif - -#ifdef HAVE_STRNCASECMP -#define SDL_strncasecmp strncasecmp -#elif defined(HAVE__STRNICMP) -#define SDL_strncasecmp _strnicmp -#else -extern DECLSPEC int SDLCALL SDL_strncasecmp(const char *str1, const char *str2, size_t maxlen); -#endif - -#ifdef HAVE_SSCANF -#define SDL_sscanf sscanf -#else -extern DECLSPEC int SDLCALL SDL_sscanf(const char *text, const char *fmt, ...); -#endif - -#ifdef HAVE_SNPRINTF -#define SDL_snprintf snprintf -#else -extern DECLSPEC int SDLCALL SDL_snprintf(char *text, size_t maxlen, const char *fmt, ...); -#endif - -#ifdef HAVE_VSNPRINTF -#define SDL_vsnprintf vsnprintf -#else -extern DECLSPEC int SDLCALL SDL_vsnprintf(char *text, size_t maxlen, const char *fmt, va_list ap); -#endif - -/** @name SDL_ICONV Error Codes - * The SDL implementation of iconv() returns these error codes - */ -/*@{*/ -#define SDL_ICONV_ERROR (size_t)-1 -#define SDL_ICONV_E2BIG (size_t)-2 -#define SDL_ICONV_EILSEQ (size_t)-3 -#define SDL_ICONV_EINVAL (size_t)-4 -/*@}*/ - -#if defined(HAVE_ICONV) && defined(HAVE_ICONV_H) -#define SDL_iconv_t iconv_t -#define SDL_iconv_open iconv_open -#define SDL_iconv_close iconv_close -#else -typedef struct _SDL_iconv_t *SDL_iconv_t; -extern DECLSPEC SDL_iconv_t SDLCALL SDL_iconv_open(const char *tocode, const char *fromcode); -extern DECLSPEC int SDLCALL SDL_iconv_close(SDL_iconv_t cd); -#endif -extern DECLSPEC size_t SDLCALL SDL_iconv(SDL_iconv_t cd, const char **inbuf, size_t *inbytesleft, char **outbuf, size_t *outbytesleft); -/** This function converts a string between encodings in one pass, returning a - * string that must be freed with SDL_free() or NULL on error. - */ -extern DECLSPEC char * SDLCALL SDL_iconv_string(const char *tocode, const char *fromcode, const char *inbuf, size_t inbytesleft); -#define SDL_iconv_utf8_locale(S) SDL_iconv_string("", "UTF-8", S, SDL_strlen(S)+1) -#define SDL_iconv_utf8_ucs2(S) (Uint16 *)SDL_iconv_string("UCS-2", "UTF-8", S, SDL_strlen(S)+1) -#define SDL_iconv_utf8_ucs4(S) (Uint32 *)SDL_iconv_string("UCS-4", "UTF-8", S, SDL_strlen(S)+1) - -/* Ends C function definitions when using C++ */ -#ifdef __cplusplus -} -#endif -#include "close_code.h" - -#endif /* _SDL_stdinc_h */ diff --git a/dji_sdk_manifold_read_cam/include/sdl/SDL_syswm.h b/dji_sdk_manifold_read_cam/include/sdl/SDL_syswm.h deleted file mode 100644 index 78433c6..0000000 --- a/dji_sdk_manifold_read_cam/include/sdl/SDL_syswm.h +++ /dev/null @@ -1,226 +0,0 @@ -/* - SDL - Simple DirectMedia Layer - Copyright (C) 1997-2012 Sam Lantinga - - This library is free software; you can redistribute it and/or - modify it under the terms of the GNU Lesser General Public - License as published by the Free Software Foundation; either - version 2.1 of the License, or (at your option) any later version. - - This library is distributed in the hope that it will be useful, - but WITHOUT ANY WARRANTY; without even the implied warranty of - MERCHANTABILITY or FITNESS FOR A PARTICULAR PURPOSE. See the GNU - Lesser General Public License for more details. - - You should have received a copy of the GNU Lesser General Public - License along with this library; if not, write to the Free Software - Foundation, Inc., 51 Franklin St, Fifth Floor, Boston, MA 02110-1301 USA - - Sam Lantinga - slouken@libsdl.org -*/ - -/** @file SDL_syswm.h - * Include file for SDL custom system window manager hooks - */ - -#ifndef _SDL_syswm_h -#define _SDL_syswm_h - -#include "SDL_stdinc.h" -#include "SDL_error.h" -#include "SDL_version.h" - -#include "begin_code.h" -/* Set up for C function definitions, even when using C++ */ -#ifdef __cplusplus -extern "C" { -#endif - -/** @file SDL_syswm.h - * Your application has access to a special type of event 'SDL_SYSWMEVENT', - * which contains window-manager specific information and arrives whenever - * an unhandled window event occurs. This event is ignored by default, but - * you can enable it with SDL_EventState() - */ -#ifdef SDL_PROTOTYPES_ONLY -struct SDL_SysWMinfo; -typedef struct SDL_SysWMinfo SDL_SysWMinfo; -#else - -/* This is the structure for custom window manager events */ -#if defined(SDL_VIDEO_DRIVER_X11) -#if defined(__APPLE__) && defined(__MACH__) -/* conflicts with Quickdraw.h */ -#define Cursor X11Cursor -#endif - -#include -#include - -#if defined(__APPLE__) && defined(__MACH__) -/* matches the re-define above */ -#undef Cursor -#endif - -/** These are the various supported subsystems under UNIX */ -typedef enum { - SDL_SYSWM_X11 -} SDL_SYSWM_TYPE; - -/** The UNIX custom event structure */ -struct SDL_SysWMmsg { - SDL_version version; - SDL_SYSWM_TYPE subsystem; - union { - XEvent xevent; - } event; -}; - -/** The UNIX custom window manager information structure. - * When this structure is returned, it holds information about which - * low level system it is using, and will be one of SDL_SYSWM_TYPE. - */ -typedef struct SDL_SysWMinfo { - SDL_version version; - SDL_SYSWM_TYPE subsystem; - union { - struct { - Display *display; /**< The X11 display */ - Window window; /**< The X11 display window */ - /** These locking functions should be called around - * any X11 functions using the display variable, - * but not the gfxdisplay variable. - * They lock the event thread, so should not be - * called around event functions or from event filters. - */ - /*@{*/ - void (*lock_func)(void); - void (*unlock_func)(void); - /*@}*/ - - /** @name Introduced in SDL 1.0.2 */ - /*@{*/ - Window fswindow; /**< The X11 fullscreen window */ - Window wmwindow; /**< The X11 managed input window */ - /*@}*/ - - /** @name Introduced in SDL 1.2.12 */ - /*@{*/ - Display *gfxdisplay; /**< The X11 display to which rendering is done */ - /*@}*/ - } x11; - } info; -} SDL_SysWMinfo; - -#elif defined(SDL_VIDEO_DRIVER_NANOX) -#include - -/** The generic custom event structure */ -struct SDL_SysWMmsg { - SDL_version version; - int data; -}; - -/** The windows custom window manager information structure */ -typedef struct SDL_SysWMinfo { - SDL_version version ; - GR_WINDOW_ID window ; /* The display window */ -} SDL_SysWMinfo; - -#elif defined(SDL_VIDEO_DRIVER_WINDIB) || defined(SDL_VIDEO_DRIVER_DDRAW) || defined(SDL_VIDEO_DRIVER_GAPI) -#define WIN32_LEAN_AND_MEAN -#include - -/** The windows custom event structure */ -struct SDL_SysWMmsg { - SDL_version version; - HWND hwnd; /**< The window for the message */ - UINT msg; /**< The type of message */ - WPARAM wParam; /**< WORD message parameter */ - LPARAM lParam; /**< LONG message parameter */ -}; - -/** The windows custom window manager information structure */ -typedef struct SDL_SysWMinfo { - SDL_version version; - HWND window; /**< The Win32 display window */ - HGLRC hglrc; /**< The OpenGL context, if any */ -} SDL_SysWMinfo; - -#elif defined(SDL_VIDEO_DRIVER_RISCOS) - -/** RISC OS custom event structure */ -struct SDL_SysWMmsg { - SDL_version version; - int eventCode; /**< The window for the message */ - int pollBlock[64]; -}; - -/** The RISC OS custom window manager information structure */ -typedef struct SDL_SysWMinfo { - SDL_version version; - int wimpVersion; /**< Wimp version running under */ - int taskHandle; /**< The RISC OS task handle */ - int window; /**< The RISC OS display window */ -} SDL_SysWMinfo; - -#elif defined(SDL_VIDEO_DRIVER_PHOTON) -#include -#include - -/** The QNX custom event structure */ -struct SDL_SysWMmsg { - SDL_version version; - int data; -}; - -/** The QNX custom window manager information structure */ -typedef struct SDL_SysWMinfo { - SDL_version version; - int data; -} SDL_SysWMinfo; - -#else - -/** The generic custom event structure */ -struct SDL_SysWMmsg { - SDL_version version; - int data; -}; - -/** The generic custom window manager information structure */ -typedef struct SDL_SysWMinfo { - SDL_version version; - int data; -} SDL_SysWMinfo; - -#endif /* video driver type */ - -#endif /* SDL_PROTOTYPES_ONLY */ - -/* Function prototypes */ -/** - * This function gives you custom hooks into the window manager information. - * It fills the structure pointed to by 'info' with custom information and - * returns 0 if the function is not implemented, 1 if the function is - * implemented and no error occurred, and -1 if the version member of - * the 'info' structure is not filled in or not supported. - * - * You typically use this function like this: - * @code - * SDL_SysWMinfo info; - * SDL_VERSION(&info.version); - * if ( SDL_GetWMInfo(&info) ) { ... } - * @endcode - */ -extern DECLSPEC int SDLCALL SDL_GetWMInfo(SDL_SysWMinfo *info); - - -/* Ends C function definitions when using C++ */ -#ifdef __cplusplus -} -#endif -#include "close_code.h" - -#endif /* _SDL_syswm_h */ diff --git a/dji_sdk_manifold_read_cam/include/sdl/SDL_thread.h b/dji_sdk_manifold_read_cam/include/sdl/SDL_thread.h deleted file mode 100644 index 9ebe00e..0000000 --- a/dji_sdk_manifold_read_cam/include/sdl/SDL_thread.h +++ /dev/null @@ -1,115 +0,0 @@ -/* - SDL - Simple DirectMedia Layer - Copyright (C) 1997-2012 Sam Lantinga - - This library is free software; you can redistribute it and/or - modify it under the terms of the GNU Lesser General Public - License as published by the Free Software Foundation; either - version 2.1 of the License, or (at your option) any later version. - - This library is distributed in the hope that it will be useful, - but WITHOUT ANY WARRANTY; without even the implied warranty of - MERCHANTABILITY or FITNESS FOR A PARTICULAR PURPOSE. See the GNU - Lesser General Public License for more details. - - You should have received a copy of the GNU Lesser General Public - License along with this library; if not, write to the Free Software - Foundation, Inc., 51 Franklin St, Fifth Floor, Boston, MA 02110-1301 USA - - Sam Lantinga - slouken@libsdl.org -*/ - -#ifndef _SDL_thread_h -#define _SDL_thread_h - -/** @file SDL_thread.h - * Header for the SDL thread management routines - * - * @note These are independent of the other SDL routines. - */ - -#include "SDL_stdinc.h" -#include "SDL_error.h" - -/* Thread synchronization primitives */ -#include "SDL_mutex.h" - -#include "begin_code.h" -/* Set up for C function definitions, even when using C++ */ -#ifdef __cplusplus -extern "C" { -#endif - -/** The SDL thread structure, defined in SDL_thread.c */ -struct SDL_Thread; -typedef struct SDL_Thread SDL_Thread; - -/** Create a thread */ -#if ((defined(__WIN32__) && !defined(HAVE_LIBC)) || defined(__OS2__)) && !defined(__SYMBIAN32__) -/** - * We compile SDL into a DLL on OS/2. This means, that it's the DLL which - * creates a new thread for the calling process with the SDL_CreateThread() - * API. There is a problem with this, that only the RTL of the SDL.DLL will - * be initialized for those threads, and not the RTL of the calling application! - * To solve this, we make a little hack here. - * We'll always use the caller's _beginthread() and _endthread() APIs to - * start a new thread. This way, if it's the SDL.DLL which uses this API, - * then the RTL of SDL.DLL will be used to create the new thread, and if it's - * the application, then the RTL of the application will be used. - * So, in short: - * Always use the _beginthread() and _endthread() of the calling runtime library! - */ -#define SDL_PASSED_BEGINTHREAD_ENDTHREAD -#ifndef _WIN32_WCE -#include /* This has _beginthread() and _endthread() defined! */ -#endif - -#ifdef __OS2__ -typedef int (*pfnSDL_CurrentBeginThread)(void (*func)(void *), void *, unsigned, void *arg); -typedef void (*pfnSDL_CurrentEndThread)(void); -#else -typedef uintptr_t (__cdecl *pfnSDL_CurrentBeginThread) (void *, unsigned, - unsigned (__stdcall *func)(void *), void *arg, - unsigned, unsigned *threadID); -typedef void (__cdecl *pfnSDL_CurrentEndThread)(unsigned code); -#endif - -extern DECLSPEC SDL_Thread * SDLCALL SDL_CreateThread(int (SDLCALL *fn)(void *), void *data, pfnSDL_CurrentBeginThread pfnBeginThread, pfnSDL_CurrentEndThread pfnEndThread); - -#ifdef __OS2__ -#define SDL_CreateThread(fn, data) SDL_CreateThread(fn, data, _beginthread, _endthread) -#elif defined(_WIN32_WCE) -#define SDL_CreateThread(fn, data) SDL_CreateThread(fn, data, NULL, NULL) -#else -#define SDL_CreateThread(fn, data) SDL_CreateThread(fn, data, _beginthreadex, _endthreadex) -#endif -#else -extern DECLSPEC SDL_Thread * SDLCALL SDL_CreateThread(int (SDLCALL *fn)(void *), void *data); -#endif - -/** Get the 32-bit thread identifier for the current thread */ -extern DECLSPEC Uint32 SDLCALL SDL_ThreadID(void); - -/** Get the 32-bit thread identifier for the specified thread, - * equivalent to SDL_ThreadID() if the specified thread is NULL. - */ -extern DECLSPEC Uint32 SDLCALL SDL_GetThreadID(SDL_Thread *thread); - -/** Wait for a thread to finish. - * The return code for the thread function is placed in the area - * pointed to by 'status', if 'status' is not NULL. - */ -extern DECLSPEC void SDLCALL SDL_WaitThread(SDL_Thread *thread, int *status); - -/** Forcefully kill a thread without worrying about its state */ -extern DECLSPEC void SDLCALL SDL_KillThread(SDL_Thread *thread); - - -/* Ends C function definitions when using C++ */ -#ifdef __cplusplus -} -#endif -#include "close_code.h" - -#endif /* _SDL_thread_h */ diff --git a/dji_sdk_manifold_read_cam/include/sdl/SDL_timer.h b/dji_sdk_manifold_read_cam/include/sdl/SDL_timer.h deleted file mode 100644 index d764d5f..0000000 --- a/dji_sdk_manifold_read_cam/include/sdl/SDL_timer.h +++ /dev/null @@ -1,125 +0,0 @@ -/* - SDL - Simple DirectMedia Layer - Copyright (C) 1997-2012 Sam Lantinga - - This library is free software; you can redistribute it and/or - modify it under the terms of the GNU Lesser General Public - License as published by the Free Software Foundation; either - version 2.1 of the License, or (at your option) any later version. - - This library is distributed in the hope that it will be useful, - but WITHOUT ANY WARRANTY; without even the implied warranty of - MERCHANTABILITY or FITNESS FOR A PARTICULAR PURPOSE. See the GNU - Lesser General Public License for more details. - - You should have received a copy of the GNU Lesser General Public - License along with this library; if not, write to the Free Software - Foundation, Inc., 51 Franklin St, Fifth Floor, Boston, MA 02110-1301 USA - - Sam Lantinga - slouken@libsdl.org -*/ - -#ifndef _SDL_timer_h -#define _SDL_timer_h - -/** @file SDL_timer.h - * Header for the SDL time management routines - */ - -#include "SDL_stdinc.h" -#include "SDL_error.h" - -#include "begin_code.h" -/* Set up for C function definitions, even when using C++ */ -#ifdef __cplusplus -extern "C" { -#endif - -/** This is the OS scheduler timeslice, in milliseconds */ -#define SDL_TIMESLICE 10 - -/** This is the maximum resolution of the SDL timer on all platforms */ -#define TIMER_RESOLUTION 10 /**< Experimentally determined */ - -/** - * Get the number of milliseconds since the SDL library initialization. - * Note that this value wraps if the program runs for more than ~49 days. - */ -extern DECLSPEC Uint32 SDLCALL SDL_GetTicks(void); - -/** Wait a specified number of milliseconds before returning */ -extern DECLSPEC void SDLCALL SDL_Delay(Uint32 ms); - -/** Function prototype for the timer callback function */ -typedef Uint32 (SDLCALL *SDL_TimerCallback)(Uint32 interval); - -/** - * Set a callback to run after the specified number of milliseconds has - * elapsed. The callback function is passed the current timer interval - * and returns the next timer interval. If the returned value is the - * same as the one passed in, the periodic alarm continues, otherwise a - * new alarm is scheduled. If the callback returns 0, the periodic alarm - * is cancelled. - * - * To cancel a currently running timer, call SDL_SetTimer(0, NULL); - * - * The timer callback function may run in a different thread than your - * main code, and so shouldn't call any functions from within itself. - * - * The maximum resolution of this timer is 10 ms, which means that if - * you request a 16 ms timer, your callback will run approximately 20 ms - * later on an unloaded system. If you wanted to set a flag signaling - * a frame update at 30 frames per second (every 33 ms), you might set a - * timer for 30 ms: - * @code SDL_SetTimer((33/10)*10, flag_update); @endcode - * - * If you use this function, you need to pass SDL_INIT_TIMER to SDL_Init(). - * - * Under UNIX, you should not use raise or use SIGALRM and this function - * in the same program, as it is implemented using setitimer(). You also - * should not use this function in multi-threaded applications as signals - * to multi-threaded apps have undefined behavior in some implementations. - * - * This function returns 0 if successful, or -1 if there was an error. - */ -extern DECLSPEC int SDLCALL SDL_SetTimer(Uint32 interval, SDL_TimerCallback callback); - -/** @name New timer API - * New timer API, supports multiple timers - * Written by Stephane Peter - */ -/*@{*/ - -/** - * Function prototype for the new timer callback function. - * The callback function is passed the current timer interval and returns - * the next timer interval. If the returned value is the same as the one - * passed in, the periodic alarm continues, otherwise a new alarm is - * scheduled. If the callback returns 0, the periodic alarm is cancelled. - */ -typedef Uint32 (SDLCALL *SDL_NewTimerCallback)(Uint32 interval, void *param); - -/** Definition of the timer ID type */ -typedef struct _SDL_TimerID *SDL_TimerID; - -/** Add a new timer to the pool of timers already running. - * Returns a timer ID, or NULL when an error occurs. - */ -extern DECLSPEC SDL_TimerID SDLCALL SDL_AddTimer(Uint32 interval, SDL_NewTimerCallback callback, void *param); - -/** - * Remove one of the multiple timers knowing its ID. - * Returns a boolean value indicating success. - */ -extern DECLSPEC SDL_bool SDLCALL SDL_RemoveTimer(SDL_TimerID t); - -/*@}*/ - -/* Ends C function definitions when using C++ */ -#ifdef __cplusplus -} -#endif -#include "close_code.h" - -#endif /* _SDL_timer_h */ diff --git a/dji_sdk_manifold_read_cam/include/sdl/SDL_types.h b/dji_sdk_manifold_read_cam/include/sdl/SDL_types.h deleted file mode 100644 index 79d8b28..0000000 --- a/dji_sdk_manifold_read_cam/include/sdl/SDL_types.h +++ /dev/null @@ -1,28 +0,0 @@ -/* - SDL - Simple DirectMedia Layer - Copyright (C) 1997-2012 Sam Lantinga - - This library is free software; you can redistribute it and/or - modify it under the terms of the GNU Lesser General Public - License as published by the Free Software Foundation; either - version 2.1 of the License, or (at your option) any later version. - - This library is distributed in the hope that it will be useful, - but WITHOUT ANY WARRANTY; without even the implied warranty of - MERCHANTABILITY or FITNESS FOR A PARTICULAR PURPOSE. See the GNU - Lesser General Public License for more details. - - You should have received a copy of the GNU Lesser General Public - License along with this library; if not, write to the Free Software - Foundation, Inc., 51 Franklin St, Fifth Floor, Boston, MA 02110-1301 USA - - Sam Lantinga - slouken@libsdl.org -*/ - -/** @file SDL_types.h - * @deprecated Use SDL_stdinc.h instead. - */ - -/* DEPRECATED */ -#include "SDL_stdinc.h" diff --git a/dji_sdk_manifold_read_cam/include/sdl/SDL_version.h b/dji_sdk_manifold_read_cam/include/sdl/SDL_version.h deleted file mode 100644 index fdc17c6..0000000 --- a/dji_sdk_manifold_read_cam/include/sdl/SDL_version.h +++ /dev/null @@ -1,91 +0,0 @@ -/* - SDL - Simple DirectMedia Layer - Copyright (C) 1997-2012 Sam Lantinga - - This library is free software; you can redistribute it and/or - modify it under the terms of the GNU Lesser General Public - License as published by the Free Software Foundation; either - version 2.1 of the License, or (at your option) any later version. - - This library is distributed in the hope that it will be useful, - but WITHOUT ANY WARRANTY; without even the implied warranty of - MERCHANTABILITY or FITNESS FOR A PARTICULAR PURPOSE. See the GNU - Lesser General Public License for more details. - - You should have received a copy of the GNU Lesser General Public - License along with this library; if not, write to the Free Software - Foundation, Inc., 51 Franklin St, Fifth Floor, Boston, MA 02110-1301 USA - - Sam Lantinga - slouken@libsdl.org -*/ - -/** @file SDL_version.h - * This header defines the current SDL version - */ - -#ifndef _SDL_version_h -#define _SDL_version_h - -#include "SDL_stdinc.h" - -#include "begin_code.h" -/* Set up for C function definitions, even when using C++ */ -#ifdef __cplusplus -extern "C" { -#endif - -/** @name Version Number - * Printable format: "%d.%d.%d", MAJOR, MINOR, PATCHLEVEL - */ -/*@{*/ -#define SDL_MAJOR_VERSION 1 -#define SDL_MINOR_VERSION 2 -#define SDL_PATCHLEVEL 15 -/*@}*/ - -typedef struct SDL_version { - Uint8 major; - Uint8 minor; - Uint8 patch; -} SDL_version; - -/** - * This macro can be used to fill a version structure with the compile-time - * version of the SDL library. - */ -#define SDL_VERSION(X) \ -{ \ - (X)->major = SDL_MAJOR_VERSION; \ - (X)->minor = SDL_MINOR_VERSION; \ - (X)->patch = SDL_PATCHLEVEL; \ -} - -/** This macro turns the version numbers into a numeric value: - * (1,2,3) -> (1203) - * This assumes that there will never be more than 100 patchlevels - */ -#define SDL_VERSIONNUM(X, Y, Z) \ - ((X)*1000 + (Y)*100 + (Z)) - -/** This is the version number macro for the current SDL version */ -#define SDL_COMPILEDVERSION \ - SDL_VERSIONNUM(SDL_MAJOR_VERSION, SDL_MINOR_VERSION, SDL_PATCHLEVEL) - -/** This macro will evaluate to true if compiled with SDL at least X.Y.Z */ -#define SDL_VERSION_ATLEAST(X, Y, Z) \ - (SDL_COMPILEDVERSION >= SDL_VERSIONNUM(X, Y, Z)) - -/** This function gets the version of the dynamically linked SDL library. - * it should NOT be used to fill a version structure, instead you should - * use the SDL_Version() macro. - */ -extern DECLSPEC const SDL_version * SDLCALL SDL_Linked_Version(void); - -/* Ends C function definitions when using C++ */ -#ifdef __cplusplus -} -#endif -#include "close_code.h" - -#endif /* _SDL_version_h */ diff --git a/dji_sdk_manifold_read_cam/include/sdl/SDL_video.h b/dji_sdk_manifold_read_cam/include/sdl/SDL_video.h deleted file mode 100644 index f9c4e07..0000000 --- a/dji_sdk_manifold_read_cam/include/sdl/SDL_video.h +++ /dev/null @@ -1,951 +0,0 @@ -/* - SDL - Simple DirectMedia Layer - Copyright (C) 1997-2012 Sam Lantinga - - This library is free software; you can redistribute it and/or - modify it under the terms of the GNU Lesser General Public - License as published by the Free Software Foundation; either - version 2.1 of the License, or (at your option) any later version. - - This library is distributed in the hope that it will be useful, - but WITHOUT ANY WARRANTY; without even the implied warranty of - MERCHANTABILITY or FITNESS FOR A PARTICULAR PURPOSE. See the GNU - Lesser General Public License for more details. - - You should have received a copy of the GNU Lesser General Public - License along with this library; if not, write to the Free Software - Foundation, Inc., 51 Franklin St, Fifth Floor, Boston, MA 02110-1301 USA - - Sam Lantinga - slouken@libsdl.org -*/ - -/** @file SDL_video.h - * Header file for access to the SDL raw framebuffer window - */ - -#ifndef _SDL_video_h -#define _SDL_video_h - -#include "SDL_stdinc.h" -#include "SDL_error.h" -#include "SDL_rwops.h" - -#include "begin_code.h" -/* Set up for C function definitions, even when using C++ */ -#ifdef __cplusplus -extern "C" { -#endif - -/** @name Transparency definitions - * These define alpha as the opacity of a surface - */ -/*@{*/ -#define SDL_ALPHA_OPAQUE 255 -#define SDL_ALPHA_TRANSPARENT 0 -/*@}*/ - -/** @name Useful data types */ -/*@{*/ -typedef struct SDL_Rect { - Sint16 x, y; - Uint16 w, h; -} SDL_Rect; - -typedef struct SDL_Color { - Uint8 r; - Uint8 g; - Uint8 b; - Uint8 unused; -} SDL_Color; -#define SDL_Colour SDL_Color - -typedef struct SDL_Palette { - int ncolors; - SDL_Color *colors; -} SDL_Palette; -/*@}*/ - -/** Everything in the pixel format structure is read-only */ -typedef struct SDL_PixelFormat { - SDL_Palette *palette; - Uint8 BitsPerPixel; - Uint8 BytesPerPixel; - Uint8 Rloss; - Uint8 Gloss; - Uint8 Bloss; - Uint8 Aloss; - Uint8 Rshift; - Uint8 Gshift; - Uint8 Bshift; - Uint8 Ashift; - Uint32 Rmask; - Uint32 Gmask; - Uint32 Bmask; - Uint32 Amask; - - /** RGB color key information */ - Uint32 colorkey; - /** Alpha value information (per-surface alpha) */ - Uint8 alpha; -} SDL_PixelFormat; - -/** This structure should be treated as read-only, except for 'pixels', - * which, if not NULL, contains the raw pixel data for the surface. - */ -typedef struct SDL_Surface { - Uint32 flags; /**< Read-only */ - SDL_PixelFormat *format; /**< Read-only */ - int w, h; /**< Read-only */ - Uint16 pitch; /**< Read-only */ - void *pixels; /**< Read-write */ - int offset; /**< Private */ - - /** Hardware-specific surface info */ - struct private_hwdata *hwdata; - - /** clipping information */ - SDL_Rect clip_rect; /**< Read-only */ - Uint32 unused1; /**< for binary compatibility */ - - /** Allow recursive locks */ - Uint32 locked; /**< Private */ - - /** info for fast blit mapping to other surfaces */ - struct SDL_BlitMap *map; /**< Private */ - - /** format version, bumped at every change to invalidate blit maps */ - unsigned int format_version; /**< Private */ - - /** Reference count -- used when freeing surface */ - int refcount; /**< Read-mostly */ -} SDL_Surface; - -/** @name SDL_Surface Flags - * These are the currently supported flags for the SDL_surface - */ -/*@{*/ - -/** Available for SDL_CreateRGBSurface() or SDL_SetVideoMode() */ -/*@{*/ -#define SDL_SWSURFACE 0x00000000 /**< Surface is in system memory */ -#define SDL_HWSURFACE 0x00000001 /**< Surface is in video memory */ -#define SDL_ASYNCBLIT 0x00000004 /**< Use asynchronous blits if possible */ -/*@}*/ - -/** Available for SDL_SetVideoMode() */ -/*@{*/ -#define SDL_ANYFORMAT 0x10000000 /**< Allow any video depth/pixel-format */ -#define SDL_HWPALETTE 0x20000000 /**< Surface has exclusive palette */ -#define SDL_DOUBLEBUF 0x40000000 /**< Set up double-buffered video mode */ -#define SDL_FULLSCREEN 0x80000000 /**< Surface is a full screen display */ -#define SDL_OPENGL 0x00000002 /**< Create an OpenGL rendering context */ -#define SDL_OPENGLBLIT 0x0000000A /**< Create an OpenGL rendering context and use it for blitting */ -#define SDL_RESIZABLE 0x00000010 /**< This video mode may be resized */ -#define SDL_NOFRAME 0x00000020 /**< No window caption or edge frame */ -/*@}*/ - -/** Used internally (read-only) */ -/*@{*/ -#define SDL_HWACCEL 0x00000100 /**< Blit uses hardware acceleration */ -#define SDL_SRCCOLORKEY 0x00001000 /**< Blit uses a source color key */ -#define SDL_RLEACCELOK 0x00002000 /**< Private flag */ -#define SDL_RLEACCEL 0x00004000 /**< Surface is RLE encoded */ -#define SDL_SRCALPHA 0x00010000 /**< Blit uses source alpha blending */ -#define SDL_PREALLOC 0x01000000 /**< Surface uses preallocated memory */ -/*@}*/ - -/*@}*/ - -/** Evaluates to true if the surface needs to be locked before access */ -#define SDL_MUSTLOCK(surface) \ - (surface->offset || \ - ((surface->flags & (SDL_HWSURFACE|SDL_ASYNCBLIT|SDL_RLEACCEL)) != 0)) - -/** typedef for private surface blitting functions */ -typedef int (*SDL_blit)(struct SDL_Surface *src, SDL_Rect *srcrect, - struct SDL_Surface *dst, SDL_Rect *dstrect); - - -/** Useful for determining the video hardware capabilities */ -typedef struct SDL_VideoInfo { - Uint32 hw_available :1; /**< Flag: Can you create hardware surfaces? */ - Uint32 wm_available :1; /**< Flag: Can you talk to a window manager? */ - Uint32 UnusedBits1 :6; - Uint32 UnusedBits2 :1; - Uint32 blit_hw :1; /**< Flag: Accelerated blits HW --> HW */ - Uint32 blit_hw_CC :1; /**< Flag: Accelerated blits with Colorkey */ - Uint32 blit_hw_A :1; /**< Flag: Accelerated blits with Alpha */ - Uint32 blit_sw :1; /**< Flag: Accelerated blits SW --> HW */ - Uint32 blit_sw_CC :1; /**< Flag: Accelerated blits with Colorkey */ - Uint32 blit_sw_A :1; /**< Flag: Accelerated blits with Alpha */ - Uint32 blit_fill :1; /**< Flag: Accelerated color fill */ - Uint32 UnusedBits3 :16; - Uint32 video_mem; /**< The total amount of video memory (in K) */ - SDL_PixelFormat *vfmt; /**< Value: The format of the video surface */ - int current_w; /**< Value: The current video mode width */ - int current_h; /**< Value: The current video mode height */ -} SDL_VideoInfo; - - -/** @name Overlay Formats - * The most common video overlay formats. - * For an explanation of these pixel formats, see: - * http://www.webartz.com/fourcc/indexyuv.htm - * - * For information on the relationship between color spaces, see: - * http://www.neuro.sfc.keio.ac.jp/~aly/polygon/info/color-space-faq.html - */ -/*@{*/ -#define SDL_YV12_OVERLAY 0x32315659 /**< Planar mode: Y + V + U (3 planes) */ -#define SDL_IYUV_OVERLAY 0x56555949 /**< Planar mode: Y + U + V (3 planes) */ -#define SDL_YUY2_OVERLAY 0x32595559 /**< Packed mode: Y0+U0+Y1+V0 (1 plane) */ -#define SDL_UYVY_OVERLAY 0x59565955 /**< Packed mode: U0+Y0+V0+Y1 (1 plane) */ -#define SDL_YVYU_OVERLAY 0x55595659 /**< Packed mode: Y0+V0+Y1+U0 (1 plane) */ -/*@}*/ - -/** The YUV hardware video overlay */ -typedef struct SDL_Overlay { - Uint32 format; /**< Read-only */ - int w, h; /**< Read-only */ - int planes; /**< Read-only */ - Uint16 *pitches; /**< Read-only */ - Uint8 **pixels; /**< Read-write */ - - /** @name Hardware-specific surface info */ - /*@{*/ - struct private_yuvhwfuncs *hwfuncs; - struct private_yuvhwdata *hwdata; - /*@{*/ - - /** @name Special flags */ - /*@{*/ - Uint32 hw_overlay :1; /**< Flag: This overlay hardware accelerated? */ - Uint32 UnusedBits :31; - /*@}*/ -} SDL_Overlay; - - -/** Public enumeration for setting the OpenGL window attributes. */ -typedef enum { - SDL_GL_RED_SIZE, - SDL_GL_GREEN_SIZE, - SDL_GL_BLUE_SIZE, - SDL_GL_ALPHA_SIZE, - SDL_GL_BUFFER_SIZE, - SDL_GL_DOUBLEBUFFER, - SDL_GL_DEPTH_SIZE, - SDL_GL_STENCIL_SIZE, - SDL_GL_ACCUM_RED_SIZE, - SDL_GL_ACCUM_GREEN_SIZE, - SDL_GL_ACCUM_BLUE_SIZE, - SDL_GL_ACCUM_ALPHA_SIZE, - SDL_GL_STEREO, - SDL_GL_MULTISAMPLEBUFFERS, - SDL_GL_MULTISAMPLESAMPLES, - SDL_GL_ACCELERATED_VISUAL, - SDL_GL_SWAP_CONTROL -} SDL_GLattr; - -/** @name flags for SDL_SetPalette() */ -/*@{*/ -#define SDL_LOGPAL 0x01 -#define SDL_PHYSPAL 0x02 -/*@}*/ - -/* Function prototypes */ - -/** - * @name Video Init and Quit - * These functions are used internally, and should not be used unless you - * have a specific need to specify the video driver you want to use. - * You should normally use SDL_Init() or SDL_InitSubSystem(). - */ -/*@{*/ -/** - * Initializes the video subsystem. Sets up a connection - * to the window manager, etc, and determines the current video mode and - * pixel format, but does not initialize a window or graphics mode. - * Note that event handling is activated by this routine. - * - * If you use both sound and video in your application, you need to call - * SDL_Init() before opening the sound device, otherwise under Win32 DirectX, - * you won't be able to set full-screen display modes. - */ -extern DECLSPEC int SDLCALL SDL_VideoInit(const char *driver_name, Uint32 flags); -extern DECLSPEC void SDLCALL SDL_VideoQuit(void); -/*@}*/ - -/** - * This function fills the given character buffer with the name of the - * video driver, and returns a pointer to it if the video driver has - * been initialized. It returns NULL if no driver has been initialized. - */ -extern DECLSPEC char * SDLCALL SDL_VideoDriverName(char *namebuf, int maxlen); - -/** - * This function returns a pointer to the current display surface. - * If SDL is doing format conversion on the display surface, this - * function returns the publicly visible surface, not the real video - * surface. - */ -extern DECLSPEC SDL_Surface * SDLCALL SDL_GetVideoSurface(void); - -/** - * This function returns a read-only pointer to information about the - * video hardware. If this is called before SDL_SetVideoMode(), the 'vfmt' - * member of the returned structure will contain the pixel format of the - * "best" video mode. - */ -extern DECLSPEC const SDL_VideoInfo * SDLCALL SDL_GetVideoInfo(void); - -/** - * Check to see if a particular video mode is supported. - * It returns 0 if the requested mode is not supported under any bit depth, - * or returns the bits-per-pixel of the closest available mode with the - * given width and height. If this bits-per-pixel is different from the - * one used when setting the video mode, SDL_SetVideoMode() will succeed, - * but will emulate the requested bits-per-pixel with a shadow surface. - * - * The arguments to SDL_VideoModeOK() are the same ones you would pass to - * SDL_SetVideoMode() - */ -extern DECLSPEC int SDLCALL SDL_VideoModeOK(int width, int height, int bpp, Uint32 flags); - -/** - * Return a pointer to an array of available screen dimensions for the - * given format and video flags, sorted largest to smallest. Returns - * NULL if there are no dimensions available for a particular format, - * or (SDL_Rect **)-1 if any dimension is okay for the given format. - * - * If 'format' is NULL, the mode list will be for the format given - * by SDL_GetVideoInfo()->vfmt - */ -extern DECLSPEC SDL_Rect ** SDLCALL SDL_ListModes(SDL_PixelFormat *format, Uint32 flags); - -/** - * Set up a video mode with the specified width, height and bits-per-pixel. - * - * If 'bpp' is 0, it is treated as the current display bits per pixel. - * - * If SDL_ANYFORMAT is set in 'flags', the SDL library will try to set the - * requested bits-per-pixel, but will return whatever video pixel format is - * available. The default is to emulate the requested pixel format if it - * is not natively available. - * - * If SDL_HWSURFACE is set in 'flags', the video surface will be placed in - * video memory, if possible, and you may have to call SDL_LockSurface() - * in order to access the raw framebuffer. Otherwise, the video surface - * will be created in system memory. - * - * If SDL_ASYNCBLIT is set in 'flags', SDL will try to perform rectangle - * updates asynchronously, but you must always lock before accessing pixels. - * SDL will wait for updates to complete before returning from the lock. - * - * If SDL_HWPALETTE is set in 'flags', the SDL library will guarantee - * that the colors set by SDL_SetColors() will be the colors you get. - * Otherwise, in 8-bit mode, SDL_SetColors() may not be able to set all - * of the colors exactly the way they are requested, and you should look - * at the video surface structure to determine the actual palette. - * If SDL cannot guarantee that the colors you request can be set, - * i.e. if the colormap is shared, then the video surface may be created - * under emulation in system memory, overriding the SDL_HWSURFACE flag. - * - * If SDL_FULLSCREEN is set in 'flags', the SDL library will try to set - * a fullscreen video mode. The default is to create a windowed mode - * if the current graphics system has a window manager. - * If the SDL library is able to set a fullscreen video mode, this flag - * will be set in the surface that is returned. - * - * If SDL_DOUBLEBUF is set in 'flags', the SDL library will try to set up - * two surfaces in video memory and swap between them when you call - * SDL_Flip(). This is usually slower than the normal single-buffering - * scheme, but prevents "tearing" artifacts caused by modifying video - * memory while the monitor is refreshing. It should only be used by - * applications that redraw the entire screen on every update. - * - * If SDL_RESIZABLE is set in 'flags', the SDL library will allow the - * window manager, if any, to resize the window at runtime. When this - * occurs, SDL will send a SDL_VIDEORESIZE event to you application, - * and you must respond to the event by re-calling SDL_SetVideoMode() - * with the requested size (or another size that suits the application). - * - * If SDL_NOFRAME is set in 'flags', the SDL library will create a window - * without any title bar or frame decoration. Fullscreen video modes have - * this flag set automatically. - * - * This function returns the video framebuffer surface, or NULL if it fails. - * - * If you rely on functionality provided by certain video flags, check the - * flags of the returned surface to make sure that functionality is available. - * SDL will fall back to reduced functionality if the exact flags you wanted - * are not available. - */ -extern DECLSPEC SDL_Surface * SDLCALL SDL_SetVideoMode - (int width, int height, int bpp, Uint32 flags); - -/** @name SDL_Update Functions - * These functions should not be called while 'screen' is locked. - */ -/*@{*/ -/** - * Makes sure the given list of rectangles is updated on the given screen. - */ -extern DECLSPEC void SDLCALL SDL_UpdateRects - (SDL_Surface *screen, int numrects, SDL_Rect *rects); -/** - * If 'x', 'y', 'w' and 'h' are all 0, SDL_UpdateRect will update the entire - * screen. - */ -extern DECLSPEC void SDLCALL SDL_UpdateRect - (SDL_Surface *screen, Sint32 x, Sint32 y, Uint32 w, Uint32 h); -/*@}*/ - -/** - * On hardware that supports double-buffering, this function sets up a flip - * and returns. The hardware will wait for vertical retrace, and then swap - * video buffers before the next video surface blit or lock will return. - * On hardware that doesn not support double-buffering, this is equivalent - * to calling SDL_UpdateRect(screen, 0, 0, 0, 0); - * The SDL_DOUBLEBUF flag must have been passed to SDL_SetVideoMode() when - * setting the video mode for this function to perform hardware flipping. - * This function returns 0 if successful, or -1 if there was an error. - */ -extern DECLSPEC int SDLCALL SDL_Flip(SDL_Surface *screen); - -/** - * Set the gamma correction for each of the color channels. - * The gamma values range (approximately) between 0.1 and 10.0 - * - * If this function isn't supported directly by the hardware, it will - * be emulated using gamma ramps, if available. If successful, this - * function returns 0, otherwise it returns -1. - */ -extern DECLSPEC int SDLCALL SDL_SetGamma(float red, float green, float blue); - -/** - * Set the gamma translation table for the red, green, and blue channels - * of the video hardware. Each table is an array of 256 16-bit quantities, - * representing a mapping between the input and output for that channel. - * The input is the index into the array, and the output is the 16-bit - * gamma value at that index, scaled to the output color precision. - * - * You may pass NULL for any of the channels to leave it unchanged. - * If the call succeeds, it will return 0. If the display driver or - * hardware does not support gamma translation, or otherwise fails, - * this function will return -1. - */ -extern DECLSPEC int SDLCALL SDL_SetGammaRamp(const Uint16 *red, const Uint16 *green, const Uint16 *blue); - -/** - * Retrieve the current values of the gamma translation tables. - * - * You must pass in valid pointers to arrays of 256 16-bit quantities. - * Any of the pointers may be NULL to ignore that channel. - * If the call succeeds, it will return 0. If the display driver or - * hardware does not support gamma translation, or otherwise fails, - * this function will return -1. - */ -extern DECLSPEC int SDLCALL SDL_GetGammaRamp(Uint16 *red, Uint16 *green, Uint16 *blue); - -/** - * Sets a portion of the colormap for the given 8-bit surface. If 'surface' - * is not a palettized surface, this function does nothing, returning 0. - * If all of the colors were set as passed to SDL_SetColors(), it will - * return 1. If not all the color entries were set exactly as given, - * it will return 0, and you should look at the surface palette to - * determine the actual color palette. - * - * When 'surface' is the surface associated with the current display, the - * display colormap will be updated with the requested colors. If - * SDL_HWPALETTE was set in SDL_SetVideoMode() flags, SDL_SetColors() - * will always return 1, and the palette is guaranteed to be set the way - * you desire, even if the window colormap has to be warped or run under - * emulation. - */ -extern DECLSPEC int SDLCALL SDL_SetColors(SDL_Surface *surface, - SDL_Color *colors, int firstcolor, int ncolors); - -/** - * Sets a portion of the colormap for a given 8-bit surface. - * 'flags' is one or both of: - * SDL_LOGPAL -- set logical palette, which controls how blits are mapped - * to/from the surface, - * SDL_PHYSPAL -- set physical palette, which controls how pixels look on - * the screen - * Only screens have physical palettes. Separate change of physical/logical - * palettes is only possible if the screen has SDL_HWPALETTE set. - * - * The return value is 1 if all colours could be set as requested, and 0 - * otherwise. - * - * SDL_SetColors() is equivalent to calling this function with - * flags = (SDL_LOGPAL|SDL_PHYSPAL). - */ -extern DECLSPEC int SDLCALL SDL_SetPalette(SDL_Surface *surface, int flags, - SDL_Color *colors, int firstcolor, - int ncolors); - -/** - * Maps an RGB triple to an opaque pixel value for a given pixel format - */ -extern DECLSPEC Uint32 SDLCALL SDL_MapRGB -(const SDL_PixelFormat * const format, - const Uint8 r, const Uint8 g, const Uint8 b); - -/** - * Maps an RGBA quadruple to a pixel value for a given pixel format - */ -extern DECLSPEC Uint32 SDLCALL SDL_MapRGBA -(const SDL_PixelFormat * const format, - const Uint8 r, const Uint8 g, const Uint8 b, const Uint8 a); - -/** - * Maps a pixel value into the RGB components for a given pixel format - */ -extern DECLSPEC void SDLCALL SDL_GetRGB(Uint32 pixel, - const SDL_PixelFormat * const fmt, - Uint8 *r, Uint8 *g, Uint8 *b); - -/** - * Maps a pixel value into the RGBA components for a given pixel format - */ -extern DECLSPEC void SDLCALL SDL_GetRGBA(Uint32 pixel, - const SDL_PixelFormat * const fmt, - Uint8 *r, Uint8 *g, Uint8 *b, Uint8 *a); - -/** @sa SDL_CreateRGBSurface */ -#define SDL_AllocSurface SDL_CreateRGBSurface -/** - * Allocate and free an RGB surface (must be called after SDL_SetVideoMode) - * If the depth is 4 or 8 bits, an empty palette is allocated for the surface. - * If the depth is greater than 8 bits, the pixel format is set using the - * flags '[RGB]mask'. - * If the function runs out of memory, it will return NULL. - * - * The 'flags' tell what kind of surface to create. - * SDL_SWSURFACE means that the surface should be created in system memory. - * SDL_HWSURFACE means that the surface should be created in video memory, - * with the same format as the display surface. This is useful for surfaces - * that will not change much, to take advantage of hardware acceleration - * when being blitted to the display surface. - * SDL_ASYNCBLIT means that SDL will try to perform asynchronous blits with - * this surface, but you must always lock it before accessing the pixels. - * SDL will wait for current blits to finish before returning from the lock. - * SDL_SRCCOLORKEY indicates that the surface will be used for colorkey blits. - * If the hardware supports acceleration of colorkey blits between - * two surfaces in video memory, SDL will try to place the surface in - * video memory. If this isn't possible or if there is no hardware - * acceleration available, the surface will be placed in system memory. - * SDL_SRCALPHA means that the surface will be used for alpha blits and - * if the hardware supports hardware acceleration of alpha blits between - * two surfaces in video memory, to place the surface in video memory - * if possible, otherwise it will be placed in system memory. - * If the surface is created in video memory, blits will be _much_ faster, - * but the surface format must be identical to the video surface format, - * and the only way to access the pixels member of the surface is to use - * the SDL_LockSurface() and SDL_UnlockSurface() calls. - * If the requested surface actually resides in video memory, SDL_HWSURFACE - * will be set in the flags member of the returned surface. If for some - * reason the surface could not be placed in video memory, it will not have - * the SDL_HWSURFACE flag set, and will be created in system memory instead. - */ -extern DECLSPEC SDL_Surface * SDLCALL SDL_CreateRGBSurface - (Uint32 flags, int width, int height, int depth, - Uint32 Rmask, Uint32 Gmask, Uint32 Bmask, Uint32 Amask); -/** @sa SDL_CreateRGBSurface */ -extern DECLSPEC SDL_Surface * SDLCALL SDL_CreateRGBSurfaceFrom(void *pixels, - int width, int height, int depth, int pitch, - Uint32 Rmask, Uint32 Gmask, Uint32 Bmask, Uint32 Amask); -extern DECLSPEC void SDLCALL SDL_FreeSurface(SDL_Surface *surface); - -/** - * SDL_LockSurface() sets up a surface for directly accessing the pixels. - * Between calls to SDL_LockSurface()/SDL_UnlockSurface(), you can write - * to and read from 'surface->pixels', using the pixel format stored in - * 'surface->format'. Once you are done accessing the surface, you should - * use SDL_UnlockSurface() to release it. - * - * Not all surfaces require locking. If SDL_MUSTLOCK(surface) evaluates - * to 0, then you can read and write to the surface at any time, and the - * pixel format of the surface will not change. In particular, if the - * SDL_HWSURFACE flag is not given when calling SDL_SetVideoMode(), you - * will not need to lock the display surface before accessing it. - * - * No operating system or library calls should be made between lock/unlock - * pairs, as critical system locks may be held during this time. - * - * SDL_LockSurface() returns 0, or -1 if the surface couldn't be locked. - */ -extern DECLSPEC int SDLCALL SDL_LockSurface(SDL_Surface *surface); -extern DECLSPEC void SDLCALL SDL_UnlockSurface(SDL_Surface *surface); - -/** - * Load a surface from a seekable SDL data source (memory or file.) - * If 'freesrc' is non-zero, the source will be closed after being read. - * Returns the new surface, or NULL if there was an error. - * The new surface should be freed with SDL_FreeSurface(). - */ -extern DECLSPEC SDL_Surface * SDLCALL SDL_LoadBMP_RW(SDL_RWops *src, int freesrc); - -/** Convenience macro -- load a surface from a file */ -#define SDL_LoadBMP(file) SDL_LoadBMP_RW(SDL_RWFromFile(file, "rb"), 1) - -/** - * Save a surface to a seekable SDL data source (memory or file.) - * If 'freedst' is non-zero, the source will be closed after being written. - * Returns 0 if successful or -1 if there was an error. - */ -extern DECLSPEC int SDLCALL SDL_SaveBMP_RW - (SDL_Surface *surface, SDL_RWops *dst, int freedst); - -/** Convenience macro -- save a surface to a file */ -#define SDL_SaveBMP(surface, file) \ - SDL_SaveBMP_RW(surface, SDL_RWFromFile(file, "wb"), 1) - -/** - * Sets the color key (transparent pixel) in a blittable surface. - * If 'flag' is SDL_SRCCOLORKEY (optionally OR'd with SDL_RLEACCEL), - * 'key' will be the transparent pixel in the source image of a blit. - * SDL_RLEACCEL requests RLE acceleration for the surface if present, - * and removes RLE acceleration if absent. - * If 'flag' is 0, this function clears any current color key. - * This function returns 0, or -1 if there was an error. - */ -extern DECLSPEC int SDLCALL SDL_SetColorKey - (SDL_Surface *surface, Uint32 flag, Uint32 key); - -/** - * This function sets the alpha value for the entire surface, as opposed to - * using the alpha component of each pixel. This value measures the range - * of transparency of the surface, 0 being completely transparent to 255 - * being completely opaque. An 'alpha' value of 255 causes blits to be - * opaque, the source pixels copied to the destination (the default). Note - * that per-surface alpha can be combined with colorkey transparency. - * - * If 'flag' is 0, alpha blending is disabled for the surface. - * If 'flag' is SDL_SRCALPHA, alpha blending is enabled for the surface. - * OR:ing the flag with SDL_RLEACCEL requests RLE acceleration for the - * surface; if SDL_RLEACCEL is not specified, the RLE accel will be removed. - * - * The 'alpha' parameter is ignored for surfaces that have an alpha channel. - */ -extern DECLSPEC int SDLCALL SDL_SetAlpha(SDL_Surface *surface, Uint32 flag, Uint8 alpha); - -/** - * Sets the clipping rectangle for the destination surface in a blit. - * - * If the clip rectangle is NULL, clipping will be disabled. - * If the clip rectangle doesn't intersect the surface, the function will - * return SDL_FALSE and blits will be completely clipped. Otherwise the - * function returns SDL_TRUE and blits to the surface will be clipped to - * the intersection of the surface area and the clipping rectangle. - * - * Note that blits are automatically clipped to the edges of the source - * and destination surfaces. - */ -extern DECLSPEC SDL_bool SDLCALL SDL_SetClipRect(SDL_Surface *surface, const SDL_Rect *rect); - -/** - * Gets the clipping rectangle for the destination surface in a blit. - * 'rect' must be a pointer to a valid rectangle which will be filled - * with the correct values. - */ -extern DECLSPEC void SDLCALL SDL_GetClipRect(SDL_Surface *surface, SDL_Rect *rect); - -/** - * Creates a new surface of the specified format, and then copies and maps - * the given surface to it so the blit of the converted surface will be as - * fast as possible. If this function fails, it returns NULL. - * - * The 'flags' parameter is passed to SDL_CreateRGBSurface() and has those - * semantics. You can also pass SDL_RLEACCEL in the flags parameter and - * SDL will try to RLE accelerate colorkey and alpha blits in the resulting - * surface. - * - * This function is used internally by SDL_DisplayFormat(). - */ -extern DECLSPEC SDL_Surface * SDLCALL SDL_ConvertSurface - (SDL_Surface *src, SDL_PixelFormat *fmt, Uint32 flags); - -/** - * This performs a fast blit from the source surface to the destination - * surface. It assumes that the source and destination rectangles are - * the same size. If either 'srcrect' or 'dstrect' are NULL, the entire - * surface (src or dst) is copied. The final blit rectangles are saved - * in 'srcrect' and 'dstrect' after all clipping is performed. - * If the blit is successful, it returns 0, otherwise it returns -1. - * - * The blit function should not be called on a locked surface. - * - * The blit semantics for surfaces with and without alpha and colorkey - * are defined as follows: - * - * RGBA->RGB: - * SDL_SRCALPHA set: - * alpha-blend (using alpha-channel). - * SDL_SRCCOLORKEY ignored. - * SDL_SRCALPHA not set: - * copy RGB. - * if SDL_SRCCOLORKEY set, only copy the pixels matching the - * RGB values of the source colour key, ignoring alpha in the - * comparison. - * - * RGB->RGBA: - * SDL_SRCALPHA set: - * alpha-blend (using the source per-surface alpha value); - * set destination alpha to opaque. - * SDL_SRCALPHA not set: - * copy RGB, set destination alpha to source per-surface alpha value. - * both: - * if SDL_SRCCOLORKEY set, only copy the pixels matching the - * source colour key. - * - * RGBA->RGBA: - * SDL_SRCALPHA set: - * alpha-blend (using the source alpha channel) the RGB values; - * leave destination alpha untouched. [Note: is this correct?] - * SDL_SRCCOLORKEY ignored. - * SDL_SRCALPHA not set: - * copy all of RGBA to the destination. - * if SDL_SRCCOLORKEY set, only copy the pixels matching the - * RGB values of the source colour key, ignoring alpha in the - * comparison. - * - * RGB->RGB: - * SDL_SRCALPHA set: - * alpha-blend (using the source per-surface alpha value). - * SDL_SRCALPHA not set: - * copy RGB. - * both: - * if SDL_SRCCOLORKEY set, only copy the pixels matching the - * source colour key. - * - * If either of the surfaces were in video memory, and the blit returns -2, - * the video memory was lost, so it should be reloaded with artwork and - * re-blitted: - * @code - * while ( SDL_BlitSurface(image, imgrect, screen, dstrect) == -2 ) { - * while ( SDL_LockSurface(image) < 0 ) - * Sleep(10); - * -- Write image pixels to image->pixels -- - * SDL_UnlockSurface(image); - * } - * @endcode - * - * This happens under DirectX 5.0 when the system switches away from your - * fullscreen application. The lock will also fail until you have access - * to the video memory again. - * - * You should call SDL_BlitSurface() unless you know exactly how SDL - * blitting works internally and how to use the other blit functions. - */ -#define SDL_BlitSurface SDL_UpperBlit - -/** This is the public blit function, SDL_BlitSurface(), and it performs - * rectangle validation and clipping before passing it to SDL_LowerBlit() - */ -extern DECLSPEC int SDLCALL SDL_UpperBlit - (SDL_Surface *src, SDL_Rect *srcrect, - SDL_Surface *dst, SDL_Rect *dstrect); -/** This is a semi-private blit function and it performs low-level surface - * blitting only. - */ -extern DECLSPEC int SDLCALL SDL_LowerBlit - (SDL_Surface *src, SDL_Rect *srcrect, - SDL_Surface *dst, SDL_Rect *dstrect); - -/** - * This function performs a fast fill of the given rectangle with 'color' - * The given rectangle is clipped to the destination surface clip area - * and the final fill rectangle is saved in the passed in pointer. - * If 'dstrect' is NULL, the whole surface will be filled with 'color' - * The color should be a pixel of the format used by the surface, and - * can be generated by the SDL_MapRGB() function. - * This function returns 0 on success, or -1 on error. - */ -extern DECLSPEC int SDLCALL SDL_FillRect - (SDL_Surface *dst, SDL_Rect *dstrect, Uint32 color); - -/** - * This function takes a surface and copies it to a new surface of the - * pixel format and colors of the video framebuffer, suitable for fast - * blitting onto the display surface. It calls SDL_ConvertSurface() - * - * If you want to take advantage of hardware colorkey or alpha blit - * acceleration, you should set the colorkey and alpha value before - * calling this function. - * - * If the conversion fails or runs out of memory, it returns NULL - */ -extern DECLSPEC SDL_Surface * SDLCALL SDL_DisplayFormat(SDL_Surface *surface); - -/** - * This function takes a surface and copies it to a new surface of the - * pixel format and colors of the video framebuffer (if possible), - * suitable for fast alpha blitting onto the display surface. - * The new surface will always have an alpha channel. - * - * If you want to take advantage of hardware colorkey or alpha blit - * acceleration, you should set the colorkey and alpha value before - * calling this function. - * - * If the conversion fails or runs out of memory, it returns NULL - */ -extern DECLSPEC SDL_Surface * SDLCALL SDL_DisplayFormatAlpha(SDL_Surface *surface); - - -/* * * * * * * * * * * * * * * * * * * * * * * * * * * * * * * * * * * * * * */ -/** @name YUV video surface overlay functions */ /*@{*/ -/* * * * * * * * * * * * * * * * * * * * * * * * * * * * * * * * * * * * * * */ - -/** This function creates a video output overlay - * Calling the returned surface an overlay is something of a misnomer because - * the contents of the display surface underneath the area where the overlay - * is shown is undefined - it may be overwritten with the converted YUV data. - */ -extern DECLSPEC SDL_Overlay * SDLCALL SDL_CreateYUVOverlay(int width, int height, - Uint32 format, SDL_Surface *display); - -/** Lock an overlay for direct access, and unlock it when you are done */ -extern DECLSPEC int SDLCALL SDL_LockYUVOverlay(SDL_Overlay *overlay); -extern DECLSPEC void SDLCALL SDL_UnlockYUVOverlay(SDL_Overlay *overlay); - -/** Blit a video overlay to the display surface. - * The contents of the video surface underneath the blit destination are - * not defined. - * The width and height of the destination rectangle may be different from - * that of the overlay, but currently only 2x scaling is supported. - */ -extern DECLSPEC int SDLCALL SDL_DisplayYUVOverlay(SDL_Overlay *overlay, SDL_Rect *dstrect); - -/** Free a video overlay */ -extern DECLSPEC void SDLCALL SDL_FreeYUVOverlay(SDL_Overlay *overlay); - -/*@}*/ - -/* * * * * * * * * * * * * * * * * * * * * * * * * * * * * * * * * * * * * * */ -/** @name OpenGL support functions. */ /*@{*/ -/* * * * * * * * * * * * * * * * * * * * * * * * * * * * * * * * * * * * * * */ - -/** - * Dynamically load an OpenGL library, or the default one if path is NULL - * - * If you do this, you need to retrieve all of the GL functions used in - * your program from the dynamic library using SDL_GL_GetProcAddress(). - */ -extern DECLSPEC int SDLCALL SDL_GL_LoadLibrary(const char *path); - -/** - * Get the address of a GL function - */ -extern DECLSPEC void * SDLCALL SDL_GL_GetProcAddress(const char* proc); - -/** - * Set an attribute of the OpenGL subsystem before intialization. - */ -extern DECLSPEC int SDLCALL SDL_GL_SetAttribute(SDL_GLattr attr, int value); - -/** - * Get an attribute of the OpenGL subsystem from the windowing - * interface, such as glX. This is of course different from getting - * the values from SDL's internal OpenGL subsystem, which only - * stores the values you request before initialization. - * - * Developers should track the values they pass into SDL_GL_SetAttribute - * themselves if they want to retrieve these values. - */ -extern DECLSPEC int SDLCALL SDL_GL_GetAttribute(SDL_GLattr attr, int* value); - -/** - * Swap the OpenGL buffers, if double-buffering is supported. - */ -extern DECLSPEC void SDLCALL SDL_GL_SwapBuffers(void); - -/** @name OpenGL Internal Functions - * Internal functions that should not be called unless you have read - * and understood the source code for these functions. - */ -/*@{*/ -extern DECLSPEC void SDLCALL SDL_GL_UpdateRects(int numrects, SDL_Rect* rects); -extern DECLSPEC void SDLCALL SDL_GL_Lock(void); -extern DECLSPEC void SDLCALL SDL_GL_Unlock(void); -/*@}*/ - -/*@}*/ - -/* * * * * * * * * * * * * * * * * * * * * * * * * * * * * * * * * * * * * * */ -/** @name Window Manager Functions */ -/** These functions allow interaction with the window manager, if any. */ /*@{*/ -/* * * * * * * * * * * * * * * * * * * * * * * * * * * * * * * * * * * * * * */ - -/** - * Sets the title and icon text of the display window (UTF-8 encoded) - */ -extern DECLSPEC void SDLCALL SDL_WM_SetCaption(const char *title, const char *icon); -/** - * Gets the title and icon text of the display window (UTF-8 encoded) - */ -extern DECLSPEC void SDLCALL SDL_WM_GetCaption(char **title, char **icon); - -/** - * Sets the icon for the display window. - * This function must be called before the first call to SDL_SetVideoMode(). - * It takes an icon surface, and a mask in MSB format. - * If 'mask' is NULL, the entire icon surface will be used as the icon. - */ -extern DECLSPEC void SDLCALL SDL_WM_SetIcon(SDL_Surface *icon, Uint8 *mask); - -/** - * This function iconifies the window, and returns 1 if it succeeded. - * If the function succeeds, it generates an SDL_APPACTIVE loss event. - * This function is a noop and returns 0 in non-windowed environments. - */ -extern DECLSPEC int SDLCALL SDL_WM_IconifyWindow(void); - -/** - * Toggle fullscreen mode without changing the contents of the screen. - * If the display surface does not require locking before accessing - * the pixel information, then the memory pointers will not change. - * - * If this function was able to toggle fullscreen mode (change from - * running in a window to fullscreen, or vice-versa), it will return 1. - * If it is not implemented, or fails, it returns 0. - * - * The next call to SDL_SetVideoMode() will set the mode fullscreen - * attribute based on the flags parameter - if SDL_FULLSCREEN is not - * set, then the display will be windowed by default where supported. - * - * This is currently only implemented in the X11 video driver. - */ -extern DECLSPEC int SDLCALL SDL_WM_ToggleFullScreen(SDL_Surface *surface); - -typedef enum { - SDL_GRAB_QUERY = -1, - SDL_GRAB_OFF = 0, - SDL_GRAB_ON = 1, - SDL_GRAB_FULLSCREEN /**< Used internally */ -} SDL_GrabMode; -/** - * This function allows you to set and query the input grab state of - * the application. It returns the new input grab state. - * - * Grabbing means that the mouse is confined to the application window, - * and nearly all keyboard input is passed directly to the application, - * and not interpreted by a window manager, if any. - */ -extern DECLSPEC SDL_GrabMode SDLCALL SDL_WM_GrabInput(SDL_GrabMode mode); - -/*@}*/ - -/** @internal Not in public API at the moment - do not use! */ -extern DECLSPEC int SDLCALL SDL_SoftStretch(SDL_Surface *src, SDL_Rect *srcrect, - SDL_Surface *dst, SDL_Rect *dstrect); - -/* Ends C function definitions when using C++ */ -#ifdef __cplusplus -} -#endif -#include "close_code.h" - -#endif /* _SDL_video_h */ diff --git a/dji_sdk_manifold_read_cam/include/sdl/begin_code.h b/dji_sdk_manifold_read_cam/include/sdl/begin_code.h deleted file mode 100644 index 27e2f7b..0000000 --- a/dji_sdk_manifold_read_cam/include/sdl/begin_code.h +++ /dev/null @@ -1,196 +0,0 @@ -/* - SDL - Simple DirectMedia Layer - Copyright (C) 1997-2012 Sam Lantinga - - This library is free software; you can redistribute it and/or - modify it under the terms of the GNU Library General Public - License as published by the Free Software Foundation; either - version 2 of the License, or (at your option) any later version. - - This library is distributed in the hope that it will be useful, - but WITHOUT ANY WARRANTY; without even the implied warranty of - MERCHANTABILITY or FITNESS FOR A PARTICULAR PURPOSE. See the GNU - Library General Public License for more details. - - You should have received a copy of the GNU Library General Public - License along with this library; if not, write to the Free - Foundation, Inc., 59 Temple Place, Suite 330, Boston, MA 02111-1307 USA - - Sam Lantinga - slouken@libsdl.org -*/ - -/** - * @file begin_code.h - * This file sets things up for C dynamic library function definitions, - * static inlined functions, and structures aligned at 4-byte alignment. - * If you don't like ugly C preprocessor code, don't look at this file. :) - */ - -/** - * @file begin_code.h - * This shouldn't be nested -- included it around code only. - */ -#ifdef _begin_code_h -#error Nested inclusion of begin_code.h -#endif -#define _begin_code_h - -/** - * @def DECLSPEC - * Some compilers use a special export keyword - */ -#ifndef DECLSPEC -# if defined(__BEOS__) || defined(__HAIKU__) -# if defined(__GNUC__) -# define DECLSPEC -# else -# define DECLSPEC __declspec(export) -# endif -# elif defined(__WIN32__) -# ifdef __BORLANDC__ -# ifdef BUILD_SDL -# define DECLSPEC -# else -# define DECLSPEC __declspec(dllimport) -# endif -# else -# define DECLSPEC __declspec(dllexport) -# endif -# elif defined(__OS2__) -# ifdef __WATCOMC__ -# ifdef BUILD_SDL -# define DECLSPEC __declspec(dllexport) -# else -# define DECLSPEC -# endif -# elif defined (__GNUC__) && __GNUC__ < 4 -# /* Added support for GCC-EMX = 4 -# define DECLSPEC __attribute__ ((visibility("default"))) -# else -# define DECLSPEC -# endif -# endif -#endif - -/** - * @def SDLCALL - * By default SDL uses the C calling convention - */ -#ifndef SDLCALL -# if defined(__WIN32__) && !defined(__GNUC__) -# define SDLCALL __cdecl -# elif defined(__OS2__) -# if defined (__GNUC__) && __GNUC__ < 4 -# /* Added support for GCC-EMX - * Based on ISO/IEC SC22/WG14 9899 Committee draft (SC22 N2794) - * - * THIS SOFTWARE IS NOT COPYRIGHTED - * - * Contributor: Danny Smith - * - * This source code is offered for use in the public domain. You may - * use, modify or distribute it freely. - * - * This code is distributed in the hope that it will be useful but - * WITHOUT ANY WARRANTY. ALL WARRANTIES, EXPRESS OR IMPLIED ARE HEREBY - * DISCLAIMED. This includes but is not limited to warranties of - * MERCHANTABILITY or FITNESS FOR A PARTICULAR PURPOSE. - * - * Date: 2000-12-02 - */ - - -#ifndef _STDINT_H -#define _STDINT_H -#define __need_wint_t -#define __need_wchar_t -#include - -//FIX---------- -#define __STDC_CONSTANT_MACROS -//------------- - -/* 7.18.1.1 Exact-width integer types */ -typedef signed char int8_t; -typedef unsigned char uint8_t; -typedef short int16_t; -typedef unsigned short uint16_t; -typedef int int32_t; -typedef unsigned uint32_t; -typedef long long int64_t; -typedef unsigned long long uint64_t; - -/* 7.18.1.2 Minimum-width integer types */ -typedef signed char int_least8_t; -typedef unsigned char uint_least8_t; -typedef short int_least16_t; -typedef unsigned short uint_least16_t; -typedef int int_least32_t; -typedef unsigned uint_least32_t; -typedef long long int_least64_t; -typedef unsigned long long uint_least64_t; - -/* 7.18.1.3 Fastest minimum-width integer types - * Not actually guaranteed to be fastest for all purposes - * Here we use the exact-width types for 8 and 16-bit ints. - */ -typedef signed char int_fast8_t; -typedef unsigned char uint_fast8_t; -typedef short int_fast16_t; -typedef unsigned short uint_fast16_t; -typedef int int_fast32_t; -typedef unsigned int uint_fast32_t; -typedef long long int_fast64_t; -typedef unsigned long long uint_fast64_t; - -/* 7.18.1.4 Integer types capable of holding object pointers */ - -#ifndef _INTPTR_T_DEFINED -#define _INTPTR_T_DEFINED -#ifdef _WIN64 - typedef __int64 intptr_t; -#else - typedef int intptr_t; -#endif -#endif - -#ifndef _UINTPTR_T_DEFINED -#define _UINTPTR_T_DEFINED -#ifdef _WIN64 - typedef unsigned __int64 uintptr_t; -#else - typedef unsigned int uintptr_t; -#endif -#endif - -/* 7.18.1.5 Greatest-width integer types */ -typedef long long intmax_t; -typedef unsigned long long uintmax_t; - -/* 7.18.2 Limits of specified-width integer types */ -#if !defined ( __cplusplus) || defined (__STDC_LIMIT_MACROS) - -/* 7.18.2.1 Limits of exact-width integer types */ -#define INT8_MIN (-128) -#define INT16_MIN (-32768) -#define INT32_MIN (-2147483647 - 1) -#define INT64_MIN (-9223372036854775807LL - 1) - -#define INT8_MAX 127 -#define INT16_MAX 32767 -#define INT32_MAX 2147483647 -#define INT64_MAX 9223372036854775807LL - -#define UINT8_MAX 0xff /* 255U */ -#define UINT16_MAX 0xffff /* 65535U */ -#define UINT32_MAX 0xffffffff /* 4294967295U */ -#define UINT64_MAX 0xffffffffffffffffULL /* 18446744073709551615ULL */ - -/* 7.18.2.2 Limits of minimum-width integer types */ -#define INT_LEAST8_MIN INT8_MIN -#define INT_LEAST16_MIN INT16_MIN -#define INT_LEAST32_MIN INT32_MIN -#define INT_LEAST64_MIN INT64_MIN - -#define INT_LEAST8_MAX INT8_MAX -#define INT_LEAST16_MAX INT16_MAX -#define INT_LEAST32_MAX INT32_MAX -#define INT_LEAST64_MAX INT64_MAX - -#define UINT_LEAST8_MAX UINT8_MAX -#define UINT_LEAST16_MAX UINT16_MAX -#define UINT_LEAST32_MAX UINT32_MAX -#define UINT_LEAST64_MAX UINT64_MAX - -/* 7.18.2.3 Limits of fastest minimum-width integer types */ -#define INT_FAST8_MIN INT8_MIN -#define INT_FAST16_MIN INT16_MIN -#define INT_FAST32_MIN INT32_MIN -#define INT_FAST64_MIN INT64_MIN - -#define INT_FAST8_MAX INT8_MAX -#define INT_FAST16_MAX INT16_MAX -#define INT_FAST32_MAX INT32_MAX -#define INT_FAST64_MAX INT64_MAX - -#define UINT_FAST8_MAX UINT8_MAX -#define UINT_FAST16_MAX UINT16_MAX -#define UINT_FAST32_MAX UINT32_MAX -#define UINT_FAST64_MAX UINT64_MAX - -/* 7.18.2.4 Limits of integer types capable of holding - object pointers */ -#ifdef _WIN64 -#define INTPTR_MIN INT64_MIN -#define INTPTR_MAX INT64_MAX -#define UINTPTR_MAX UINT64_MAX -#else -#define INTPTR_MIN INT32_MIN -#define INTPTR_MAX INT32_MAX -#define UINTPTR_MAX UINT32_MAX -#endif - -/* 7.18.2.5 Limits of greatest-width integer types */ -#define INTMAX_MIN INT64_MIN -#define INTMAX_MAX INT64_MAX -#define UINTMAX_MAX UINT64_MAX - -/* 7.18.3 Limits of other integer types */ -#define PTRDIFF_MIN INTPTR_MIN -#define PTRDIFF_MAX INTPTR_MAX - -#define SIG_ATOMIC_MIN INTPTR_MIN -#define SIG_ATOMIC_MAX INTPTR_MAX - -#define SIZE_MAX UINTPTR_MAX - -#ifndef WCHAR_MIN /* also in wchar.h */ -#define WCHAR_MIN 0 -#define WCHAR_MAX 0xffff /* UINT16_MAX */ -#endif - -/* - * wint_t is unsigned short for compatibility with MS runtime - */ -#define WINT_MIN 0 -#define WINT_MAX 0xffff /* UINT16_MAX */ - -#endif /* !defined ( __cplusplus) || defined __STDC_LIMIT_MACROS */ - - -/* 7.18.4 Macros for integer constants */ -#if !defined ( __cplusplus) || defined (__STDC_CONSTANT_MACROS) - -/* 7.18.4.1 Macros for minimum-width integer constants - - Accoding to Douglas Gwyn : - "This spec was changed in ISO/IEC 9899:1999 TC1; in ISO/IEC - 9899:1999 as initially published, the expansion was required - to be an integer constant of precisely matching type, which - is impossible to accomplish for the shorter types on most - platforms, because C99 provides no standard way to designate - an integer constant with width less than that of type int. - TC1 changed this to require just an integer constant - *expression* with *promoted* type." -*/ - -#define INT8_C(val) val -#define UINT8_C(val) val -#define INT16_C(val) val -#define UINT16_C(val) val - -#define INT32_C(val) val -#define UINT32_C(val) val##U -#define INT64_C(val) val##LL -#define UINT64_C(val) val##ULL - -/* 7.18.4.2 Macros for greatest-width integer constants */ -#define INTMAX_C(val) INT64_C(val) -#define UINTMAX_C(val) UINT64_C(val) - - -#endif /* !defined ( __cplusplus) || defined __STDC_CONSTANT_MACROS */ - -#endif diff --git a/dji_sdk_manifold_read_cam/include/usbGadget.h b/dji_sdk_manifold_read_cam/include/usbGadget.h deleted file mode 100644 index da7f4d9..0000000 --- a/dji_sdk_manifold_read_cam/include/usbGadget.h +++ /dev/null @@ -1,134 +0,0 @@ -/* Copyright (C) 2015, DJI Innovations, Inc. All rights reserved. - * - * The software is licensed under the terms of the GNU Lesser General Public License as published by - * the Free Software Foundation, either version 3 of the License, or - * (at your option) any later version. - * - * This program is distributed in the hope that it will be useful, - * but WITHOUT ANY WARRANTY; without even the implied warranty of - * MERCHANTABILITY or FITNESS FOR A PARTICULAR PURPOSE. See the - * GNU Lesser General Public License for more details. - * - * You should have received a copy of the GNU Lesser General Public License. - * If not, see . - */ - -#ifndef __GADGET_H -#define __GADGET_H - -#if HAVE_LINUX_USB_SUBDIR -#include -#else -#include -#endif -#include "./libusb-gadget/src/usb-gadget.h" - -#define OTG_VENDORID 0x0547 -#define OTG_PRODUCTID 0x1002 - -#define STRING_MANUFACTURER 25 -#define STRING_PRODUCT 45 -#define STRING_SERIAL 101 -#define STRING_LOOPBACK 250 -#define CONFIG_LOOPBACK 2 - - -static struct usb_gadget_string strings[] = { - {STRING_MANUFACTURER, "The manufacturer",}, - {STRING_PRODUCT, "The product",}, - {STRING_SERIAL, "0123456789.0123456789.0123456789",}, - {STRING_LOOPBACK, "The loopback",}, -}; - -static struct usb_gadget_strings loopback_strings = { - .language = 0x0409, /* en-us */ - .strings = strings, -}; - -static struct usb_device_descriptor loopback_device_descriptor = { - .bLength = sizeof(loopback_device_descriptor), - .bDescriptorType = USB_DT_DEVICE, - - .bcdUSB = usb_gadget_cpu_to_le16(0x0200), - .bDeviceClass = USB_CLASS_VENDOR_SPEC, - - .iManufacturer = usb_gadget_cpu_to_le16(STRING_MANUFACTURER), - .iProduct = usb_gadget_cpu_to_le16(STRING_PRODUCT), - .iSerialNumber = usb_gadget_cpu_to_le16(STRING_SERIAL), - .bNumConfigurations = 1, -}; - -static struct usb_config_descriptor loopback_config_descriptor = { - .bLength = sizeof(loopback_config_descriptor), - .bDescriptorType = USB_DT_CONFIG, - - .bNumInterfaces = 1, - .bConfigurationValue = CONFIG_LOOPBACK, - .iConfiguration = STRING_LOOPBACK, - .bmAttributes = USB_CONFIG_ATT_ONE | USB_CONFIG_ATT_SELFPOWER, - .bMaxPower = 1, /* self-powered */ -}; - -static const struct usb_interface_descriptor loopback_interface_descriptor = { - .bLength = sizeof(loopback_interface_descriptor), - .bDescriptorType = USB_DT_INTERFACE, - - .bNumEndpoints = 2, - .bInterfaceClass = USB_CLASS_VENDOR_SPEC, - .iInterface = STRING_LOOPBACK, -}; - -static struct usb_endpoint_descriptor loopback_ep_in_descriptor = { - .bLength = USB_DT_ENDPOINT_SIZE, - .bDescriptorType = USB_DT_ENDPOINT, - - .bEndpointAddress = USB_DIR_IN | 6, /* number is mandatory for gadgetfs */ - .bmAttributes = USB_ENDPOINT_XFER_BULK, - .wMaxPacketSize = usb_gadget_cpu_to_le16(64), /* mandatory for gadgetfs */ -}; - -static struct usb_endpoint_descriptor loopback_ep_out_descriptor = { - .bLength = USB_DT_ENDPOINT_SIZE, - .bDescriptorType = USB_DT_ENDPOINT, - - .bEndpointAddress = USB_DIR_OUT | 2, /* number is mandatory for gadgetfs */ - .bmAttributes = USB_ENDPOINT_XFER_BULK, - .wMaxPacketSize = usb_gadget_cpu_to_le16(64), /* mandatory for gadgetfs */ -}; - -static struct usb_endpoint_descriptor loopback_hs_ep_in_descriptor = { - .bLength = USB_DT_ENDPOINT_SIZE, - .bDescriptorType = USB_DT_ENDPOINT, - - .bEndpointAddress = USB_DIR_IN | 6, /* number is mandatory for gadgetfs */ - .bmAttributes = USB_ENDPOINT_XFER_BULK, - .wMaxPacketSize = usb_gadget_cpu_to_le16(512), /* mandatory for gadgetfs */ -}; - -static struct usb_endpoint_descriptor loopback_hs_ep_out_descriptor = { - .bLength = USB_DT_ENDPOINT_SIZE, - .bDescriptorType = USB_DT_ENDPOINT, - - .bEndpointAddress = USB_DIR_OUT | 2, /* number is mandatory for gadgetfs */ - .bmAttributes = USB_ENDPOINT_XFER_BULK, - .wMaxPacketSize = usb_gadget_cpu_to_le16(512), /* mandatory for gadgetfs */ -}; - -static struct usb_descriptor_header *loopback_config[] = { - (struct usb_descriptor_header *)&loopback_config_descriptor, - (struct usb_descriptor_header *)&loopback_interface_descriptor, - (struct usb_descriptor_header *)&loopback_ep_in_descriptor, - (struct usb_descriptor_header *)&loopback_ep_out_descriptor, - NULL, -}; - -static struct usb_descriptor_header *loopback_hs_config[] = { - (struct usb_descriptor_header *)&loopback_config_descriptor, - (struct usb_descriptor_header *)&loopback_interface_descriptor, - (struct usb_descriptor_header *)&loopback_hs_ep_in_descriptor, - (struct usb_descriptor_header *)&loopback_hs_ep_out_descriptor, - NULL, -}; - -#endif - diff --git a/dji_sdk_manifold_read_cam/include/usbHost.h b/dji_sdk_manifold_read_cam/include/usbHost.h deleted file mode 100644 index 126057c..0000000 --- a/dji_sdk_manifold_read_cam/include/usbHost.h +++ /dev/null @@ -1,32 +0,0 @@ -/* Copyright (C) 2015, DJI Innovations, Inc. All rights reserved. - * - * The software is licensed under the terms of the GNU Lesser General Public License as published by - * the Free Software Foundation, either version 3 of the License, or - * (at your option) any later version. - * - * This program is distributed in the hope that it will be useful, - * but WITHOUT ANY WARRANTY; without even the implied warranty of - * MERCHANTABILITY or FITNESS FOR A PARTICULAR PURPOSE. See the - * GNU Lesser General Public License for more details. - * - * You should have received a copy of the GNU Lesser General Public License. - * If not, see . - */ - -#ifndef __HOST_H -#define __HOST_H - -#include - -#define LB_VENDORID 0x0547 /*LIGHTBRIDGE ID--THE SAME ID of 68013*/ -#define IS_TO_DEVICE 0 /* to device */ -#define IS_TO_HOST 0x80 /* to host */ -#define IS_BULK 2 - -int usb_sync_read( unsigned char *buffer, int len , int endpoint); -int usb_sync_write(const char *buffer, int len , int endpoint); -int GetEndPoint(libusb_device *dev); -void print_devs(libusb_device **devs); -int init_usbHost(); -void ReleaseUsb(); -#endif diff --git a/dji_sdk_manifold_read_cam/package.xml b/dji_sdk_manifold_read_cam/package.xml index 72cc7ee..a87649a 100644 --- a/dji_sdk_manifold_read_cam/package.xml +++ b/dji_sdk_manifold_read_cam/package.xml @@ -2,7 +2,7 @@ dji_sdk_read_cam 0.0.0 - The read_cam package + The nv_cam package @@ -13,41 +13,20 @@ - TODO + DJI - - - - - - - - - - - - - - - - - - - - - - - catkin cv_bridge + image_transport + opencv2 roscpp - rospy sensor_msgs std_msgs cv_bridge + image_transport + opencv2 roscpp - rospy sensor_msgs std_msgs diff --git a/dji_sdk_manifold_read_cam/src/CamMain.cpp b/dji_sdk_manifold_read_cam/src/CamMain.cpp deleted file mode 100644 index c1193de..0000000 --- a/dji_sdk_manifold_read_cam/src/CamMain.cpp +++ /dev/null @@ -1,59 +0,0 @@ -#include "ros/ros.h" -#include -#include -#include -#include -#include -#include -#include -#include -#include -#include -#include -#include -#include "djiCam.h" - - -int main(int argc, char **argv) -{ - - ros::init(argc,argv,"ImageTrans"); - - ros::NodeHandle nh; - - image_transport::ImageTransport it(nh); - image_transport::Publisher pub = it.advertise("dji_sdk/image_raw", 1); - - cv_bridge::CvImage out_Image; - sensor_msgs::Image msg; - - ros::Time time=ros::Time::now(); - - IplImage * pImg = cvCreateImage(cvSize(1280, 720),IPL_DEPTH_8U,3); - - int ret = djiCam_init(); - - int nState = 1; - - while(nState && ros::ok()) - { - nState = djiCam_loop(pImg); /*DISPLAY_MODE | SAVEPICTURE_MODE | TRANSFER_MODE*/ - - time=ros::Time::now(); - out_Image.header.stamp = time; - out_Image.header.frame_id = "image"; - out_Image.encoding = "bgr8"; - out_Image.image = pImg; - out_Image.toImageMsg(msg); - pub.publish(msg); - - ros::spinOnce(); - - } - - /*Ctrl+c to break*/ - djiCam_exit(); - printf("System exit ok!\n"); - - return 0; -} diff --git a/dji_sdk_manifold_read_cam/src/djiCam.c b/dji_sdk_manifold_read_cam/src/djiCam.c deleted file mode 100644 index 690fe31..0000000 --- a/dji_sdk_manifold_read_cam/src/djiCam.c +++ /dev/null @@ -1,534 +0,0 @@ -/* Copyright (C) 2015, DJI Innovations, Inc. All rights reserved. - * - * The software is licensed under the terms of the GNU Lesser General Public License as published by - * the Free Software Foundation, either version 3 of the License, or - * (at your option) any later version. - * - * This program is distributed in the hope that it will be useful, - * but WITHOUT ANY WARRANTY; without even the implied warranty of - * MERCHANTABILITY or FITNESS FOR A PARTICULAR PURPOSE. See the - * GNU Lesser General Public License for more details. - * - * You should have received a copy of the GNU Lesser General Public License. - * If not, see . - */ - - -#include -#include -#include -#include -#include -#include -#include -#include -#include -#include -#include -#include -#include - -#include -#include -#include -#include -#include - -#include -#include -#include -#include - -#include "libusb-gadget/src/config.h" -#include "usbGadget.h" -#include "usbHost.h" -#include "djiCam.h" - - -#define __STDC_CONSTANT_MACROS -#include -#include -#include -#include - - - -#define SFM_REFRESH_EVENT (SDL_USEREVENT + 1) -#define BUFFER_SIZE 512 /*Max size of usb read/write*/ -#define BUF_NUM 64 -#define SCREEN_W 1280 /*720P*/ -#define SCREEN_H 720 -#define FRAME_SIZE SCREEN_W*SCREEN_H*3 - -#define RGB_FORMAT - - -/*Thread*/ -static SDL_Thread *video_tid; -static pthread_t vedioDisplay_thread; -static pthread_t usbRead_thread; -static pthread_t usbWrite_thread; -static pthread_t saveJPG_thread; - - -/*FFmpeg*/ -static AVCodec *g_pCodec; -static AVCodecContext *g_pContext = NULL; -static AVCodecParserContext *g_pCodecPaser = NULL; -static AVFrame *g_pFrame,*g_pFrameYUV, *g_pFrameRGB; -static struct SwsContext *g_pConvert_ctx; - -/*usb*/ -static struct usb_gadget_endpoint *g_gadget_endpoint_in, *g_gadget_endpoint_out; /*Use for usb gadget*/ -extern int g_hostGet_endpoint_out, g_hostGet_endpoint_in; /*Use for usb host*/ -IplImage * g_pImage; - -static struct SwsContext* swscontext; -static int linesize[4] = {0, 0, 0, 0}; - -static volatile int g_trigger = 0; -static int g_gotFrame = 0; -static volatile int g_ForceBreak = 0; -static volatile unsigned int g_nFrame = 0; -static volatile int g_thread_exit = 0; - -static pthread_mutex_t frame_mutex; -static pthread_mutex_t hImgMutex; -static int g_mode = 0; - -typedef struct framebuf{ - uint8_t data[BUF_NUM][FRAME_SIZE]; - volatile unsigned int nframe[BUF_NUM]; - volatile uint8_t newest[BUF_NUM]; - volatile unsigned int r; - volatile unsigned int w; -}framebuf_t; -static framebuf_t g_FrameBuf; - -typedef struct databuf{ - uint8_t buf[BUF_NUM][BUFFER_SIZE + 8]; - volatile unsigned int len[BUF_NUM]; - volatile unsigned int r; - volatile unsigned int w; -}databuf_t; -static databuf_t g_DataBuf; - -static struct usb_gadget_device device = { - .device = &loopback_device_descriptor, - .config = loopback_config, - .hs_config = loopback_hs_config, - .strings = &loopback_strings, - }; -static usb_gadget_dev_handle *handle; -static struct pollfd fds; - - - - -int av2ipl(AVFrame *src, IplImage *dst, int height, int width) -{ - - linesize[0] = dst->widthStep; - if (swscontext == 0) - return 0; - sws_scale(swscontext, src->data, src->linesize, 0, height, (uint8_t **) & (dst->imageData), linesize); - return 1; -} - - - -static int sfp_refresh_thread(void *opaque) -{ - while (0 == g_thread_exit) - { - SDL_Event event; - event.type = SFM_REFRESH_EVENT; - SDL_PushEvent(&event); - SDL_Delay(30); - } - printf("sfp_refresh_thread quit ok!\n"); - return 0; -} - - -static void loopback_stop_endpoints (void *data) -{ - usb_gadget_endpoint_close (g_gadget_endpoint_in); - usb_gadget_endpoint_close (g_gadget_endpoint_out); - g_gadget_endpoint_in = NULL; - g_gadget_endpoint_out = NULL; -} - - -/*Read data from camera*/ -static void *usbRead_loop(void *data) -{ - int w; - int ret; - static int count = 0; - int paserLength_In; - int paserLen; - uint8_t *pFrameBuff; - int i; - static int found = 0; - int read_counter = 0; - AVFrame *pFrame; - IplImage * pImg = cvCreateImage(cvSize(SCREEN_W,SCREEN_H),IPL_DEPTH_8U,3); - - printf("usbRead_loop thread start ...\n"); - pthread_cleanup_push (loopback_stop_endpoints, NULL); - sleep(1); - while(1) - { - - pthread_testcancel (); - - if(1 == g_ForceBreak) - { - printf("Force usbRead_loop thread to stop!\n"); - break; - } - w = g_DataBuf.w; - ret = usb_gadget_endpoint_read(g_gadget_endpoint_out, g_DataBuf.buf[w], BUFFER_SIZE, 100); - pthread_testcancel (); - //printf("ret = %d\n",ret); - if(ret != 37 && read_counter == 0) - { - - printf("not 37 .................................\n"); - } - read_counter++; - if(!(read_counter % 1000)) - { - printf("*Read %d\n", read_counter); - } - if (ret <= 0 || ret > BUFFER_SIZE) - { - printf("usbRead_loop:usb_gadget_endpoint_read, ret = %d\n", ret); - perror ("usbRead_loop:usb_gadget_endpoint_read:"); - continue; - } - if(found == 0) - { - for(i=0;i<=(ret-5);i++) - { - if(g_DataBuf.buf[w][i]==0x00 && g_DataBuf.buf[w][i+1]==0x00 && g_DataBuf.buf[w][i+2]==0x00 && g_DataBuf.buf[w][i+3]==0x01 && g_DataBuf.buf[w][i+4]==0x67) - { - found = 1; - printf("Found header..........\n"); - break; - } - } - if(found == 0) - continue; - } - - paserLength_In = ret; - pFrameBuff = g_DataBuf.buf[w]; - g_DataBuf.len[w] = ret; - g_DataBuf.w = (w + 1) % (BUF_NUM); - - if(!g_trigger) ++count; - if(2 == count) - { - count = 0; - g_trigger = 1; - } - - while(paserLength_In) - { - AVPacket avpkt; - av_init_packet(&avpkt); - paserLen = av_parser_parse2(g_pCodecPaser, g_pContext, &avpkt.data, &avpkt.size, pFrameBuff, paserLength_In, AV_NOPTS_VALUE, AV_NOPTS_VALUE, AV_NOPTS_VALUE); - paserLength_In -= paserLen; - pFrameBuff += paserLen; - - if(avpkt.size > 0) - { - pthread_mutex_lock(&frame_mutex); - ret = avcodec_decode_video2(g_pContext, g_pFrame, &g_gotFrame, &avpkt); - if(ret < 0) - { - printf("usbRead_loop: decode error ! \n"); - pthread_mutex_unlock(&frame_mutex); - break; - } - else if(g_gotFrame) - { - av2ipl(g_pFrame,g_pImage,SCREEN_H,SCREEN_W); - g_nFrame++; - - if(!(g_nFrame % 100)) - { - printf("*Frame %d\n", g_nFrame); - } - } - pthread_mutex_unlock(&frame_mutex); - - } - av_free_packet(&avpkt); - } - - } - pthread_cleanup_pop (1); -} - - -static void loopback_event_cb (usb_gadget_dev_handle *handle, struct usb_gadget_event *event, void *arg) -{ - - switch (event->type) - { - case USG_EVENT_ENDPOINT_ENABLE: - if (event->u.number == (loopback_ep_in_descriptor.bEndpointAddress & USB_ENDPOINT_NUMBER_MASK)) - { - g_gadget_endpoint_in = usb_gadget_endpoint (handle, event->u.number); - printf("open ep_in\n"); - } - else if (event->u.number == (loopback_ep_out_descriptor.bEndpointAddress & USB_ENDPOINT_NUMBER_MASK)) - { - g_gadget_endpoint_out = usb_gadget_endpoint (handle, event->u.number); - printf("open ep_out\n"); - if (pthread_create (&usbRead_thread, 0, usbRead_loop, NULL) != 0) - { - perror ("usbRead_thread create"); - assert(0); - } - } - - if (!g_gadget_endpoint_in || !g_gadget_endpoint_out) - return; - printf("connect\n"); - break; - - case USG_EVENT_ENDPOINT_DISABLE: - if (event->u.number == (loopback_ep_in_descriptor.bEndpointAddress & USB_ENDPOINT_NUMBER_MASK)) - g_gadget_endpoint_in = NULL; - else if (event->u.number == (loopback_ep_out_descriptor.bEndpointAddress & USB_ENDPOINT_NUMBER_MASK)) - g_gadget_endpoint_out = NULL; - break; - - case USG_EVENT_DISCONNECT: /* FALLTHROUGH */ - printf("disconnect\n"); - if (usbRead_thread) - pthread_cancel (usbRead_thread); - break; - - default: - break; - } -} - -static void decode_init() -{ - memset((void *)&g_FrameBuf,0,sizeof(g_FrameBuf)); - avcodec_register_all(); - g_pCodec = avcodec_find_decoder(AV_CODEC_ID_H264); - if (!g_pCodec) { - fprintf(stderr, "Codec not found\n"); - exit(1); - } - g_pContext = avcodec_alloc_context3(g_pCodec); - if (!g_pContext) { - fprintf(stderr, "Could not allocate video codec context\n"); - exit(1); - } - if(g_pCodec->capabilities & CODEC_CAP_TRUNCATED) - g_pContext->flags |= CODEC_FLAG_TRUNCATED; /* we do not send complete frames */ - - if (avcodec_open2(g_pContext, g_pCodec, NULL) < 0) - { /* open it */ - fprintf(stderr, "Could not open codec\n"); - exit(1); - } - g_pFrame = av_frame_alloc(); - if (!g_pFrame) { - fprintf(stderr, "Could not allocate video g_pFrame\n"); - exit(1); - } - g_pFrameYUV=av_frame_alloc(); - if (!g_pFrameYUV) { - fprintf(stderr, "Could not allocate video g_pFrameYUV\n"); - exit(1); - } - g_pFrameRGB=av_frame_alloc(); - if (!g_pFrameRGB) { - fprintf(stderr, "Could not allocate video g_pFrameRGB\n"); - exit(1); - } - g_pCodecPaser = av_parser_init(AV_CODEC_ID_H264); - if (!g_pCodecPaser) - { - fprintf(stderr, "g_pCodecPaser NULL\n"); - exit(1); - } - -} - -int djiCam_loop(IplImage* pImg) -{ - int ret; - fds.revents = 0; - ret = poll (&fds, 1, 10); - - if (ret < 0 || g_ForceBreak == 1) - { - perror ("poll error or break!\n"); - ret = system("echo disconnect > /sys/devices/platform/tegra-udc.0/udc/tegra-udc.0/soft_connect"); - if(ret < 0) - printf("system called failed! %s %d\n",__FILE__,__LINE__); - return 0; - } - - if (fds.revents & POLLIN) - usb_gadget_handle_control_event (handle); - if (g_pImage) { - pthread_mutex_lock(&hImgMutex); - //cvResize(g_pImage,pImg,0); //use this one for a lower resolution pImg - cvCopy(g_pImage, pImg, 0); - pthread_mutex_unlock(&hImgMutex); - } - - return 1; -} - -static void stopSignalHanle(int sig) -{ - printf("Stop SIGNAL! \n"); - g_ForceBreak = 1; - -} - -int djiCam_init() -{ - int ret; - int debug_level = 0; - ret = system("echo 0 > /sys/class/gpio/gpio243/value"); - if(ret < 0) - { - printf("system called failed! %s %d\n",__FILE__,__LINE__); - // return -1; - } - ret = system("echo 0 > /sys/devices/platform/tegra-otg/enable_host"); - if(ret < 0) - { - printf("system called failed! %s %d\n",__FILE__,__LINE__); - // return -1; - } - printf("disable host\n"); - ret = system("echo 1 > /sys/devices/platform/tegra-otg/enable_device"); - if(ret < 0) - { - printf("system called failed! %s %d\n",__FILE__,__LINE__); - // return -1; - } - printf("enable device\n"); - //sleep(1); - ret = system("mkdir /dev/gadget"); - if(ret < 0) - { - printf("system called failed! %s %d\n",__FILE__,__LINE__); - // return -1; - } - ret = system("mount -t gadgetfs none /dev/gadget"); - if(ret < 0) - { - printf("system called failed! %s %d\n",__FILE__,__LINE__); - // return -1; - } - printf("mount gadgetfs\n"); - - loopback_device_descriptor.idVendor = OTG_VENDORID; - loopback_device_descriptor.idProduct = OTG_PRODUCTID; - handle = usb_gadget_open (&device); - if (!handle) - { - fprintf (stderr, "Couldn't open device.\n"); - return -1; - } - - usb_gadget_set_event_cb (handle, loopback_event_cb, NULL); - usb_gadget_set_debug_level (handle, debug_level); - - usb_gadget_endpoint (handle, 0); - - - fds.fd = usb_gadget_control_fd (handle); - fds.events = POLLIN | POLLPRI; - - - ret = pthread_mutex_init(&frame_mutex, NULL); - pthread_mutex_init(&hImgMutex, NULL); - if(ret != 0) - { - perror("Mutex init failed"); - return -1; - } - - signal(SIGINT, stopSignalHanle); - decode_init(); - video_tid = SDL_CreateThread(sfp_refresh_thread,NULL); - - printf("Init is ok..........\n"); - - - ret = system("echo connect > /sys/devices/platform/tegra-udc.0/udc/tegra-udc.0/soft_connect"); - if(ret < 0) - { - printf("system called failed! %s %d\n",__FILE__,__LINE__); - } - printf("udc soft connect\n"); - - g_pImage = cvCreateImage(cvSize(SCREEN_W, SCREEN_H),IPL_DEPTH_8U,3); - swscontext = sws_getContext(SCREEN_W, SCREEN_H, PIX_FMT_YUV420P, SCREEN_W, SCREEN_H, PIX_FMT_BGR24, SWS_BILINEAR, 0, 0, 0); - - return 0; -} - -void djiCam_exit() -{ - void *result = NULL; - int ret; - - usb_gadget_close(handle); - ret = system("umount -f /dev/gadget"); - if(ret < 0) - { - printf("system called failed! %s %d\n",__FILE__,__LINE__); - } - ret = system("rm -rf /dev/gadget"); - if(ret < 0) - { - printf("system called failed! %s %d\n",__FILE__,__LINE__); - } - -#if 0 - if(usbRead_thread) - pthread_join(usbRead_thread,&result); - if(usbWrite_thread) - pthread_join(usbWrite_thread,&result); - if(vedioDisplay_thread) - pthread_join(vedioDisplay_thread,&result); - if(saveJPG_thread) - pthread_join(saveJPG_thread,&result); -#endif - system("echo disconnect > /sys/devices/platform/tegra-udc.0/udc/tegra-udc.0/soft_connect"); - usleep(200*1000); - system("echo 0 > /sys/devices/platform/tegra-otg/enable_device"); - usleep(200*1000); - system("echo 1 > /sys/devices/platform/tegra-otg/enable_host"); - usleep(200*1000); - system("echo 1 > /sys/class/gpio/gpio243/value"); - printf("The threads exit sucessfully !\n"); - usleep(200*1000); - - pthread_mutex_destroy(&frame_mutex); - pthread_mutex_destroy(&hImgMutex); - sws_freeContext(g_pConvert_ctx); - avcodec_close(g_pContext); - av_free(g_pContext); - av_frame_free(&g_pFrame); - av_frame_free(&g_pFrameYUV); - av_frame_free(&g_pFrameRGB); - -} diff --git a/dji_sdk_manifold_read_cam/src/nv_cam.cpp b/dji_sdk_manifold_read_cam/src/nv_cam.cpp new file mode 100644 index 0000000..4c09926 --- /dev/null +++ b/dji_sdk_manifold_read_cam/src/nv_cam.cpp @@ -0,0 +1,279 @@ +#include "ros/ros.h" +#include +#include +#include +#include +#include +#include +#include +#include +#include +#include +#include +#include +#include +#include +#include +#include +#include "cv.h" +#include "highgui.h" +#include "djicam.h" + +typedef unsigned char BYTE; +#define IMAGE_W 1280 +#define IMAGE_H 720 +#define FRAME_SIZE IMAGE_W*IMAGE_H*3 + +#define RGB + +unsigned char buffer[FRAME_SIZE] = {0}; +unsigned int frame_size = 0; +unsigned int nframe = 0; +FILE *fp; + + +#define mode GETBUFFER_MODE + +struct sRGB{ + int r; + int g; + int b; +}; + +sRGB yuvTorgb(int Y, int U, int V) +{ + sRGB rgb; + rgb.r = (int)(Y + 1.4075 * (V-128)); + rgb.g = (int)(Y - 0.3455 * (U-128) - 0.7169*(V-128)); + rgb.b = (int)(Y + 1.779 * (U-128)); + rgb.r =(rgb.r<0? 0: rgb.r>255? 255 : rgb.r); + rgb.g =(rgb.g<0? 0: rgb.g>255? 255 : rgb.g); + rgb.b =(rgb.b<0? 0: rgb.b>255? 255 : rgb.b); + return rgb; +} + +unsigned char * NV12ToRGB(unsigned char * src, unsigned char * rgb, int width, int height){ + int numOfPixel = width * height; + int positionOfU = numOfPixel; + int startY,step,startU,Y,U,V,index,nTmp; + sRGB tmp; + + for(int i=0; i>1) * (width_y>>1) + (x>>1); + yIndex = y * width_y + x; + + temp = (int)(puc_y[yIndex] + (puc_v[uvIndex] - 128) * 1.4022); + rData[yIndex] = temp<0 ? 0 : (temp > 255 ? 255 : temp); + + temp = (int)(puc_y[yIndex] + (puc_u[uvIndex] - 128) * (-0.3456) + + (puc_v[uvIndex] - 128) * (-0.7145)); + gData[yIndex] = temp < 0 ? 0 : (temp > 255 ? 255 : temp); + + temp = (int)(puc_y[yIndex] + (puc_u[uvIndex] - 128) * 1.771); + bData[yIndex] = temp < 0 ? 0 : (temp > 255 ? 255 : temp); + } + } + + int widthStep = width_y*3; + for (int y = 0; y < height_y; y++) + { + for (int x = 0; x < width_y; x++) + { + puc_rgb[y * widthStep + x * 3 + 2] = rData[y * width_y + x]; //R + puc_rgb[y * widthStep + x * 3 + 1] = gData[y * width_y + x]; //G + puc_rgb[y * widthStep + x * 3 + 0] = bData[y * width_y + x]; //B + } + } + + if (!puc_rgb) + { + return false; + } + delete [] rgbData; + return true; +} + +IplImage* YUV420_To_IplImage(unsigned char* pYUV420, int width, int height) +{ + if (!pYUV420) + { + return NULL; + } + + int baseSize = width*height; + int imgSize = baseSize*3; + BYTE* pRGB24 = new BYTE[imgSize]; + memset(pRGB24, 0, imgSize); + + int temp = 0; + + BYTE* yData = pYUV420; + BYTE* uData = pYUV420 + baseSize; + BYTE* vData = uData + (baseSize>>2); + + if(YUV420_To_BGR24(yData, uData, vData, pRGB24, width, height) == false || !pRGB24) + { + return NULL; + } + + IplImage *image = cvCreateImage(cvSize(width, height), 8,3); + memcpy(image->imageData, pRGB24, imgSize); + + if (!image) + { + return NULL; + } + + delete [] pRGB24; + return image; +} + +int main(int argc, char **argv) +{ + ros::init(argc,argv,"image_raw"); + int ret,nKey; + int nState = 1; + int nCount = 1; +#ifdef RGB + IplImage * pRawImg = cvCreateImage(cvSize(IMAGE_W, IMAGE_H),IPL_DEPTH_8U,3); + IplImage * pImg = cvCreateImage(cvSize(640, 480),IPL_DEPTH_8U,3); + unsigned char * pData = new unsigned char[1280 * 720 * 3]; +#else + IplImage * pRawImg = cvCreateImage(cvSize(IMAGE_W, IMAGE_H),IPL_DEPTH_8U,1); + IplImage * pImg = cvCreateImage(cvSize(640, 480),IPL_DEPTH_8U,1); +#endif + + ros::NodeHandle node; + image_transport::ImageTransport transport(node); + image_transport::Publisher image_pub = transport.advertise("dji_sdk/image_raw", 1); + ros::Publisher caminfo_pub = node.advertise("dji_sdk/camera_info",1); + + ros::Time time=ros::Time::now(); + + cv_bridge::CvImage cvi; + + + sensor_msgs::Image im; + sensor_msgs::CameraInfo cam_info; + + cam_info.header.frame_id = "/camera"; + cam_info.height = IMAGE_H/2; + cam_info.width = IMAGE_W/2; + cam_info.distortion_model = ""; + cam_info.D.push_back(-0.1297646493949856); + cam_info.D.push_back(0.0946885697670611); + cam_info.D.push_back(-0.0002935002712265514); + cam_info.D.push_back(-0.00022663675362156343); + cam_info.D.push_back(0.0); + cam_info.K = {388.40923066779754, 0.0, 318.06257844065226, 0.0, 518.1538449374815, 241.17339016626644, 0.0, 0.0, 1.0}; + cam_info.R = {1.0, 0.0, 0.0, 0.0, 1.0, 0.0, 0.0, 0.0, 1.0}; + cam_info.P = {373.5429992675781, 0.0, 317.51131336952494, 0.0, 0.0, 504.4360656738281, 240.6131009245937, 0.0, 0.0, 0.0, 1.0, 0.0}; + cam_info.binning_x = 0; + cam_info.binning_x = 0; + + cam_info.roi.x_offset = 0; + cam_info.roi.y_offset = 0; + cam_info.roi.height = 0; + cam_info.roi.width = 0; + cam_info.roi.do_rectify = false; + + ret = manifold_cam_init(mode); + if(ret == -1) + { + printf("manifold init error \n"); + return -1; + } + + while(1) + { + ret = manifold_cam_read(buffer, &nframe, 1); + + if(ret != -1) + { + +#ifdef RGB + NV12ToRGB(buffer,pData,1280,720); + memcpy(pRawImg->imageData,pData,FRAME_SIZE); +#else + memcpy(pRawImg->imageData,buffer,FRAME_SIZE/3); +#endif + cvResize(pRawImg,pImg,CV_INTER_LINEAR); + + time=ros::Time::now(); + cvi.header.stamp = time; + cvi.header.frame_id = "image"; +#ifdef RGB + cvi.encoding = "bgr8"; +#else + cvi.encoding = "mono8"; +#endif + cvi.image = pImg; + cvi.toImageMsg(im); + cam_info.header.seq = nCount; + cam_info.header.stamp = time; + caminfo_pub.publish(cam_info); + image_pub.publish(im); + + ros::spinOnce(); + nCount++; + + } + else + break; + usleep(1000); + } + while(!manifold_cam_exit()) + { + sleep(1); + } + + fclose(fp); + sleep(1); + return 0; +} diff --git a/dji_sdk_manifold_read_cam/src/usbHost.c b/dji_sdk_manifold_read_cam/src/usbHost.c deleted file mode 100644 index 128423c..0000000 --- a/dji_sdk_manifold_read_cam/src/usbHost.c +++ /dev/null @@ -1,203 +0,0 @@ -/* Copyright (C) 2015, DJI Innovations, Inc. All rights reserved. - * - * The software is licensed under the terms of the GNU Lesser General Public License as published by - * the Free Software Foundation, either version 3 of the License, or - * (at your option) any later version. - * - * This program is distributed in the hope that it will be useful, - * but WITHOUT ANY WARRANTY; without even the implied warranty of - * MERCHANTABILITY or FITNESS FOR A PARTICULAR PURPOSE. See the - * GNU Lesser General Public License for more details. - * - * You should have received a copy of the GNU Lesser General Public License. - * If not, see . - */ - -#include -#include -#include -#include -#include -#include -#include -#include "usbHost.h" - -static libusb_device_handle* g_hdev; -static libusb_device* g_dev; -int g_hostGet_endpoint_out = 0, g_hostGet_endpoint_in = 0; - -int usb_sync_read(unsigned char *buffer, int len, int endpoint) -{ - int actural_length = 0; - int ret; - if(!g_hdev) - { - printf("hdev NULL! %s %d\n",__FILE__,__LINE__); - return -1; - } - - ret = libusb_bulk_transfer(g_hdev, endpoint, (unsigned char*)buffer, len, &actural_length, 0); - if ( 0 == ret ) - return actural_length; - else - return -1; -} - -int usb_sync_write(const char *buffer, int len , int endpoint) -{ - int actural_length = 0; - int ret; - if(!g_hdev) - { - printf("hdev NULL! %s %d\n",__FILE__,__LINE__); - return -1; - } - - ret = libusb_bulk_transfer(g_hdev, endpoint, (unsigned char*)buffer, len, &actural_length, 0); - if ( 0 == ret ) - return actural_length; - else - return -1; -} - -int GetEndPoint(libusb_device *dev) -{ - struct libusb_config_descriptor *pConfig; - int interface_idx; - int ep_idx; - int altsetting_idx; - int r = libusb_get_active_config_descriptor(dev, &pConfig); - if (r < 0) - return -1; - - for (interface_idx = 0; interface_idx < pConfig->bNumInterfaces; interface_idx++) - { - const struct libusb_interface *pInterface = &pConfig->interface[interface_idx]; - - for (altsetting_idx = 0; altsetting_idx < pInterface->num_altsetting; altsetting_idx++) - { - const struct libusb_interface_descriptor *pAltsetting = &pInterface->altsetting[altsetting_idx]; - for (ep_idx = 0; ep_idx < pAltsetting->bNumEndpoints; ep_idx++) - { - const struct libusb_endpoint_descriptor *pEndpoint = &pAltsetting->endpoint[ep_idx]; - - if(IS_TO_DEVICE == ( pEndpoint->bEndpointAddress & 0x80 ) && IS_BULK == (pEndpoint->bmAttributes & 0x03)) - { - g_hostGet_endpoint_out = pEndpoint->bEndpointAddress; - printf("Usb Host get EndPoint_out:[%x]\n",g_hostGet_endpoint_out); - } - if(IS_TO_HOST == ( pEndpoint->bEndpointAddress & 0x80 ) && IS_BULK == (pEndpoint->bmAttributes & 0x03)) - { - g_hostGet_endpoint_in = pEndpoint->bEndpointAddress; - printf("Usb Host get EndPoint_in:[%x]\n",g_hostGet_endpoint_in); - } - } - } - - } - libusb_free_config_descriptor(pConfig); - return 0; -} - -void print_devs(libusb_device **devs) -{ - libusb_device *dev; - int i = 0; - - while ((dev = devs[i++]) != NULL) - { - struct libusb_device_descriptor desc; - int r = libusb_get_device_descriptor(dev, &desc); - if (r < 0) - { - fprintf(stderr, "failed to get device descriptor"); - return; - } - - printf("%04x:%04x (bus %d, device %d)\n", desc.idVendor, - desc.idProduct, - libusb_get_bus_number(dev), - libusb_get_device_address(dev)); - } -} - -int init_usbHost() -{ - bool success = 1; - int i; - - int result = libusb_init(NULL); - if(result != LIBUSB_SUCCESS) - { - printf("Failed to initialise libusb. libusb error: %d\n", result); - return 1; - } - - struct libusb_device **devs; - int ret = libusb_get_device_list(NULL, &devs); - if (ret < 0) - { - printf("libusb_get_device_list FAILED !!! \n"); - return 1; - } - else - { - printf("Found %d usb device: \n",ret); - print_devs(devs); - } - - for (i = 0; devs[i] != NULL; ++i ) - { - libusb_device *dev = devs[i]; - struct libusb_device_descriptor desc; - int r = libusb_get_device_descriptor(dev, &desc); - if (r < 0) - { - fprintf(stderr, "failed to get device descriptor"); - continue; - } - if ( LB_VENDORID == desc.idVendor ) - { - printf("Found USB device VendorID = 0x%x \n",LB_VENDORID); - r = libusb_open(dev, &g_hdev); - if (r < 0) - { - printf( "open failed,%s %d\n", __FILE__, __LINE__ ); - g_hdev = NULL; - return 1; - } - if(g_hdev == NULL) - { - printf("Could not open device VENDOR_ID = 0x%x \n",LB_VENDORID); - return 1; - } - g_dev = libusb_get_device(g_hdev); - result = libusb_claim_interface(g_hdev, 0); - if (result != LIBUSB_SUCCESS) - { - printf("Claiming libusb_claim_interface failed!\n"); - libusb_detach_kernel_driver(g_hdev, 0); - result = libusb_claim_interface(g_hdev, 0); - } - if (result != LIBUSB_SUCCESS) - { - printf("Claiming libusb_claim_interface failed!\n"); - libusb_detach_kernel_driver(g_hdev, 0); - } - result = GetEndPoint(dev); - if(result < 0) - return 1; - success = 0; - break; - } - } - libusb_free_device_list(devs, 1); - return success; -} - -void ReleaseUsb() -{ - libusb_exit(NULL); - printf( "release usb,%s %d\n", __FILE__, __LINE__ ); -} - diff --git a/dji_sdk_manifold_read_cam_nv/CATKIN_IGNORE b/dji_sdk_manifold_read_cam_nv/CATKIN_IGNORE deleted file mode 100644 index e69de29..0000000 diff --git a/dji_sdk_manifold_read_cam_nv/CMakeLists.txt b/dji_sdk_manifold_read_cam_nv/CMakeLists.txt deleted file mode 100644 index 7d944cf..0000000 --- a/dji_sdk_manifold_read_cam_nv/CMakeLists.txt +++ /dev/null @@ -1,29 +0,0 @@ -cmake_minimum_required(VERSION 2.8.3) -project(dji_sdk_read_cam_nv) - -## Find catkin macros and libraries -## if COMPONENTS list like find_package(catkin REQUIRED COMPONENTS xyz) - -## is used, also find other catkin packages -catkin_package() -find_package(catkin REQUIRED COMPONENTS - cv_bridge - image_transport - #opencv2 - roscpp - sensor_msgs - std_msgs -) - -include_directories( - include - ${catkin_INCLUDE_DIRS} -) - -add_executable(dji_sdk_read_cam_nv src/nv_cam.cpp) -link_directories(/usr/local/lib /usr/lib/arm-linux-gnueabihf /usr/lib) -target_link_libraries( - dji_sdk_read_cam_nv - dcam - ${catkin_LIBRARIES}) - diff --git a/dji_sdk_manifold_read_cam_nv/README.md b/dji_sdk_manifold_read_cam_nv/README.md deleted file mode 100644 index 2bca151..0000000 --- a/dji_sdk_manifold_read_cam_nv/README.md +++ /dev/null @@ -1,19 +0,0 @@ -##DJI Onboard SDK ROS Package for Video Decoding on Manifold - -This package is a specified video decoding package for Manifold. - -###How to use -1. Install the necessary library: refer [here](https://github.com/dji-sdk/manifold_cam) -2. Delete the `CATKIN_IGNORE` file inside package and `catkin_make`. -3. `rosrun dji_sdk_manifold_read_cam_nv dji_sdk_manifold_read_cam_nv` -4. The image will be published into topic `/dji_sdk/image_raw` - - -###Note: -1. This package is specially designed for Manifold. -2. The RC controller must be connected to Matrice 100 in order to get the video stream. -3. This package does not provice video transparent transmission. You cannot see the video on DJI Go while running this package. -4. This package uses hardware decoding method, while the other one uses FFMPEG. -5. The image format is in Grayscale, while the other one publishes RGB image. - -![image](../dji_sdk_doc/readcam.png) \ No newline at end of file diff --git a/dji_sdk_manifold_read_cam_nv/package.xml b/dji_sdk_manifold_read_cam_nv/package.xml deleted file mode 100644 index b81bc11..0000000 --- a/dji_sdk_manifold_read_cam_nv/package.xml +++ /dev/null @@ -1,39 +0,0 @@ - - - dji_sdk_read_cam_nv - 0.0.0 - The nv_cam package - - - - - dji - - - - - - DJI - - - catkin - cv_bridge - image_transport - opencv2 - roscpp - sensor_msgs - std_msgs - cv_bridge - image_transport - opencv2 - roscpp - sensor_msgs - std_msgs - - - - - - - - diff --git a/dji_sdk_manifold_read_cam_nv/src/nv_cam.cpp b/dji_sdk_manifold_read_cam_nv/src/nv_cam.cpp deleted file mode 100644 index 11a26c5..0000000 --- a/dji_sdk_manifold_read_cam_nv/src/nv_cam.cpp +++ /dev/null @@ -1,304 +0,0 @@ -#include "ros/ros.h" -#include -#include -#include -#include -#include -#include -#include -#include -#include -#include -#include -#include -#include -#include -#include -#include -#include "cv.h" -#include "highgui.h" -#include "djicam.h" - -typedef unsigned char BYTE; -#define IMAGE_W 1280 -#define IMAGE_H 720 -#define FRAME_SIZE IMAGE_W*IMAGE_H*3 - - -unsigned char buffer[FRAME_SIZE] = {0}; -unsigned int frame_size = 0; -unsigned int nframe = 0; -FILE *fp; - - -#define mode GETBUFFER_MODE - -//class RGB{ -// int r, g, b; -//}; -struct sRGB{ - int r; - int g; - int b; -}; - -sRGB yuvTorgb(int Y, int U, int V) -{ - sRGB rgb; - rgb.r = (int)(Y + 1.4075 * (V-128)); - rgb.g = (int)(Y - 0.3455 * (U-128) - 0.7169*(V-128)); - rgb.b = (int)(Y + 1.779 * (U-128)); -// rgb.r = (int)(Y + 1.14 * V); -// rgb.g = (int)(Y - 0.39*U - 0.58*V); -// rgb.b = (int)(Y + 2.03 * U); -// rgb.r = (int)((Y&0xff) + 1.4075 * ((V&0xff)-128)); -// rgb.g = (int)((Y&0xff) - 0.3455 * ((U&0xff)-128) - 0.7169*((V&0xff)-128)); -// rgb.b = (int)((Y&0xff) + 1.779 * ((U&0xff)-128)); - rgb.r =(rgb.r<0? 0: rgb.r>255? 255 : rgb.r); - rgb.g =(rgb.g<0? 0: rgb.g>255? 255 : rgb.g); - rgb.b =(rgb.b<0? 0: rgb.b>255? 255 : rgb.b); - return rgb; -} - -unsigned char * NV12ToRGB(unsigned char * src, unsigned char * rgb, int width, int height){ - int numOfPixel = width * height; - int positionOfU = numOfPixel; - int startY,step,startU,Y,U,V,index,nTmp; - sRGB tmp; - //char * rgb = new char[numOfPixel*3]; - //int rgb[numOfPixel*3]; - - for(int i=0; iRGB 的转换矩阵 - //double Yuv2Rgb[3][3] = {1, 0, 1.4022, - // 1, -0.3456, -0.7145, - // 1, 1.771, 0}; - - for(int y=0; y < height_y; y++) - { - for(int x=0; x < width_y; x++) - { - uvIndex = (y>>1) * (width_y>>1) + (x>>1); - yIndex = y * width_y + x; - - /* r分量 */ - temp = (int)(puc_y[yIndex] + (puc_v[uvIndex] - 128) * 1.4022); - rData[yIndex] = temp<0 ? 0 : (temp > 255 ? 255 : temp); - - /* g分量 */ - temp = (int)(puc_y[yIndex] + (puc_u[uvIndex] - 128) * (-0.3456) + - (puc_v[uvIndex] - 128) * (-0.7145)); - gData[yIndex] = temp < 0 ? 0 : (temp > 255 ? 255 : temp); - - /* b分量 */ - temp = (int)(puc_y[yIndex] + (puc_u[uvIndex] - 128) * 1.771); - bData[yIndex] = temp < 0 ? 0 : (temp > 255 ? 255 : temp); - } - } - - //将R,G,B三个分量赋给img_data - int widthStep = width_y*3; - for (int y = 0; y < height_y; y++) - { - for (int x = 0; x < width_y; x++) - { - puc_rgb[y * widthStep + x * 3 + 2] = rData[y * width_y + x]; //R - puc_rgb[y * widthStep + x * 3 + 1] = gData[y * width_y + x]; //G - puc_rgb[y * widthStep + x * 3 + 0] = bData[y * width_y + x]; //B - } - } - - if (!puc_rgb) - { - return false; - } - delete [] rgbData; - return true; -} - -IplImage* YUV420_To_IplImage(unsigned char* pYUV420, int width, int height) -{ - if (!pYUV420) - { - return NULL; - } - - //初始化变量 - int baseSize = width*height; - int imgSize = baseSize*3; - BYTE* pRGB24 = new BYTE[imgSize]; - memset(pRGB24, 0, imgSize); - - /* 变量声明 */ - int temp = 0; - - BYTE* yData = pYUV420; //y分量地址 - BYTE* uData = pYUV420 + baseSize; //u分量地址 - BYTE* vData = uData + (baseSize>>2); //v分量地址 - - if(YUV420_To_BGR24(yData, uData, vData, pRGB24, width, height) == false || !pRGB24) - { - return NULL; - } - - IplImage *image = cvCreateImage(cvSize(width, height), 8,3); - memcpy(image->imageData, pRGB24, imgSize); - - if (!image) - { - return NULL; - } - - delete [] pRGB24; - return image; -} - -int main(int argc, char **argv) -{ - ros::init(argc,argv,"image_raw"); - int ret,nKey; - int nState = 1; - int nCount = 1; - cvNamedWindow("Video", CV_WINDOW_AUTOSIZE); - IplImage * pRawImg = cvCreateImage(cvSize(IMAGE_W, IMAGE_H),IPL_DEPTH_8U,1); - IplImage * pImg = cvCreateImage(cvSize(640, 480),IPL_DEPTH_8U,1); - - ros::NodeHandle node; - image_transport::ImageTransport transport(node); - image_transport::Publisher image_pub = transport.advertise("dji_sdk/image_raw", 1); - ros::Publisher caminfo_pub = node.advertise("dji_sdk/camera_info",1); - - ros::Time time=ros::Time::now(); - - cv_bridge::CvImage cvi; - - - sensor_msgs::Image im; - sensor_msgs::CameraInfo cam_info; - - cam_info.header.frame_id = "/camera"; - cam_info.height = IMAGE_H/2; - cam_info.width = IMAGE_W/2; - cam_info.distortion_model = ""; -// for (int nI = 0; nI < 5; nI ++) -// cam_info.D.push_back(0.0); - cam_info.D.push_back(-0.1297646493949856); - cam_info.D.push_back(0.0946885697670611); - cam_info.D.push_back(-0.0002935002712265514); - cam_info.D.push_back(-0.00022663675362156343); - cam_info.D.push_back(0.0); - cam_info.K = {388.40923066779754, 0.0, 318.06257844065226, 0.0, 518.1538449374815, 241.17339016626644, 0.0, 0.0, 1.0}; - cam_info.R = {1.0, 0.0, 0.0, 0.0, 1.0, 0.0, 0.0, 0.0, 1.0}; - cam_info.P = {373.5429992675781, 0.0, 317.51131336952494, 0.0, 0.0, 504.4360656738281, 240.6131009245937, 0.0, 0.0, 0.0, 1.0, 0.0}; - cam_info.binning_x = 0; - cam_info.binning_x = 0; - - cam_info.roi.x_offset = 0; - cam_info.roi.y_offset = 0; - cam_info.roi.height = 0; - cam_info.roi.width = 0; - cam_info.roi.do_rectify = false; - - //fp = fopen("src.yuv", "wb"); - ret = manifold_cam_init(mode); - if(ret == -1) - { - printf("manifold init error \n"); - return -1; - } - - while(1) - { - ret = manifold_decode_start(buffer, &frame_size, &nframe); - - //printf("main ret = %d\n",ret); - if(ret == 1) - { - //printf("get buffer size = %d!\n", frame_size); - memcpy(pRawImg->imageData,buffer,FRAME_SIZE/3); - cvResize(pRawImg,pImg,CV_INTER_LINEAR); - - time=ros::Time::now(); - cvi.header.stamp = time; - cvi.header.frame_id = "image"; - cvi.encoding = "mono8"; - cvi.image = pImg; - //cvi.image = pRawImg; - cvi.toImageMsg(im); - cam_info.header.seq = nCount; - cam_info.header.stamp = time; - caminfo_pub.publish(cam_info); - image_pub.publish(im); - - - - //ROS_INFO("Converted Successfully!"); - - ros::spinOnce(); - - nCount++; - - cvShowImage("Video", pRawImg); -// cvWaitKey(1); -// printf("frame_size = %d\n",frame_size); -// printf("nframe = %d\n",nframe); -// if(nframe>30 && nframe<=100) -// fwrite(buffer,1,frame_size,fp); - - } - else if(ret == -1) - break; - usleep(1000); - } - while(!manifold_cam_exit()) - { - sleep(1); - } - - fclose(fp); - sleep(1); - return 0; -}