From afeb25a2cf9555122b6e095b13a8373c14a0d3da Mon Sep 17 00:00:00 2001 From: Tamal Saha Date: Tue, 10 Oct 2023 03:29:58 -0700 Subject: [PATCH] Update deps Signed-off-by: Tamal Saha --- Dockerfile.dbg | 2 +- Dockerfile.in | 2 +- Makefile | 2 +- cmd/capa-vpc-peering-operator/main.go | 4 +- go.mod | 18 +- go.sum | 37 +- pkg/cmds/run.go | 2 +- .../awsmanagedcontrolplane_controller.go | 2 +- .../vpcpeeringconnection_controller.go | 2 +- .../license-verifier/info/lib.go | 16 +- vendor/golang.org/x/net/html/render.go | 28 +- vendor/golang.org/x/net/html/token.go | 9 +- vendor/golang.org/x/net/http2/Dockerfile | 51 - vendor/golang.org/x/net/http2/Makefile | 3 - vendor/golang.org/x/net/http2/server.go | 17 +- vendor/golang.org/x/net/http2/transport.go | 82 +- vendor/golang.org/x/net/http2/writesched.go | 3 +- .../x/net/http2/writesched_roundrobin.go | 119 + vendor/golang.org/x/net/idna/idna9.0.0.go | 2 +- vendor/golang.org/x/net/idna/tables13.0.0.go | 2988 ++++--- vendor/golang.org/x/net/idna/tables15.0.0.go | 5145 +++++++++++ vendor/golang.org/x/net/idna/trie.go | 21 - vendor/golang.org/x/net/idna/trie12.0.0.go | 31 + vendor/golang.org/x/net/idna/trie13.0.0.go | 31 + vendor/golang.org/x/sys/cpu/cpu.go | 5 +- vendor/golang.org/x/sys/cpu/cpu_x86.go | 7 + vendor/golang.org/x/sys/cpu/endian_little.go | 4 +- vendor/golang.org/x/sys/unix/mkall.sh | 2 +- vendor/golang.org/x/sys/unix/mkerrors.sh | 11 +- vendor/golang.org/x/sys/unix/mmap_nomremap.go | 14 + vendor/golang.org/x/sys/unix/mremap.go | 53 + vendor/golang.org/x/sys/unix/syscall_aix.go | 15 - vendor/golang.org/x/sys/unix/syscall_bsd.go | 14 - .../golang.org/x/sys/unix/syscall_darwin.go | 50 +- vendor/golang.org/x/sys/unix/syscall_linux.go | 111 +- .../x/sys/unix/syscall_linux_amd64.go | 2 +- .../x/sys/unix/syscall_linux_arm64.go | 2 +- .../x/sys/unix/syscall_linux_loong64.go | 2 +- .../x/sys/unix/syscall_linux_mips64x.go | 2 +- .../x/sys/unix/syscall_linux_riscv64.go | 13 +- .../golang.org/x/sys/unix/syscall_netbsd.go | 13 +- .../golang.org/x/sys/unix/syscall_openbsd.go | 17 +- .../golang.org/x/sys/unix/syscall_solaris.go | 14 - vendor/golang.org/x/sys/unix/syscall_unix.go | 11 + .../x/sys/unix/syscall_zos_s390x.go | 14 - vendor/golang.org/x/sys/unix/zerrors_linux.go | 43 +- .../x/sys/unix/zerrors_linux_386.go | 9 + .../x/sys/unix/zerrors_linux_amd64.go | 9 + .../x/sys/unix/zerrors_linux_arm.go | 9 + .../x/sys/unix/zerrors_linux_arm64.go | 11 + .../x/sys/unix/zerrors_linux_loong64.go | 9 + .../x/sys/unix/zerrors_linux_mips.go | 9 + .../x/sys/unix/zerrors_linux_mips64.go | 9 + .../x/sys/unix/zerrors_linux_mips64le.go | 9 + .../x/sys/unix/zerrors_linux_mipsle.go | 9 + .../x/sys/unix/zerrors_linux_ppc.go | 9 + .../x/sys/unix/zerrors_linux_ppc64.go | 9 + .../x/sys/unix/zerrors_linux_ppc64le.go | 9 + .../x/sys/unix/zerrors_linux_riscv64.go | 9 + .../x/sys/unix/zerrors_linux_s390x.go | 9 + .../x/sys/unix/zerrors_linux_sparc64.go | 57 + .../golang.org/x/sys/unix/zsyscall_linux.go | 47 +- .../x/sys/unix/zsyscall_linux_riscv64.go | 16 + .../x/sys/unix/zsyscall_netbsd_386.go | 11 + .../x/sys/unix/zsyscall_netbsd_amd64.go | 11 + .../x/sys/unix/zsyscall_netbsd_arm.go | 11 + .../x/sys/unix/zsyscall_netbsd_arm64.go | 11 + .../x/sys/unix/zsyscall_openbsd_386.go | 22 + .../x/sys/unix/zsyscall_openbsd_386.s | 10 + .../x/sys/unix/zsyscall_openbsd_amd64.go | 32 +- .../x/sys/unix/zsyscall_openbsd_amd64.s | 10 + .../x/sys/unix/zsyscall_openbsd_arm.go | 22 + .../x/sys/unix/zsyscall_openbsd_arm.s | 10 + .../x/sys/unix/zsyscall_openbsd_arm64.go | 22 + .../x/sys/unix/zsyscall_openbsd_arm64.s | 10 + .../x/sys/unix/zsyscall_openbsd_mips64.go | 22 + .../x/sys/unix/zsyscall_openbsd_mips64.s | 10 + .../x/sys/unix/zsyscall_openbsd_ppc64.go | 22 + .../x/sys/unix/zsyscall_openbsd_ppc64.s | 12 + .../x/sys/unix/zsyscall_openbsd_riscv64.go | 22 + .../x/sys/unix/zsyscall_openbsd_riscv64.s | 10 + .../x/sys/unix/zsysnum_linux_riscv64.go | 2 + .../x/sys/unix/zsysnum_linux_s390x.go | 1 + vendor/golang.org/x/sys/unix/ztypes_linux.go | 101 +- .../golang.org/x/sys/unix/ztypes_linux_386.go | 2 + .../x/sys/unix/ztypes_linux_amd64.go | 2 + .../golang.org/x/sys/unix/ztypes_linux_arm.go | 2 + .../x/sys/unix/ztypes_linux_arm64.go | 2 + .../x/sys/unix/ztypes_linux_loong64.go | 2 + .../x/sys/unix/ztypes_linux_mips.go | 2 + .../x/sys/unix/ztypes_linux_mips64.go | 2 + .../x/sys/unix/ztypes_linux_mips64le.go | 2 + .../x/sys/unix/ztypes_linux_mipsle.go | 2 + .../golang.org/x/sys/unix/ztypes_linux_ppc.go | 2 + .../x/sys/unix/ztypes_linux_ppc64.go | 2 + .../x/sys/unix/ztypes_linux_ppc64le.go | 2 + .../x/sys/unix/ztypes_linux_riscv64.go | 25 + .../x/sys/unix/ztypes_linux_s390x.go | 2 + .../x/sys/unix/ztypes_linux_sparc64.go | 2 + vendor/golang.org/x/sys/windows/service.go | 4 + .../x/sys/windows/syscall_windows.go | 28 +- .../x/sys/windows/zsyscall_windows.go | 34 +- vendor/golang.org/x/term/term_unix.go | 2 +- .../text/internal/language/compact/tables.go | 356 +- .../x/text/internal/language/tables.go | 4686 +++++----- vendor/golang.org/x/text/language/match.go | 2 +- vendor/golang.org/x/text/language/tables.go | 138 +- .../x/text/unicode/bidi/tables13.0.0.go | 4 +- .../x/text/unicode/bidi/tables15.0.0.go | 2043 +++++ .../x/text/unicode/norm/tables13.0.0.go | 4 +- .../x/text/unicode/norm/tables15.0.0.go | 7908 +++++++++++++++++ vendor/golang.org/x/text/unicode/norm/trie.go | 2 +- .../golang.org/x/text/width/tables13.0.0.go | 4 +- .../golang.org/x/text/width/tables15.0.0.go | 1368 +++ .../gomodules.xyz/jsonpatch/v2/jsonpatch.go | 4 + vendor/gomodules.xyz/logs/lib.go | 9 +- vendor/modules.txt | 17 +- .../api/v1beta2/awsfargateprofile_types.go | 163 - .../api/v1beta2/awsfargateprofile_webhook.go | 153 - .../exp/api/v1beta2/awsmachinepool_types.go | 292 - .../exp/api/v1beta2/awsmachinepool_webhook.go | 165 - .../v1beta2/awsmanagedmachinepool_types.go | 273 - .../v1beta2/awsmanagedmachinepool_webhook.go | 281 - .../v2/exp/api/v1beta2/conditions_consts.go | 104 - .../v2/exp/api/v1beta2/conversion.go | 35 - .../v2/exp/api/v1beta2/doc.go | 21 - .../v2/exp/api/v1beta2/finalizers.go | 28 - .../v2/exp/api/v1beta2/groupversion_info.go | 36 - .../v2/exp/api/v1beta2/types.go | 281 - .../exp/api/v1beta2/zz_generated.deepcopy.go | 989 --- .../exp/api/v1beta2/zz_generated.defaults.go | 33 - 131 files changed, 21987 insertions(+), 7201 deletions(-) delete mode 100644 vendor/golang.org/x/net/http2/Dockerfile delete mode 100644 vendor/golang.org/x/net/http2/Makefile create mode 100644 vendor/golang.org/x/net/http2/writesched_roundrobin.go create mode 100644 vendor/golang.org/x/net/idna/tables15.0.0.go create mode 100644 vendor/golang.org/x/net/idna/trie12.0.0.go create mode 100644 vendor/golang.org/x/net/idna/trie13.0.0.go create mode 100644 vendor/golang.org/x/sys/unix/mmap_nomremap.go create mode 100644 vendor/golang.org/x/sys/unix/mremap.go create mode 100644 vendor/golang.org/x/text/unicode/bidi/tables15.0.0.go create mode 100644 vendor/golang.org/x/text/unicode/norm/tables15.0.0.go create mode 100644 vendor/golang.org/x/text/width/tables15.0.0.go delete mode 100644 vendor/sigs.k8s.io/cluster-api-provider-aws/v2/exp/api/v1beta2/awsfargateprofile_types.go delete mode 100644 vendor/sigs.k8s.io/cluster-api-provider-aws/v2/exp/api/v1beta2/awsfargateprofile_webhook.go delete mode 100644 vendor/sigs.k8s.io/cluster-api-provider-aws/v2/exp/api/v1beta2/awsmachinepool_types.go delete mode 100644 vendor/sigs.k8s.io/cluster-api-provider-aws/v2/exp/api/v1beta2/awsmachinepool_webhook.go delete mode 100644 vendor/sigs.k8s.io/cluster-api-provider-aws/v2/exp/api/v1beta2/awsmanagedmachinepool_types.go delete mode 100644 vendor/sigs.k8s.io/cluster-api-provider-aws/v2/exp/api/v1beta2/awsmanagedmachinepool_webhook.go delete mode 100644 vendor/sigs.k8s.io/cluster-api-provider-aws/v2/exp/api/v1beta2/conditions_consts.go delete mode 100644 vendor/sigs.k8s.io/cluster-api-provider-aws/v2/exp/api/v1beta2/conversion.go delete mode 100644 vendor/sigs.k8s.io/cluster-api-provider-aws/v2/exp/api/v1beta2/doc.go delete mode 100644 vendor/sigs.k8s.io/cluster-api-provider-aws/v2/exp/api/v1beta2/finalizers.go delete mode 100644 vendor/sigs.k8s.io/cluster-api-provider-aws/v2/exp/api/v1beta2/groupversion_info.go delete mode 100644 vendor/sigs.k8s.io/cluster-api-provider-aws/v2/exp/api/v1beta2/types.go delete mode 100644 vendor/sigs.k8s.io/cluster-api-provider-aws/v2/exp/api/v1beta2/zz_generated.deepcopy.go delete mode 100644 vendor/sigs.k8s.io/cluster-api-provider-aws/v2/exp/api/v1beta2/zz_generated.defaults.go diff --git a/Dockerfile.dbg b/Dockerfile.dbg index e01cd433..fb3f0cca 100644 --- a/Dockerfile.dbg +++ b/Dockerfile.dbg @@ -16,7 +16,7 @@ FROM ghcr.io/appscode/dlv:1.20.1 FROM {ARG_FROM} -LABEL org.opencontainers.image.source https://github.com/bytebuilders/capa-vpc-peering-operator +LABEL org.opencontainers.image.source https://github.com/kluster-api/capa-vpc-peering-operator RUN set -x \ && apt-get update \ diff --git a/Dockerfile.in b/Dockerfile.in index 0dc44462..3b4f0d55 100644 --- a/Dockerfile.in +++ b/Dockerfile.in @@ -14,7 +14,7 @@ FROM {ARG_FROM} -LABEL org.opencontainers.image.source https://github.com/bytebuilders/capa-vpc-peering-operator +LABEL org.opencontainers.image.source https://github.com/kluster-api/capa-vpc-peering-operator RUN set -x \ && apk add --update --upgrade --no-cache pcre2 ca-certificates tzdata \ diff --git a/Makefile b/Makefile index 16779ae3..dcace051 100644 --- a/Makefile +++ b/Makefile @@ -18,7 +18,7 @@ PRODUCT_OWNER_NAME := appscode PRODUCT_NAME := capa-vpc-peering-operator ENFORCE_LICENSE ?= -GO_PKG := go.bytebuilders.dev +GO_PKG := go.klusters.dev REPO := $(notdir $(shell pwd)) BIN := capa-vpc-peering-operator COMPRESS ?= no diff --git a/cmd/capa-vpc-peering-operator/main.go b/cmd/capa-vpc-peering-operator/main.go index 77315b41..0484a5f9 100644 --- a/cmd/capa-vpc-peering-operator/main.go +++ b/cmd/capa-vpc-peering-operator/main.go @@ -20,9 +20,9 @@ import ( "fmt" "os" - "go.bytebuilders.dev/capa-vpc-peering-operator/pkg/cmds" - _ "go.bytebuilders.dev/license-verifier/info" + "go.klusters.dev/capa-vpc-peering-operator/pkg/cmds" + _ "go.bytebuilders.dev/license-verifier/info" "gomodules.xyz/logs" _ "k8s.io/client-go/kubernetes/fake" _ "k8s.io/client-go/plugin/pkg/client/auth" diff --git a/go.mod b/go.mod index ffdf8364..f92f13b1 100644 --- a/go.mod +++ b/go.mod @@ -1,4 +1,4 @@ -module go.bytebuilders.dev/capa-vpc-peering-operator +module go.klusters.dev/capa-vpc-peering-operator go 1.18 @@ -8,8 +8,8 @@ require ( github.com/onsi/gomega v1.27.6 github.com/pkg/errors v0.9.1 github.com/spf13/cobra v1.7.0 - go.bytebuilders.dev/license-verifier v0.13.2 - gomodules.xyz/logs v0.0.6 + go.bytebuilders.dev/license-verifier v0.13.3 + gomodules.xyz/logs v0.0.7 gomodules.xyz/x v0.0.15 k8s.io/apimachinery v0.26.3 k8s.io/client-go v0.26.3 @@ -107,16 +107,16 @@ require ( go.uber.org/atomic v1.10.0 // indirect go.uber.org/multierr v1.8.0 // indirect go.uber.org/zap v1.24.0 // indirect - golang.org/x/crypto v0.9.0 // indirect - golang.org/x/net v0.10.0 // indirect + golang.org/x/crypto v0.13.0 // indirect + golang.org/x/net v0.15.0 // indirect golang.org/x/oauth2 v0.7.0 // indirect - golang.org/x/sys v0.8.0 // indirect - golang.org/x/term v0.8.0 // indirect - golang.org/x/text v0.9.0 // indirect + golang.org/x/sys v0.12.0 // indirect + golang.org/x/term v0.12.0 // indirect + golang.org/x/text v0.13.0 // indirect golang.org/x/time v0.3.0 // indirect gomodules.xyz/clock v0.0.0-20200817085942-06523dba733f // indirect gomodules.xyz/flags v0.1.3 // indirect - gomodules.xyz/jsonpatch/v2 v2.3.0 // indirect + gomodules.xyz/jsonpatch/v2 v2.4.0 // indirect gomodules.xyz/sets v0.2.1 // indirect gomodules.xyz/wait v0.2.0 // indirect google.golang.org/appengine v1.6.7 // indirect diff --git a/go.sum b/go.sum index b42c5e7a..d27cf2c8 100644 --- a/go.sum +++ b/go.sum @@ -142,9 +142,9 @@ github.com/go-gl/glfw/v3.3/glfw v0.0.0-20200222043503-6f7a984d4dc4/go.mod h1:tQ2 github.com/go-kit/kit v0.8.0/go.mod h1:xBxKIO96dXMWWy0MnWVtmwkA9/13aqxPnvrjFYMA2as= github.com/go-logfmt/logfmt v0.3.0/go.mod h1:Qt1PoO58o5twSAckw1HlFXLmHsOX5/0LbT9GBnD5lWE= github.com/go-logfmt/logfmt v0.4.0/go.mod h1:3RMwSq7FuexP4Kalkev3ejPJsZTpXXBr9+V4qmtdjCk= -github.com/go-logr/logr v0.4.0/go.mod h1:z6/tIYblkpsD+a4lm/fGIIU9mZ+XfAiaFtq7xTgseGU= github.com/go-logr/logr v1.2.0/go.mod h1:jdQByPbusPIv2/zmleS9BjJVeZ6kBagPoEUsqbVz/1A= github.com/go-logr/logr v1.2.2/go.mod h1:jdQByPbusPIv2/zmleS9BjJVeZ6kBagPoEUsqbVz/1A= +github.com/go-logr/logr v1.2.3/go.mod h1:jdQByPbusPIv2/zmleS9BjJVeZ6kBagPoEUsqbVz/1A= github.com/go-logr/logr v1.2.4 h1:g01GSCwiDw2xSZfjJ2/T9M+S6pFdcNtFYsp+Y43HYDQ= github.com/go-logr/logr v1.2.4/go.mod h1:jdQByPbusPIv2/zmleS9BjJVeZ6kBagPoEUsqbVz/1A= github.com/go-logr/zapr v1.2.3 h1:a9vnzlIBPQBBkeaR9IuMUfmVOrQlkoC4YfPoFkX3T7A= @@ -451,6 +451,7 @@ github.com/spf13/afero v1.9.3 h1:41FoI0fD7OR7mGcKE/aOiLkGreyf8ifIOQmJANWogMk= github.com/spf13/afero v1.9.3/go.mod h1:iUV7ddyEEZPO5gA3zD4fJt6iStLlL+Lg4m2cihcDf8Y= github.com/spf13/cast v1.3.0/go.mod h1:Qx5cxh0v+4UWYiBimWS+eyWzqEqokIECu5etghLkUJE= github.com/spf13/cobra v1.1.3/go.mod h1:pGADOWyqRD/YMrPZigI/zbliZ2wVD/23d+is3pSWzOo= +github.com/spf13/cobra v1.5.0/go.mod h1:dWXEIy2H428czQCjInthrTRUg7yKbok+2Qi/yBIJoUM= github.com/spf13/cobra v1.7.0 h1:hyqWnYt1ZQShIddO5kBpj3vu05/++x6tJ6dg8EC572I= github.com/spf13/cobra v1.7.0/go.mod h1:uLxZILRyS/50WlhOIKD7W6V5bgeIt+4sICxh6uRMrb0= github.com/spf13/jwalterweatherman v1.0.0/go.mod h1:cQK4TGJAtQXfYWX+Ddv3mKDzgVb68N+wFjFa4jdeBTo= @@ -509,8 +510,8 @@ github.com/zclconf/go-cty v1.10.0/go.mod h1:vVKLxnk3puL4qRAv72AO+W99LUD4da90g3uU github.com/zclconf/go-cty v1.11.0 h1:726SxLdi2SDnjY+BStqB9J1hNp4+2WlzyXLuimibIe0= github.com/zclconf/go-cty v1.11.0/go.mod h1:s9IfD1LK5ccNMSWCVFCE2rJfHiZgi7JijgeWIMfhLvA= github.com/zclconf/go-cty-debug v0.0.0-20191215020915-b22d67c1ba0b/go.mod h1:ZRKQfBXbGkpdV6QMzT3rU1kSTAnfu1dO8dPKjYprgj8= -go.bytebuilders.dev/license-verifier v0.13.2 h1:wV1ynl+GR+zKb3dh19WEzuC0uzTdiSGgVg9G78Nh4XU= -go.bytebuilders.dev/license-verifier v0.13.2/go.mod h1:PTTlWgokzoisBezn2zt+JeGkhTJZ0flvLzdhHVBy86M= +go.bytebuilders.dev/license-verifier v0.13.3 h1:/CnRn1N6qiFjdirydHVBDtOtSlCwOm8cgUi0plZNgjU= +go.bytebuilders.dev/license-verifier v0.13.3/go.mod h1:PTTlWgokzoisBezn2zt+JeGkhTJZ0flvLzdhHVBy86M= go.etcd.io/bbolt v1.3.2/go.mod h1:IbVyRI1SCnLcuJnV2u8VeU0CEYM7e686BmAb1XKL+uU= go.opencensus.io v0.21.0/go.mod h1:mSImk1erAIZhrmZN+AvHh14ztQfjbGwt4TtuofqLduU= go.opencensus.io v0.22.0/go.mod h1:+kGneAE2xo2IficOXnaByMWTGM9T73dGwxeWcUqIpI8= @@ -544,8 +545,8 @@ golang.org/x/crypto v0.0.0-20200622213623-75b288015ac9/go.mod h1:LzIPMQfyMNhhGPh golang.org/x/crypto v0.0.0-20210421170649-83a5a9bb288b/go.mod h1:T9bdIzuCu7OtxOm1hfPfRQxPLYneinmdGuTeoZ9dtd4= golang.org/x/crypto v0.0.0-20210921155107-089bfa567519/go.mod h1:GvvjBRRGRdwPK5ydBHafDWAxML/pGHZbMvKqRZ5+Abc= golang.org/x/crypto v0.0.0-20211108221036-ceb1ce70b4fa/go.mod h1:GvvjBRRGRdwPK5ydBHafDWAxML/pGHZbMvKqRZ5+Abc= -golang.org/x/crypto v0.9.0 h1:LF6fAI+IutBocDJ2OT0Q1g8plpYljMZ4+lty+dsqw3g= -golang.org/x/crypto v0.9.0/go.mod h1:yrmDGqONDYtNj3tH8X9dzUun2m2lzPa9ngI6/RUPGR0= +golang.org/x/crypto v0.13.0 h1:mvySKfSWJ+UKUii46M40LOvyWfN0s2U+46/jDd0e6Ck= +golang.org/x/crypto v0.13.0/go.mod h1:y6Z2r+Rw4iayiXXAIxJIDAJ1zMW4yaTpebo8fPOliYc= golang.org/x/exp v0.0.0-20190121172915-509febef88a4/go.mod h1:CJ0aWSM057203Lf6IL+f9T1iT9GByDxfZKAQTCR3kQA= golang.org/x/exp v0.0.0-20190306152737-a1d7652674e8/go.mod h1:CJ0aWSM057203Lf6IL+f9T1iT9GByDxfZKAQTCR3kQA= golang.org/x/exp v0.0.0-20190510132918-efd6b22b2522/go.mod h1:ZjyILWgesfNpC6sMxTJOJm9Kp84zZh5NQWvqDGG3Qr8= @@ -623,8 +624,8 @@ golang.org/x/net v0.0.0-20210405180319-a5a99cb37ef4/go.mod h1:p54w0d4576C0XHj96b golang.org/x/net v0.0.0-20210805182204-aaa1db679c0d/go.mod h1:9nx3DQGgdP8bBQD5qxJ1jj9UTztislL4KSBs9R2vV5Y= golang.org/x/net v0.0.0-20220722155237-a158d28d115b/go.mod h1:XRhObCWvk6IyKnWLug+ECip1KBveYUHfp+8e9klMJ9c= golang.org/x/net v0.1.0/go.mod h1:Cx3nUiGt4eDBEyega/BKRp+/AlGL8hYe7U9odMt2Cco= -golang.org/x/net v0.10.0 h1:X2//UzNDwYmtCLn7To6G58Wr6f5ahEAQgKNzv9Y951M= -golang.org/x/net v0.10.0/go.mod h1:0qNGK6F8kojg2nk9dLZ2mShWaEBan6FAoqfSigmmuDg= +golang.org/x/net v0.15.0 h1:ugBLEUaxABaB5AJqW9enI0ACdci2RUd4eP51NTBvuJ8= +golang.org/x/net v0.15.0/go.mod h1:idbUs1IY1+zTqbi8yxTbhexhEEk5ur9LInksu6HrEpk= golang.org/x/oauth2 v0.0.0-20180821212333-d2e6202438be/go.mod h1:N/0e6XlmueqKjAGxoOufVs8QHGRruUQn6yWY3a++T0U= golang.org/x/oauth2 v0.0.0-20190226205417-e64efc72b421/go.mod h1:gOpvHmFTYa4IltrdGE7lF6nIHvwfUNPOp7c8zoXwtLw= golang.org/x/oauth2 v0.0.0-20190604053449-0f29369cfe45/go.mod h1:gOpvHmFTYa4IltrdGE7lF6nIHvwfUNPOp7c8zoXwtLw= @@ -704,13 +705,13 @@ golang.org/x/sys v0.0.0-20220722155257-8c9f86f7a55f/go.mod h1:oPkhp1MJrh7nUepCBc golang.org/x/sys v0.0.0-20220811171246-fbc7d0a398ab/go.mod h1:oPkhp1MJrh7nUepCBck5+mAzfO9JrbApNNgaTdGDITg= golang.org/x/sys v0.0.0-20220908164124-27713097b956/go.mod h1:oPkhp1MJrh7nUepCBck5+mAzfO9JrbApNNgaTdGDITg= golang.org/x/sys v0.1.0/go.mod h1:oPkhp1MJrh7nUepCBck5+mAzfO9JrbApNNgaTdGDITg= -golang.org/x/sys v0.8.0 h1:EBmGv8NaZBZTWvrbjNoL6HVt+IVy3QDQpJs7VRIw3tU= -golang.org/x/sys v0.8.0/go.mod h1:oPkhp1MJrh7nUepCBck5+mAzfO9JrbApNNgaTdGDITg= +golang.org/x/sys v0.12.0 h1:CM0HF96J0hcLAwsHPJZjfdNzs0gftsLfgKt57wWHJ0o= +golang.org/x/sys v0.12.0/go.mod h1:oPkhp1MJrh7nUepCBck5+mAzfO9JrbApNNgaTdGDITg= golang.org/x/term v0.0.0-20201126162022-7de9c90e9dd1/go.mod h1:bj7SfCRtBDWHUb9snDiAeCFNEtKQo2Wmx5Cou7ajbmo= golang.org/x/term v0.0.0-20210927222741-03fcf44c2211/go.mod h1:jbD1KX2456YbFQfuXm/mYQcufACuNUgVhRMnK/tPxf8= golang.org/x/term v0.1.0/go.mod h1:jbD1KX2456YbFQfuXm/mYQcufACuNUgVhRMnK/tPxf8= -golang.org/x/term v0.8.0 h1:n5xxQn2i3PC0yLAbjTpNT85q/Kgzcr2gIoX9OrJUols= -golang.org/x/term v0.8.0/go.mod h1:xPskH00ivmX89bAKVGSKKtLOWNx2+17Eiy94tnKShWo= +golang.org/x/term v0.12.0 h1:/ZfYdc3zq+q02Rv9vGqTeSItdzZTSNDmfTi0mBAuidU= +golang.org/x/term v0.12.0/go.mod h1:owVbMEjm3cBLCHdkQu9b1opXd4ETQWc3BhuQGKgXgvU= golang.org/x/text v0.0.0-20170915032832-14c0d48ead0c/go.mod h1:NqM8EUOU14njkJ3fqMW+pc6Ldnwhi/IjpwHt7yyuwOQ= golang.org/x/text v0.3.0/go.mod h1:NqM8EUOU14njkJ3fqMW+pc6Ldnwhi/IjpwHt7yyuwOQ= golang.org/x/text v0.3.1-0.20180807135948-17ff2d5776d2/go.mod h1:NqM8EUOU14njkJ3fqMW+pc6Ldnwhi/IjpwHt7yyuwOQ= @@ -721,8 +722,8 @@ golang.org/x/text v0.3.5/go.mod h1:5Zoc/QRtKVWzQhOtBMvqHzDpF6irO9z98xDceosuGiQ= golang.org/x/text v0.3.6/go.mod h1:5Zoc/QRtKVWzQhOtBMvqHzDpF6irO9z98xDceosuGiQ= golang.org/x/text v0.3.7/go.mod h1:u+2+/6zg+i71rQMx5EYifcz6MCKuco9NR6JIITiCfzQ= golang.org/x/text v0.4.0/go.mod h1:mrYo+phRRbMaCq/xk9113O4dZlRixOauAjOtrjsXDZ8= -golang.org/x/text v0.9.0 h1:2sjJmO8cDvYveuX97RDLsxlyUxLl+GHoLxBiRdHllBE= -golang.org/x/text v0.9.0/go.mod h1:e1OnstbJyHTd6l/uOt8jFFHp6TRDWZR/bV3emEE/zU8= +golang.org/x/text v0.13.0 h1:ablQoSUd0tRdKxZewP80B+BaqeKJuVhuRxj/dkrun3k= +golang.org/x/text v0.13.0/go.mod h1:TvPlkZtksWOMsz7fbANvkp4WM8x/WCo/om8BMLbz+aE= golang.org/x/time v0.0.0-20181108054448-85acf8d2951c/go.mod h1:tRJNPiyCQ0inRvYxbN9jk5I+vvW/OXSQhTDSoE431IQ= golang.org/x/time v0.0.0-20190308202827-9d24e82272b4/go.mod h1:tRJNPiyCQ0inRvYxbN9jk5I+vvW/OXSQhTDSoE431IQ= golang.org/x/time v0.0.0-20191024005414-555d28b269f0/go.mod h1:tRJNPiyCQ0inRvYxbN9jk5I+vvW/OXSQhTDSoE431IQ= @@ -792,10 +793,10 @@ gomodules.xyz/clock v0.0.0-20200817085942-06523dba733f h1:hTyhR4r+tj1Uq7/PpFxLTz gomodules.xyz/clock v0.0.0-20200817085942-06523dba733f/go.mod h1:K3m7N+nBOlf91/tpv8REUGwsAgaKFwElQCuiLhm12AQ= gomodules.xyz/flags v0.1.3 h1:jQ06+EfmoMv5NvjXvJon03dOhLU+FF0TQMWN7I6qpzs= gomodules.xyz/flags v0.1.3/go.mod h1:e+kvBLnqdEWGG670SKOYag1CXStM2Slrxq01OIK3tFs= -gomodules.xyz/jsonpatch/v2 v2.3.0 h1:8NFhfS6gzxNqjLIYnZxg319wZ5Qjnx4m/CcX+Klzazc= -gomodules.xyz/jsonpatch/v2 v2.3.0/go.mod h1:AH3dM2RI6uoBZxn3LVrfvJ3E0/9dG4cSrbuBJT4moAY= -gomodules.xyz/logs v0.0.6 h1:8+9Wkud5yBPtIvkVszubyTeFxNII30lWODom0+GZD8U= -gomodules.xyz/logs v0.0.6/go.mod h1:Q+fFtZFLEB5q86KmDehXCGuMP72Rv+Rwz0KuVxK+Gi4= +gomodules.xyz/jsonpatch/v2 v2.4.0 h1:Ci3iUJyx9UeRx7CeFN8ARgGbkESwJK+KB9lLcWxY/Zw= +gomodules.xyz/jsonpatch/v2 v2.4.0/go.mod h1:AH3dM2RI6uoBZxn3LVrfvJ3E0/9dG4cSrbuBJT4moAY= +gomodules.xyz/logs v0.0.7 h1:dkhpdQuzj+pOS3S7VaOq+JV7BVU7f68/k3uDYufhPow= +gomodules.xyz/logs v0.0.7/go.mod h1:IEIZbRl9zua2jb35NU4KoqxUEDPmKvem3PhfRHqQI54= gomodules.xyz/pointer v0.1.0 h1:sG2UKrYVSo6E3r4itAjXfPfe4fuXMi0KdyTHpR3vGCg= gomodules.xyz/sets v0.2.0/go.mod h1:jKgNp01/iDs+svOWXaPk5cKP3VXy0mWUoTF/ore+aMc= gomodules.xyz/sets v0.2.1 h1:vK3oUWoGVrZKLDKO/bzEo/ucHFdCE7+DxWPeWxK72KQ= @@ -949,7 +950,7 @@ k8s.io/client-go v0.26.3 h1:k1UY+KXfkxV2ScEL3gilKcF7761xkYsSD6BC9szIu8s= k8s.io/client-go v0.26.3/go.mod h1:ZPNu9lm8/dbRIPAgteN30RSXea6vrCpFvq+MateTUuQ= k8s.io/component-base v0.26.3 h1:oC0WMK/ggcbGDTkdcqefI4wIZRYdK3JySx9/HADpV0g= k8s.io/component-base v0.26.3/go.mod h1:5kj1kZYwSC6ZstHJN7oHBqcJC6yyn41eR+Sqa/mQc8E= -k8s.io/klog/v2 v2.8.0/go.mod h1:hy9LJ/NvuK+iVyP4Ehqva4HxZG/oXyIS3n3Jmire4Ec= +k8s.io/klog/v2 v2.80.1/go.mod h1:y1WjHnz7Dj687irZUWR/WLkLc5N1YHtjLdmgWjndZn0= k8s.io/klog/v2 v2.100.1 h1:7WCHKK6K8fNhTqfBhISHQ97KrnJNFZMcQvKp7gP/tmg= k8s.io/klog/v2 v2.100.1/go.mod h1:y1WjHnz7Dj687irZUWR/WLkLc5N1YHtjLdmgWjndZn0= k8s.io/kube-openapi v0.0.0-20230109183929-3758b55a6596 h1:8cNCQs+WqqnSpZ7y0LMQPKD+RZUHU17VqLPMW3qxnxc= diff --git a/pkg/cmds/run.go b/pkg/cmds/run.go index 3ec9ca00..11e08f1c 100644 --- a/pkg/cmds/run.go +++ b/pkg/cmds/run.go @@ -19,7 +19,7 @@ package cmds import ( "os" - "go.bytebuilders.dev/capa-vpc-peering-operator/pkg/controllers" + "go.klusters.dev/capa-vpc-peering-operator/pkg/controllers" "github.com/spf13/cobra" v "gomodules.xyz/x/version" diff --git a/pkg/controllers/awsmanagedcontrolplane_controller.go b/pkg/controllers/awsmanagedcontrolplane_controller.go index 20cd7f9d..76ebf380 100644 --- a/pkg/controllers/awsmanagedcontrolplane_controller.go +++ b/pkg/controllers/awsmanagedcontrolplane_controller.go @@ -20,7 +20,7 @@ import ( "context" "errors" - "go.bytebuilders.dev/capa-vpc-peering-operator/pkg/firewall" + "go.klusters.dev/capa-vpc-peering-operator/pkg/firewall" "k8s.io/apimachinery/pkg/runtime" "k8s.io/klog/v2" diff --git a/pkg/controllers/vpcpeeringconnection_controller.go b/pkg/controllers/vpcpeeringconnection_controller.go index 21bc01e9..57338232 100644 --- a/pkg/controllers/vpcpeeringconnection_controller.go +++ b/pkg/controllers/vpcpeeringconnection_controller.go @@ -20,7 +20,7 @@ import ( "context" "fmt" - "go.bytebuilders.dev/capa-vpc-peering-operator/pkg/firewall" + "go.klusters.dev/capa-vpc-peering-operator/pkg/firewall" "github.com/pkg/errors" "k8s.io/apimachinery/pkg/runtime" diff --git a/vendor/go.bytebuilders.dev/license-verifier/info/lib.go b/vendor/go.bytebuilders.dev/license-verifier/info/lib.go index 12b50db8..ece54d83 100644 --- a/vendor/go.bytebuilders.dev/license-verifier/info/lib.go +++ b/vendor/go.bytebuilders.dev/license-verifier/info/lib.go @@ -47,8 +47,8 @@ var ( ProductName string // This has been renamed to Features ProductUID string - prodDomain = "byte.builders" - qaDomain = "appscode.ninja" + ProdDomain = "byte.builders" + QADomain = "appscode.ninja" registrationAPIPath = "api/v1/register" LicenseIssuerAPIPath = "api/v1/license/issue" @@ -123,9 +123,9 @@ func APIServerAddress(override ...string) (*url.URL, error) { } if SkipLicenseVerification() { - return url.Parse("https://api." + qaDomain) + return url.Parse("https://api." + QADomain) } - return url.Parse("https://api." + prodDomain) + return url.Parse("https://api." + ProdDomain) } func HostedEndpoint(u string) (bool, error) { @@ -142,10 +142,10 @@ func HostedEndpoint(u string) (bool, error) { } func HostedDomain(d string) bool { - return d == prodDomain || - d == qaDomain || - strings.HasSuffix(d, "."+prodDomain) || - strings.HasSuffix(d, "."+qaDomain) + return d == ProdDomain || + d == QADomain || + strings.HasSuffix(d, "."+ProdDomain) || + strings.HasSuffix(d, "."+QADomain) } func LoadLicenseCA() ([]byte, error) { diff --git a/vendor/golang.org/x/net/html/render.go b/vendor/golang.org/x/net/html/render.go index 8b280319..e8c12334 100644 --- a/vendor/golang.org/x/net/html/render.go +++ b/vendor/golang.org/x/net/html/render.go @@ -194,9 +194,8 @@ func render1(w writer, n *Node) error { } } - // Render any child nodes. - switch n.Data { - case "iframe", "noembed", "noframes", "noscript", "plaintext", "script", "style", "xmp": + // Render any child nodes + if childTextNodesAreLiteral(n) { for c := n.FirstChild; c != nil; c = c.NextSibling { if c.Type == TextNode { if _, err := w.WriteString(c.Data); err != nil { @@ -213,7 +212,7 @@ func render1(w writer, n *Node) error { // last element in the file, with no closing tag. return plaintextAbort } - default: + } else { for c := n.FirstChild; c != nil; c = c.NextSibling { if err := render1(w, c); err != nil { return err @@ -231,6 +230,27 @@ func render1(w writer, n *Node) error { return w.WriteByte('>') } +func childTextNodesAreLiteral(n *Node) bool { + // Per WHATWG HTML 13.3, if the parent of the current node is a style, + // script, xmp, iframe, noembed, noframes, or plaintext element, and the + // current node is a text node, append the value of the node's data + // literally. The specification is not explicit about it, but we only + // enforce this if we are in the HTML namespace (i.e. when the namespace is + // ""). + // NOTE: we also always include noscript elements, although the + // specification states that they should only be rendered as such if + // scripting is enabled for the node (which is not something we track). + if n.Namespace != "" { + return false + } + switch n.Data { + case "iframe", "noembed", "noframes", "noscript", "plaintext", "script", "style", "xmp": + return true + default: + return false + } +} + // writeQuoted writes s to w surrounded by quotes. Normally it will use double // quotes, but if s contains a double quote, it will use single quotes. // It is used for writing the identifiers in a doctype declaration. diff --git a/vendor/golang.org/x/net/html/token.go b/vendor/golang.org/x/net/html/token.go index 5c2a1f4e..de67f938 100644 --- a/vendor/golang.org/x/net/html/token.go +++ b/vendor/golang.org/x/net/html/token.go @@ -913,7 +913,14 @@ func (z *Tokenizer) readTagAttrKey() { case ' ', '\n', '\r', '\t', '\f', '/': z.pendingAttr[0].end = z.raw.end - 1 return - case '=', '>': + case '=': + if z.pendingAttr[0].start+1 == z.raw.end { + // WHATWG 13.2.5.32, if we see an equals sign before the attribute name + // begins, we treat it as a character in the attribute name and continue. + continue + } + fallthrough + case '>': z.raw.end-- z.pendingAttr[0].end = z.raw.end return diff --git a/vendor/golang.org/x/net/http2/Dockerfile b/vendor/golang.org/x/net/http2/Dockerfile deleted file mode 100644 index 85122459..00000000 --- a/vendor/golang.org/x/net/http2/Dockerfile +++ /dev/null @@ -1,51 +0,0 @@ -# -# This Dockerfile builds a recent curl with HTTP/2 client support, using -# a recent nghttp2 build. -# -# See the Makefile for how to tag it. If Docker and that image is found, the -# Go tests use this curl binary for integration tests. -# - -FROM ubuntu:trusty - -RUN apt-get update && \ - apt-get upgrade -y && \ - apt-get install -y git-core build-essential wget - -RUN apt-get install -y --no-install-recommends \ - autotools-dev libtool pkg-config zlib1g-dev \ - libcunit1-dev libssl-dev libxml2-dev libevent-dev \ - automake autoconf - -# The list of packages nghttp2 recommends for h2load: -RUN apt-get install -y --no-install-recommends make binutils \ - autoconf automake autotools-dev \ - libtool pkg-config zlib1g-dev libcunit1-dev libssl-dev libxml2-dev \ - libev-dev libevent-dev libjansson-dev libjemalloc-dev \ - cython python3.4-dev python-setuptools - -# Note: setting NGHTTP2_VER before the git clone, so an old git clone isn't cached: -ENV NGHTTP2_VER 895da9a -RUN cd /root && git clone https://github.com/tatsuhiro-t/nghttp2.git - -WORKDIR /root/nghttp2 -RUN git reset --hard $NGHTTP2_VER -RUN autoreconf -i -RUN automake -RUN autoconf -RUN ./configure -RUN make -RUN make install - -WORKDIR /root -RUN wget https://curl.se/download/curl-7.45.0.tar.gz -RUN tar -zxvf curl-7.45.0.tar.gz -WORKDIR /root/curl-7.45.0 -RUN ./configure --with-ssl --with-nghttp2=/usr/local -RUN make -RUN make install -RUN ldconfig - -CMD ["-h"] -ENTRYPOINT ["/usr/local/bin/curl"] - diff --git a/vendor/golang.org/x/net/http2/Makefile b/vendor/golang.org/x/net/http2/Makefile deleted file mode 100644 index 55fd826f..00000000 --- a/vendor/golang.org/x/net/http2/Makefile +++ /dev/null @@ -1,3 +0,0 @@ -curlimage: - docker build -t gohttp2/curl . - diff --git a/vendor/golang.org/x/net/http2/server.go b/vendor/golang.org/x/net/http2/server.go index cd057f39..6d5e0088 100644 --- a/vendor/golang.org/x/net/http2/server.go +++ b/vendor/golang.org/x/net/http2/server.go @@ -441,7 +441,7 @@ func (s *Server) ServeConn(c net.Conn, opts *ServeConnOpts) { if s.NewWriteScheduler != nil { sc.writeSched = s.NewWriteScheduler() } else { - sc.writeSched = NewPriorityWriteScheduler(nil) + sc.writeSched = newRoundRobinWriteScheduler() } // These start at the RFC-specified defaults. If there is a higher @@ -1012,14 +1012,6 @@ func (sc *serverConn) serve() { } } -func (sc *serverConn) awaitGracefulShutdown(sharedCh <-chan struct{}, privateCh chan struct{}) { - select { - case <-sc.doneServing: - case <-sharedCh: - close(privateCh) - } -} - type serverMessage int // Message values sent to serveMsgCh. @@ -2429,7 +2421,7 @@ type requestBody struct { conn *serverConn closeOnce sync.Once // for use by Close only sawEOF bool // for use by Read only - pipe *pipe // non-nil if we have a HTTP entity message body + pipe *pipe // non-nil if we have an HTTP entity message body needsContinue bool // need to send a 100-continue } @@ -2569,7 +2561,8 @@ func (rws *responseWriterState) writeChunk(p []byte) (n int, err error) { clen = "" } } - if clen == "" && rws.handlerDone && bodyAllowedForStatus(rws.status) && (len(p) > 0 || !isHeadResp) { + _, hasContentLength := rws.snapHeader["Content-Length"] + if !hasContentLength && clen == "" && rws.handlerDone && bodyAllowedForStatus(rws.status) && (len(p) > 0 || !isHeadResp) { clen = strconv.Itoa(len(p)) } _, hasContentType := rws.snapHeader["Content-Type"] @@ -2774,7 +2767,7 @@ func (w *responseWriter) FlushError() error { err = rws.bw.Flush() } else { // The bufio.Writer won't call chunkWriter.Write - // (writeChunk with zero bytes, so we have to do it + // (writeChunk with zero bytes), so we have to do it // ourselves to force the HTTP response header and/or // final DATA frame (with END_STREAM) to be sent. _, err = chunkWriter{rws}.Write(nil) diff --git a/vendor/golang.org/x/net/http2/transport.go b/vendor/golang.org/x/net/http2/transport.go index ac90a263..4515b22c 100644 --- a/vendor/golang.org/x/net/http2/transport.go +++ b/vendor/golang.org/x/net/http2/transport.go @@ -19,6 +19,7 @@ import ( "io/fs" "log" "math" + "math/bits" mathrand "math/rand" "net" "net/http" @@ -290,8 +291,7 @@ func (t *Transport) initConnPool() { // HTTP/2 server. type ClientConn struct { t *Transport - tconn net.Conn // usually *tls.Conn, except specialized impls - tconnClosed bool + tconn net.Conn // usually *tls.Conn, except specialized impls tlsState *tls.ConnectionState // nil only for specialized impls reused uint32 // whether conn is being reused; atomic singleUse bool // whether being used for a single http.Request @@ -518,11 +518,14 @@ func (t *Transport) RoundTrip(req *http.Request) (*http.Response, error) { func authorityAddr(scheme string, authority string) (addr string) { host, port, err := net.SplitHostPort(authority) if err != nil { // authority didn't have a port + host = authority + port = "" + } + if port == "" { // authority's port was empty port = "443" if scheme == "http" { port = "80" } - host = authority } if a, err := idna.ToASCII(host); err == nil { host = a @@ -1268,21 +1271,23 @@ func (cc *ClientConn) RoundTrip(req *http.Request) (*http.Response, error) { cancelRequest := func(cs *clientStream, err error) error { cs.cc.mu.Lock() - defer cs.cc.mu.Unlock() - cs.abortStreamLocked(err) - if cs.ID != 0 { - // This request may have failed because of a problem with the connection, - // or for some unrelated reason. (For example, the user might have canceled - // the request without waiting for a response.) Mark the connection as - // not reusable, since trying to reuse a dead connection is worse than - // unnecessarily creating a new one. - // - // If cs.ID is 0, then the request was never allocated a stream ID and - // whatever went wrong was unrelated to the connection. We might have - // timed out waiting for a stream slot when StrictMaxConcurrentStreams - // is set, for example, in which case retrying on a different connection - // will not help. - cs.cc.doNotReuse = true + bodyClosed := cs.reqBodyClosed + cs.cc.mu.Unlock() + // Wait for the request body to be closed. + // + // If nothing closed the body before now, abortStreamLocked + // will have started a goroutine to close it. + // + // Closing the body before returning avoids a race condition + // with net/http checking its readTrackingBody to see if the + // body was read from or closed. See golang/go#60041. + // + // The body is closed in a separate goroutine without the + // connection mutex held, but dropping the mutex before waiting + // will keep us from holding it indefinitely if the body + // close is slow for some reason. + if bodyClosed != nil { + <-bodyClosed } return err } @@ -1301,11 +1306,14 @@ func (cc *ClientConn) RoundTrip(req *http.Request) (*http.Response, error) { return handleResponseHeaders() default: waitDone() - return nil, cancelRequest(cs, cs.abortErr) + return nil, cs.abortErr } case <-ctx.Done(): - return nil, cancelRequest(cs, ctx.Err()) + err := ctx.Err() + cs.abortStream(err) + return nil, cancelRequest(cs, err) case <-cs.reqCancel: + cs.abortStream(errRequestCanceled) return nil, cancelRequest(cs, errRequestCanceled) } } @@ -1672,7 +1680,27 @@ func (cs *clientStream) frameScratchBufferLen(maxFrameSize int) int { return int(n) // doesn't truncate; max is 512K } -var bufPool sync.Pool // of *[]byte +// Seven bufPools manage different frame sizes. This helps to avoid scenarios where long-running +// streaming requests using small frame sizes occupy large buffers initially allocated for prior +// requests needing big buffers. The size ranges are as follows: +// {0 KB, 16 KB], {16 KB, 32 KB], {32 KB, 64 KB], {64 KB, 128 KB], {128 KB, 256 KB], +// {256 KB, 512 KB], {512 KB, infinity} +// In practice, the maximum scratch buffer size should not exceed 512 KB due to +// frameScratchBufferLen(maxFrameSize), thus the "infinity pool" should never be used. +// It exists mainly as a safety measure, for potential future increases in max buffer size. +var bufPools [7]sync.Pool // of *[]byte +func bufPoolIndex(size int) int { + if size <= 16384 { + return 0 + } + size -= 1 + bits := bits.Len(uint(size)) + index := bits - 14 + if index >= len(bufPools) { + return len(bufPools) - 1 + } + return index +} func (cs *clientStream) writeRequestBody(req *http.Request) (err error) { cc := cs.cc @@ -1690,12 +1718,13 @@ func (cs *clientStream) writeRequestBody(req *http.Request) (err error) { // Scratch buffer for reading into & writing from. scratchLen := cs.frameScratchBufferLen(maxFrameSize) var buf []byte - if bp, ok := bufPool.Get().(*[]byte); ok && len(*bp) >= scratchLen { - defer bufPool.Put(bp) + index := bufPoolIndex(scratchLen) + if bp, ok := bufPools[index].Get().(*[]byte); ok && len(*bp) >= scratchLen { + defer bufPools[index].Put(bp) buf = *bp } else { buf = make([]byte, scratchLen) - defer bufPool.Put(&buf) + defer bufPools[index].Put(&buf) } var sawEOF bool @@ -1863,6 +1892,9 @@ func (cc *ClientConn) encodeHeaders(req *http.Request, addGzipHeader bool, trail if err != nil { return nil, err } + if !httpguts.ValidHostHeader(host) { + return nil, errors.New("http2: invalid Host header") + } var path string if req.Method != "CONNECT" { @@ -1899,7 +1931,7 @@ func (cc *ClientConn) encodeHeaders(req *http.Request, addGzipHeader bool, trail // 8.1.2.3 Request Pseudo-Header Fields // The :path pseudo-header field includes the path and query parts of the // target URI (the path-absolute production and optionally a '?' character - // followed by the query production (see Sections 3.3 and 3.4 of + // followed by the query production, see Sections 3.3 and 3.4 of // [RFC3986]). f(":authority", host) m := req.Method diff --git a/vendor/golang.org/x/net/http2/writesched.go b/vendor/golang.org/x/net/http2/writesched.go index c7cd0017..cc893adc 100644 --- a/vendor/golang.org/x/net/http2/writesched.go +++ b/vendor/golang.org/x/net/http2/writesched.go @@ -184,7 +184,8 @@ func (wr *FrameWriteRequest) replyToWriter(err error) { // writeQueue is used by implementations of WriteScheduler. type writeQueue struct { - s []FrameWriteRequest + s []FrameWriteRequest + prev, next *writeQueue } func (q *writeQueue) empty() bool { return len(q.s) == 0 } diff --git a/vendor/golang.org/x/net/http2/writesched_roundrobin.go b/vendor/golang.org/x/net/http2/writesched_roundrobin.go new file mode 100644 index 00000000..54fe8632 --- /dev/null +++ b/vendor/golang.org/x/net/http2/writesched_roundrobin.go @@ -0,0 +1,119 @@ +// Copyright 2023 The Go Authors. All rights reserved. +// Use of this source code is governed by a BSD-style +// license that can be found in the LICENSE file. + +package http2 + +import ( + "fmt" + "math" +) + +type roundRobinWriteScheduler struct { + // control contains control frames (SETTINGS, PING, etc.). + control writeQueue + + // streams maps stream ID to a queue. + streams map[uint32]*writeQueue + + // stream queues are stored in a circular linked list. + // head is the next stream to write, or nil if there are no streams open. + head *writeQueue + + // pool of empty queues for reuse. + queuePool writeQueuePool +} + +// newRoundRobinWriteScheduler constructs a new write scheduler. +// The round robin scheduler priorizes control frames +// like SETTINGS and PING over DATA frames. +// When there are no control frames to send, it performs a round-robin +// selection from the ready streams. +func newRoundRobinWriteScheduler() WriteScheduler { + ws := &roundRobinWriteScheduler{ + streams: make(map[uint32]*writeQueue), + } + return ws +} + +func (ws *roundRobinWriteScheduler) OpenStream(streamID uint32, options OpenStreamOptions) { + if ws.streams[streamID] != nil { + panic(fmt.Errorf("stream %d already opened", streamID)) + } + q := ws.queuePool.get() + ws.streams[streamID] = q + if ws.head == nil { + ws.head = q + q.next = q + q.prev = q + } else { + // Queues are stored in a ring. + // Insert the new stream before ws.head, putting it at the end of the list. + q.prev = ws.head.prev + q.next = ws.head + q.prev.next = q + q.next.prev = q + } +} + +func (ws *roundRobinWriteScheduler) CloseStream(streamID uint32) { + q := ws.streams[streamID] + if q == nil { + return + } + if q.next == q { + // This was the only open stream. + ws.head = nil + } else { + q.prev.next = q.next + q.next.prev = q.prev + if ws.head == q { + ws.head = q.next + } + } + delete(ws.streams, streamID) + ws.queuePool.put(q) +} + +func (ws *roundRobinWriteScheduler) AdjustStream(streamID uint32, priority PriorityParam) {} + +func (ws *roundRobinWriteScheduler) Push(wr FrameWriteRequest) { + if wr.isControl() { + ws.control.push(wr) + return + } + q := ws.streams[wr.StreamID()] + if q == nil { + // This is a closed stream. + // wr should not be a HEADERS or DATA frame. + // We push the request onto the control queue. + if wr.DataSize() > 0 { + panic("add DATA on non-open stream") + } + ws.control.push(wr) + return + } + q.push(wr) +} + +func (ws *roundRobinWriteScheduler) Pop() (FrameWriteRequest, bool) { + // Control and RST_STREAM frames first. + if !ws.control.empty() { + return ws.control.shift(), true + } + if ws.head == nil { + return FrameWriteRequest{}, false + } + q := ws.head + for { + if wr, ok := q.consume(math.MaxInt32); ok { + ws.head = q.next + return wr, true + } + q = q.next + if q == ws.head { + break + } + } + return FrameWriteRequest{}, false +} diff --git a/vendor/golang.org/x/net/idna/idna9.0.0.go b/vendor/golang.org/x/net/idna/idna9.0.0.go index aae6aac8..ee1698ce 100644 --- a/vendor/golang.org/x/net/idna/idna9.0.0.go +++ b/vendor/golang.org/x/net/idna/idna9.0.0.go @@ -121,7 +121,7 @@ func CheckJoiners(enable bool) Option { } } -// StrictDomainName limits the set of permissable ASCII characters to those +// StrictDomainName limits the set of permissible ASCII characters to those // allowed in domain names as defined in RFC 1034 (A-Z, a-z, 0-9 and the // hyphen). This is set by default for MapForLookup and ValidateForRegistration, // but is only useful if ValidateLabels is set. diff --git a/vendor/golang.org/x/net/idna/tables13.0.0.go b/vendor/golang.org/x/net/idna/tables13.0.0.go index 390c5e56..66701ead 100644 --- a/vendor/golang.org/x/net/idna/tables13.0.0.go +++ b/vendor/golang.org/x/net/idna/tables13.0.0.go @@ -1,151 +1,294 @@ // Code generated by running "go generate" in golang.org/x/text. DO NOT EDIT. -//go:build go1.16 -// +build go1.16 +//go:build go1.16 && !go1.21 +// +build go1.16,!go1.21 package idna // UnicodeVersion is the Unicode version from which the tables in this package are derived. const UnicodeVersion = "13.0.0" -var mappings string = "" + // Size: 8188 bytes - "\x00\x01 \x03 ̈\x01a\x03 ̄\x012\x013\x03 ́\x03 ̧\x011\x01o\x051⁄4\x051⁄2" + - "\x053⁄4\x03i̇\x03l·\x03ʼn\x01s\x03dž\x03ⱥ\x03ⱦ\x01h\x01j\x01r\x01w\x01y" + - "\x03 ̆\x03 ̇\x03 ̊\x03 ̨\x03 ̃\x03 ̋\x01l\x01x\x04̈́\x03 ι\x01;\x05 ̈́" + - "\x04եւ\x04اٴ\x04وٴ\x04ۇٴ\x04يٴ\x06क़\x06ख़\x06ग़\x06ज़\x06ड़\x06ढ़\x06फ़" + - "\x06य़\x06ড়\x06ঢ়\x06য়\x06ਲ਼\x06ਸ਼\x06ਖ਼\x06ਗ਼\x06ਜ਼\x06ਫ਼\x06ଡ଼\x06ଢ଼" + - "\x06ํา\x06ໍາ\x06ຫນ\x06ຫມ\x06གྷ\x06ཌྷ\x06དྷ\x06བྷ\x06ཛྷ\x06ཀྵ\x06ཱི\x06ཱུ" + - "\x06ྲྀ\x09ྲཱྀ\x06ླྀ\x09ླཱྀ\x06ཱྀ\x06ྒྷ\x06ྜྷ\x06ྡྷ\x06ྦྷ\x06ྫྷ\x06ྐྵ\x02" + - "в\x02д\x02о\x02с\x02т\x02ъ\x02ѣ\x02æ\x01b\x01d\x01e\x02ǝ\x01g\x01i\x01k" + - "\x01m\x01n\x02ȣ\x01p\x01t\x01u\x02ɐ\x02ɑ\x02ə\x02ɛ\x02ɜ\x02ŋ\x02ɔ\x02ɯ" + - "\x01v\x02β\x02γ\x02δ\x02φ\x02χ\x02ρ\x02н\x02ɒ\x01c\x02ɕ\x02ð\x01f\x02ɟ" + - "\x02ɡ\x02ɥ\x02ɨ\x02ɩ\x02ɪ\x02ʝ\x02ɭ\x02ʟ\x02ɱ\x02ɰ\x02ɲ\x02ɳ\x02ɴ\x02ɵ" + - "\x02ɸ\x02ʂ\x02ʃ\x02ƫ\x02ʉ\x02ʊ\x02ʋ\x02ʌ\x01z\x02ʐ\x02ʑ\x02ʒ\x02θ\x02ss" + - "\x02ά\x02έ\x02ή\x02ί\x02ό\x02ύ\x02ώ\x05ἀι\x05ἁι\x05ἂι\x05ἃι\x05ἄι\x05ἅι" + - "\x05ἆι\x05ἇι\x05ἠι\x05ἡι\x05ἢι\x05ἣι\x05ἤι\x05ἥι\x05ἦι\x05ἧι\x05ὠι\x05ὡι" + - "\x05ὢι\x05ὣι\x05ὤι\x05ὥι\x05ὦι\x05ὧι\x05ὰι\x04αι\x04άι\x05ᾶι\x02ι\x05 ̈͂" + - "\x05ὴι\x04ηι\x04ήι\x05ῆι\x05 ̓̀\x05 ̓́\x05 ̓͂\x02ΐ\x05 ̔̀\x05 ̔́\x05 ̔͂" + - "\x02ΰ\x05 ̈̀\x01`\x05ὼι\x04ωι\x04ώι\x05ῶι\x06′′\x09′′′\x06‵‵\x09‵‵‵\x02!" + - "!\x02??\x02?!\x02!?\x0c′′′′\x010\x014\x015\x016\x017\x018\x019\x01+\x01=" + - "\x01(\x01)\x02rs\x02ħ\x02no\x01q\x02sm\x02tm\x02ω\x02å\x02א\x02ב\x02ג" + - "\x02ד\x02π\x051⁄7\x051⁄9\x061⁄10\x051⁄3\x052⁄3\x051⁄5\x052⁄5\x053⁄5\x054" + - "⁄5\x051⁄6\x055⁄6\x051⁄8\x053⁄8\x055⁄8\x057⁄8\x041⁄\x02ii\x02iv\x02vi" + - "\x04viii\x02ix\x02xi\x050⁄3\x06∫∫\x09∫∫∫\x06∮∮\x09∮∮∮\x0210\x0211\x0212" + - "\x0213\x0214\x0215\x0216\x0217\x0218\x0219\x0220\x04(10)\x04(11)\x04(12)" + - "\x04(13)\x04(14)\x04(15)\x04(16)\x04(17)\x04(18)\x04(19)\x04(20)\x0c∫∫∫∫" + - "\x02==\x05⫝̸\x02ɫ\x02ɽ\x02ȿ\x02ɀ\x01.\x04 ゙\x04 ゚\x06より\x06コト\x05(ᄀ)\x05" + - "(ᄂ)\x05(ᄃ)\x05(ᄅ)\x05(ᄆ)\x05(ᄇ)\x05(ᄉ)\x05(ᄋ)\x05(ᄌ)\x05(ᄎ)\x05(ᄏ)\x05(ᄐ" + - ")\x05(ᄑ)\x05(ᄒ)\x05(가)\x05(나)\x05(다)\x05(라)\x05(마)\x05(바)\x05(사)\x05(아)" + - "\x05(자)\x05(차)\x05(카)\x05(타)\x05(파)\x05(하)\x05(주)\x08(오전)\x08(오후)\x05(一)" + - "\x05(二)\x05(三)\x05(四)\x05(五)\x05(六)\x05(七)\x05(八)\x05(九)\x05(十)\x05(月)" + - "\x05(火)\x05(水)\x05(木)\x05(金)\x05(土)\x05(日)\x05(株)\x05(有)\x05(社)\x05(名)" + - "\x05(特)\x05(財)\x05(祝)\x05(労)\x05(代)\x05(呼)\x05(学)\x05(監)\x05(企)\x05(資)" + - "\x05(協)\x05(祭)\x05(休)\x05(自)\x05(至)\x0221\x0222\x0223\x0224\x0225\x0226" + - "\x0227\x0228\x0229\x0230\x0231\x0232\x0233\x0234\x0235\x06참고\x06주의\x0236" + - "\x0237\x0238\x0239\x0240\x0241\x0242\x0243\x0244\x0245\x0246\x0247\x0248" + - "\x0249\x0250\x041月\x042月\x043月\x044月\x045月\x046月\x047月\x048月\x049月\x0510" + - "月\x0511月\x0512月\x02hg\x02ev\x06令和\x0cアパート\x0cアルファ\x0cアンペア\x09アール\x0cイニ" + - "ング\x09インチ\x09ウォン\x0fエスクード\x0cエーカー\x09オンス\x09オーム\x09カイリ\x0cカラット\x0cカロリー" + - "\x09ガロン\x09ガンマ\x06ギガ\x09ギニー\x0cキュリー\x0cギルダー\x06キロ\x0fキログラム\x12キロメートル\x0f" + - "キロワット\x09グラム\x0fグラムトン\x0fクルゼイロ\x0cクローネ\x09ケース\x09コルナ\x09コーポ\x0cサイクル" + - "\x0fサンチーム\x0cシリング\x09センチ\x09セント\x09ダース\x06デシ\x06ドル\x06トン\x06ナノ\x09ノット" + - "\x09ハイツ\x0fパーセント\x09パーツ\x0cバーレル\x0fピアストル\x09ピクル\x06ピコ\x06ビル\x0fファラッド\x0c" + - "フィート\x0fブッシェル\x09フラン\x0fヘクタール\x06ペソ\x09ペニヒ\x09ヘルツ\x09ペンス\x09ページ\x09ベータ" + - "\x0cポイント\x09ボルト\x06ホン\x09ポンド\x09ホール\x09ホーン\x0cマイクロ\x09マイル\x09マッハ\x09マルク" + - "\x0fマンション\x0cミクロン\x06ミリ\x0fミリバール\x06メガ\x0cメガトン\x0cメートル\x09ヤード\x09ヤール\x09" + - "ユアン\x0cリットル\x06リラ\x09ルピー\x0cルーブル\x06レム\x0fレントゲン\x09ワット\x040点\x041点\x04" + - "2点\x043点\x044点\x045点\x046点\x047点\x048点\x049点\x0510点\x0511点\x0512点\x0513点" + - "\x0514点\x0515点\x0516点\x0517点\x0518点\x0519点\x0520点\x0521点\x0522点\x0523点" + - "\x0524点\x02da\x02au\x02ov\x02pc\x02dm\x02iu\x06平成\x06昭和\x06大正\x06明治\x0c株" + - "式会社\x02pa\x02na\x02ma\x02ka\x02kb\x02mb\x02gb\x04kcal\x02pf\x02nf\x02m" + - "g\x02kg\x02hz\x02ml\x02dl\x02kl\x02fm\x02nm\x02mm\x02cm\x02km\x02m2\x02m" + - "3\x05m∕s\x06m∕s2\x07rad∕s\x08rad∕s2\x02ps\x02ns\x02ms\x02pv\x02nv\x02mv" + - "\x02kv\x02pw\x02nw\x02mw\x02kw\x02bq\x02cc\x02cd\x06c∕kg\x02db\x02gy\x02" + - "ha\x02hp\x02in\x02kk\x02kt\x02lm\x02ln\x02lx\x02ph\x02pr\x02sr\x02sv\x02" + - "wb\x05v∕m\x05a∕m\x041日\x042日\x043日\x044日\x045日\x046日\x047日\x048日\x049日" + - "\x0510日\x0511日\x0512日\x0513日\x0514日\x0515日\x0516日\x0517日\x0518日\x0519日" + - "\x0520日\x0521日\x0522日\x0523日\x0524日\x0525日\x0526日\x0527日\x0528日\x0529日" + - "\x0530日\x0531日\x02ь\x02ɦ\x02ɬ\x02ʞ\x02ʇ\x02œ\x02ʍ\x04𤋮\x04𢡊\x04𢡄\x04𣏕" + - "\x04𥉉\x04𥳐\x04𧻓\x02ff\x02fi\x02fl\x02st\x04մն\x04մե\x04մի\x04վն\x04մխ" + - "\x04יִ\x04ײַ\x02ע\x02ה\x02כ\x02ל\x02ם\x02ר\x02ת\x04שׁ\x04שׂ\x06שּׁ\x06שּ" + - "ׂ\x04אַ\x04אָ\x04אּ\x04בּ\x04גּ\x04דּ\x04הּ\x04וּ\x04זּ\x04טּ\x04יּ\x04" + - "ךּ\x04כּ\x04לּ\x04מּ\x04נּ\x04סּ\x04ףּ\x04פּ\x04צּ\x04קּ\x04רּ\x04שּ" + - "\x04תּ\x04וֹ\x04בֿ\x04כֿ\x04פֿ\x04אל\x02ٱ\x02ٻ\x02پ\x02ڀ\x02ٺ\x02ٿ\x02ٹ" + - "\x02ڤ\x02ڦ\x02ڄ\x02ڃ\x02چ\x02ڇ\x02ڍ\x02ڌ\x02ڎ\x02ڈ\x02ژ\x02ڑ\x02ک\x02گ" + - "\x02ڳ\x02ڱ\x02ں\x02ڻ\x02ۀ\x02ہ\x02ھ\x02ے\x02ۓ\x02ڭ\x02ۇ\x02ۆ\x02ۈ\x02ۋ" + - "\x02ۅ\x02ۉ\x02ې\x02ى\x04ئا\x04ئە\x04ئو\x04ئۇ\x04ئۆ\x04ئۈ\x04ئې\x04ئى\x02" + - "ی\x04ئج\x04ئح\x04ئم\x04ئي\x04بج\x04بح\x04بخ\x04بم\x04بى\x04بي\x04تج\x04" + - "تح\x04تخ\x04تم\x04تى\x04تي\x04ثج\x04ثم\x04ثى\x04ثي\x04جح\x04جم\x04حج" + - "\x04حم\x04خج\x04خح\x04خم\x04سج\x04سح\x04سخ\x04سم\x04صح\x04صم\x04ضج\x04ضح" + - "\x04ضخ\x04ضم\x04طح\x04طم\x04ظم\x04عج\x04عم\x04غج\x04غم\x04فج\x04فح\x04فخ" + - "\x04فم\x04فى\x04في\x04قح\x04قم\x04قى\x04قي\x04كا\x04كج\x04كح\x04كخ\x04كل" + - "\x04كم\x04كى\x04كي\x04لج\x04لح\x04لخ\x04لم\x04لى\x04لي\x04مج\x04مح\x04مخ" + - "\x04مم\x04مى\x04مي\x04نج\x04نح\x04نخ\x04نم\x04نى\x04ني\x04هج\x04هم\x04هى" + - "\x04هي\x04يج\x04يح\x04يخ\x04يم\x04يى\x04يي\x04ذٰ\x04رٰ\x04ىٰ\x05 ٌّ\x05 " + - "ٍّ\x05 َّ\x05 ُّ\x05 ِّ\x05 ّٰ\x04ئر\x04ئز\x04ئن\x04بر\x04بز\x04بن\x04ت" + - "ر\x04تز\x04تن\x04ثر\x04ثز\x04ثن\x04ما\x04نر\x04نز\x04نن\x04ير\x04يز\x04" + - "ين\x04ئخ\x04ئه\x04به\x04ته\x04صخ\x04له\x04نه\x04هٰ\x04يه\x04ثه\x04سه" + - "\x04شم\x04شه\x06ـَّ\x06ـُّ\x06ـِّ\x04طى\x04طي\x04عى\x04عي\x04غى\x04غي" + - "\x04سى\x04سي\x04شى\x04شي\x04حى\x04حي\x04جى\x04جي\x04خى\x04خي\x04صى\x04صي" + - "\x04ضى\x04ضي\x04شج\x04شح\x04شخ\x04شر\x04سر\x04صر\x04ضر\x04اً\x06تجم\x06ت" + - "حج\x06تحم\x06تخم\x06تمج\x06تمح\x06تمخ\x06جمح\x06حمي\x06حمى\x06سحج\x06سج" + - "ح\x06سجى\x06سمح\x06سمج\x06سمم\x06صحح\x06صمم\x06شحم\x06شجي\x06شمخ\x06شمم" + - "\x06ضحى\x06ضخم\x06طمح\x06طمم\x06طمي\x06عجم\x06عمم\x06عمى\x06غمم\x06غمي" + - "\x06غمى\x06فخم\x06قمح\x06قمم\x06لحم\x06لحي\x06لحى\x06لجج\x06لخم\x06لمح" + - "\x06محج\x06محم\x06محي\x06مجح\x06مجم\x06مخج\x06مخم\x06مجخ\x06همج\x06همم" + - "\x06نحم\x06نحى\x06نجم\x06نجى\x06نمي\x06نمى\x06يمم\x06بخي\x06تجي\x06تجى" + - "\x06تخي\x06تخى\x06تمي\x06تمى\x06جمي\x06جحى\x06جمى\x06سخى\x06صحي\x06شحي" + - "\x06ضحي\x06لجي\x06لمي\x06يحي\x06يجي\x06يمي\x06ممي\x06قمي\x06نحي\x06عمي" + - "\x06كمي\x06نجح\x06مخي\x06لجم\x06كمم\x06جحي\x06حجي\x06مجي\x06فمي\x06بحي" + - "\x06سخي\x06نجي\x06صلے\x06قلے\x08الله\x08اكبر\x08محمد\x08صلعم\x08رسول\x08" + - "عليه\x08وسلم\x06صلى!صلى الله عليه وسلم\x0fجل جلاله\x08ریال\x01,\x01:" + - "\x01!\x01?\x01_\x01{\x01}\x01[\x01]\x01#\x01&\x01*\x01-\x01<\x01>\x01\\" + - "\x01$\x01%\x01@\x04ـً\x04ـَ\x04ـُ\x04ـِ\x04ـّ\x04ـْ\x02ء\x02آ\x02أ\x02ؤ" + - "\x02إ\x02ئ\x02ا\x02ب\x02ة\x02ت\x02ث\x02ج\x02ح\x02خ\x02د\x02ذ\x02ر\x02ز" + - "\x02س\x02ش\x02ص\x02ض\x02ط\x02ظ\x02ع\x02غ\x02ف\x02ق\x02ك\x02ل\x02م\x02ن" + - "\x02ه\x02و\x02ي\x04لآ\x04لأ\x04لإ\x04لا\x01\x22\x01'\x01/\x01^\x01|\x01~" + - "\x02¢\x02£\x02¬\x02¦\x02¥\x08𝅗𝅥\x08𝅘𝅥\x0c𝅘𝅥𝅮\x0c𝅘𝅥𝅯\x0c𝅘𝅥𝅰\x0c𝅘𝅥𝅱\x0c𝅘𝅥𝅲" + - "\x08𝆹𝅥\x08𝆺𝅥\x0c𝆹𝅥𝅮\x0c𝆺𝅥𝅮\x0c𝆹𝅥𝅯\x0c𝆺𝅥𝅯\x02ı\x02ȷ\x02α\x02ε\x02ζ\x02η" + - "\x02κ\x02λ\x02μ\x02ν\x02ξ\x02ο\x02σ\x02τ\x02υ\x02ψ\x03∇\x03∂\x02ϝ\x02ٮ" + - "\x02ڡ\x02ٯ\x020,\x021,\x022,\x023,\x024,\x025,\x026,\x027,\x028,\x029," + - "\x03(a)\x03(b)\x03(c)\x03(d)\x03(e)\x03(f)\x03(g)\x03(h)\x03(i)\x03(j)" + - "\x03(k)\x03(l)\x03(m)\x03(n)\x03(o)\x03(p)\x03(q)\x03(r)\x03(s)\x03(t)" + - "\x03(u)\x03(v)\x03(w)\x03(x)\x03(y)\x03(z)\x07〔s〕\x02wz\x02hv\x02sd\x03p" + - "pv\x02wc\x02mc\x02md\x02mr\x02dj\x06ほか\x06ココ\x03サ\x03手\x03字\x03双\x03デ" + - "\x03二\x03多\x03解\x03天\x03交\x03映\x03無\x03料\x03前\x03後\x03再\x03新\x03初\x03終" + - "\x03生\x03販\x03声\x03吹\x03演\x03投\x03捕\x03一\x03三\x03遊\x03左\x03中\x03右\x03指" + - "\x03走\x03打\x03禁\x03空\x03合\x03満\x03有\x03月\x03申\x03割\x03営\x03配\x09〔本〕\x09〔" + - "三〕\x09〔二〕\x09〔安〕\x09〔点〕\x09〔打〕\x09〔盗〕\x09〔勝〕\x09〔敗〕\x03得\x03可\x03丽\x03" + - "丸\x03乁\x03你\x03侮\x03侻\x03倂\x03偺\x03備\x03僧\x03像\x03㒞\x03免\x03兔\x03兤\x03" + - "具\x03㒹\x03內\x03冗\x03冤\x03仌\x03冬\x03况\x03凵\x03刃\x03㓟\x03刻\x03剆\x03剷\x03" + - "㔕\x03勇\x03勉\x03勤\x03勺\x03包\x03匆\x03北\x03卉\x03卑\x03博\x03即\x03卽\x03卿\x03" + - "灰\x03及\x03叟\x03叫\x03叱\x03吆\x03咞\x03吸\x03呈\x03周\x03咢\x03哶\x03唐\x03啓\x03" + - "啣\x03善\x03喙\x03喫\x03喳\x03嗂\x03圖\x03嘆\x03圗\x03噑\x03噴\x03切\x03壮\x03城\x03" + - "埴\x03堍\x03型\x03堲\x03報\x03墬\x03売\x03壷\x03夆\x03夢\x03奢\x03姬\x03娛\x03娧\x03" + - "姘\x03婦\x03㛮\x03嬈\x03嬾\x03寃\x03寘\x03寧\x03寳\x03寿\x03将\x03尢\x03㞁\x03屠\x03" + - "屮\x03峀\x03岍\x03嵃\x03嵮\x03嵫\x03嵼\x03巡\x03巢\x03㠯\x03巽\x03帨\x03帽\x03幩\x03" + - "㡢\x03㡼\x03庰\x03庳\x03庶\x03廊\x03廾\x03舁\x03弢\x03㣇\x03形\x03彫\x03㣣\x03徚\x03" + - "忍\x03志\x03忹\x03悁\x03㤺\x03㤜\x03悔\x03惇\x03慈\x03慌\x03慎\x03慺\x03憎\x03憲\x03" + - "憤\x03憯\x03懞\x03懲\x03懶\x03成\x03戛\x03扝\x03抱\x03拔\x03捐\x03挽\x03拼\x03捨\x03" + - "掃\x03揤\x03搢\x03揅\x03掩\x03㨮\x03摩\x03摾\x03撝\x03摷\x03㩬\x03敏\x03敬\x03旣\x03" + - "書\x03晉\x03㬙\x03暑\x03㬈\x03㫤\x03冒\x03冕\x03最\x03暜\x03肭\x03䏙\x03朗\x03望\x03" + - "朡\x03杞\x03杓\x03㭉\x03柺\x03枅\x03桒\x03梅\x03梎\x03栟\x03椔\x03㮝\x03楂\x03榣\x03" + - "槪\x03檨\x03櫛\x03㰘\x03次\x03歔\x03㱎\x03歲\x03殟\x03殺\x03殻\x03汎\x03沿\x03泍\x03" + - "汧\x03洖\x03派\x03海\x03流\x03浩\x03浸\x03涅\x03洴\x03港\x03湮\x03㴳\x03滋\x03滇\x03" + - "淹\x03潮\x03濆\x03瀹\x03瀞\x03瀛\x03㶖\x03灊\x03災\x03灷\x03炭\x03煅\x03熜\x03爨\x03" + - "爵\x03牐\x03犀\x03犕\x03獺\x03王\x03㺬\x03玥\x03㺸\x03瑇\x03瑜\x03瑱\x03璅\x03瓊\x03" + - "㼛\x03甤\x03甾\x03異\x03瘐\x03㿼\x03䀈\x03直\x03眞\x03真\x03睊\x03䀹\x03瞋\x03䁆\x03" + - "䂖\x03硎\x03碌\x03磌\x03䃣\x03祖\x03福\x03秫\x03䄯\x03穀\x03穊\x03穏\x03䈂\x03篆\x03" + - "築\x03䈧\x03糒\x03䊠\x03糨\x03糣\x03紀\x03絣\x03䌁\x03緇\x03縂\x03繅\x03䌴\x03䍙\x03" + - "罺\x03羕\x03翺\x03者\x03聠\x03聰\x03䏕\x03育\x03脃\x03䐋\x03脾\x03媵\x03舄\x03辞\x03" + - "䑫\x03芑\x03芋\x03芝\x03劳\x03花\x03芳\x03芽\x03苦\x03若\x03茝\x03荣\x03莭\x03茣\x03" + - "莽\x03菧\x03著\x03荓\x03菊\x03菌\x03菜\x03䔫\x03蓱\x03蓳\x03蔖\x03蕤\x03䕝\x03䕡\x03" + - "䕫\x03虐\x03虜\x03虧\x03虩\x03蚩\x03蚈\x03蜎\x03蛢\x03蝹\x03蜨\x03蝫\x03螆\x03蟡\x03" + - "蠁\x03䗹\x03衠\x03衣\x03裗\x03裞\x03䘵\x03裺\x03㒻\x03䚾\x03䛇\x03誠\x03諭\x03變\x03" + - "豕\x03貫\x03賁\x03贛\x03起\x03跋\x03趼\x03跰\x03軔\x03輸\x03邔\x03郱\x03鄑\x03鄛\x03" + - "鈸\x03鋗\x03鋘\x03鉼\x03鏹\x03鐕\x03開\x03䦕\x03閷\x03䧦\x03雃\x03嶲\x03霣\x03䩮\x03" + - "䩶\x03韠\x03䪲\x03頋\x03頩\x03飢\x03䬳\x03餩\x03馧\x03駂\x03駾\x03䯎\x03鬒\x03鱀\x03" + - "鳽\x03䳎\x03䳭\x03鵧\x03䳸\x03麻\x03䵖\x03黹\x03黾\x03鼅\x03鼏\x03鼖\x03鼻" +var mappings string = "" + // Size: 6539 bytes + " ̈a ̄23 ́ ̧1o1⁄41⁄23⁄4i̇l·ʼnsdžⱥⱦhjrwy ̆ ̇ ̊ ̨ ̃ ̋lẍ́ ι; ̈́եւاٴوٴۇٴيٴक" + + "़ख़ग़ज़ड़ढ़फ़य़ড়ঢ়য়ਲ਼ਸ਼ਖ਼ਗ਼ਜ਼ਫ਼ଡ଼ଢ଼ําໍາຫນຫມགྷཌྷདྷབྷཛྷཀྵཱཱིུྲྀྲཱྀླྀླཱ" + + "ཱྀྀྒྷྜྷྡྷྦྷྫྷྐྵвдостъѣæbdeǝgikmnȣptuɐɑəɛɜŋɔɯvβγδφχρнɒcɕðfɟɡɥɨɩɪʝɭʟɱɰɲɳ" + + "ɴɵɸʂʃƫʉʊʋʌzʐʑʒθssάέήίόύώἀιἁιἂιἃιἄιἅιἆιἇιἠιἡιἢιἣιἤιἥιἦιἧιὠιὡιὢιὣιὤιὥιὦιὧ" + + "ιὰιαιάιᾶιι ̈͂ὴιηιήιῆι ̓̀ ̓́ ̓͂ΐ ̔̀ ̔́ ̔͂ΰ ̈̀`ὼιωιώιῶι′′′′′‵‵‵‵‵!!???!!?" + + "′′′′0456789+=()rsħnoqsmtmωåאבגדπ1⁄71⁄91⁄101⁄32⁄31⁄52⁄53⁄54⁄51⁄65⁄61⁄83" + + "⁄85⁄87⁄81⁄iiivviviiiixxi0⁄3∫∫∫∫∫∮∮∮∮∮1011121314151617181920(10)(11)(12" + + ")(13)(14)(15)(16)(17)(18)(19)(20)∫∫∫∫==⫝̸ɫɽȿɀ. ゙ ゚よりコト(ᄀ)(ᄂ)(ᄃ)(ᄅ)(ᄆ)(ᄇ)" + + "(ᄉ)(ᄋ)(ᄌ)(ᄎ)(ᄏ)(ᄐ)(ᄑ)(ᄒ)(가)(나)(다)(라)(마)(바)(사)(아)(자)(차)(카)(타)(파)(하)(주)(오전" + + ")(오후)(一)(二)(三)(四)(五)(六)(七)(八)(九)(十)(月)(火)(水)(木)(金)(土)(日)(株)(有)(社)(名)(特)(" + + "財)(祝)(労)(代)(呼)(学)(監)(企)(資)(協)(祭)(休)(自)(至)21222324252627282930313233343" + + "5참고주의3637383940414243444546474849501月2月3月4月5月6月7月8月9月10月11月12月hgev令和アパート" + + "アルファアンペアアールイニングインチウォンエスクードエーカーオンスオームカイリカラットカロリーガロンガンマギガギニーキュリーギルダーキロキロ" + + "グラムキロメートルキロワットグラムグラムトンクルゼイロクローネケースコルナコーポサイクルサンチームシリングセンチセントダースデシドルトンナノ" + + "ノットハイツパーセントパーツバーレルピアストルピクルピコビルファラッドフィートブッシェルフランヘクタールペソペニヒヘルツペンスページベータポ" + + "イントボルトホンポンドホールホーンマイクロマイルマッハマルクマンションミクロンミリミリバールメガメガトンメートルヤードヤールユアンリットルリ" + + "ラルピールーブルレムレントゲンワット0点1点2点3点4点5点6点7点8点9点10点11点12点13点14点15点16点17点18点19点20" + + "点21点22点23点24点daauovpcdmiu平成昭和大正明治株式会社panamakakbmbgbkcalpfnfmgkghzmldlk" + + "lfmnmmmcmkmm2m3m∕sm∕s2rad∕srad∕s2psnsmspvnvmvkvpwnwmwkwbqcccdc∕kgdbgyhah" + + "pinkkktlmlnlxphprsrsvwbv∕ma∕m1日2日3日4日5日6日7日8日9日10日11日12日13日14日15日16日17日1" + + "8日19日20日21日22日23日24日25日26日27日28日29日30日31日ьɦɬʞʇœʍ𤋮𢡊𢡄𣏕𥉉𥳐𧻓fffiflstմնմեմիվնմ" + + "խיִײַעהכלםרתשׁשׂשּׁשּׂאַאָאּבּגּדּהּוּזּטּיּךּכּלּמּנּסּףּפּצּקּרּשּתּו" + + "ֹבֿכֿפֿאלٱٻپڀٺٿٹڤڦڄڃچڇڍڌڎڈژڑکگڳڱںڻۀہھےۓڭۇۆۈۋۅۉېىئائەئوئۇئۆئۈئېئىیئجئحئم" + + "ئيبجبحبخبمبىبيتجتحتختمتىتيثجثمثىثيجحجمحجحمخجخحخمسجسحسخسمصحصمضجضحضخضمطحط" + + "مظمعجعمغجغمفجفحفخفمفىفيقحقمقىقيكاكجكحكخكلكمكىكيلجلحلخلملىليمجمحمخمممىمي" + + "نجنحنخنمنىنيهجهمهىهييجيحيخيميىييذٰرٰىٰ ٌّ ٍّ َّ ُّ ِّ ّٰئرئزئنبربزبنترت" + + "زتنثرثزثنمانرنزننيريزينئخئهبهتهصخلهنههٰيهثهسهشمشهـَّـُّـِّطىطيعىعيغىغيس" + + "ىسيشىشيحىحيجىجيخىخيصىصيضىضيشجشحشخشرسرصرضراًتجمتحجتحمتخمتمجتمحتمخجمححميح" + + "مىسحجسجحسجىسمحسمجسممصححصممشحمشجيشمخشممضحىضخمطمحطممطميعجمعممعمىغممغميغمى" + + "فخمقمحقمملحملحيلحىلججلخملمحمحجمحممحيمجحمجممخجمخممجخهمجهممنحمنحىنجمنجىنم" + + "ينمىيممبخيتجيتجىتخيتخىتميتمىجميجحىجمىسخىصحيشحيضحيلجيلمييحييجييميمميقمين" + + "حيعميكمينجحمخيلجمكممجحيحجيمجيفميبحيسخينجيصلےقلےاللهاكبرمحمدصلعمرسولعليه" + + "وسلمصلىصلى الله عليه وسلمجل جلالهریال,:!?_{}[]#&*-<>\\$%@ـًـَـُـِـّـْءآ" + + "أؤإئابةتثجحخدذرزسشصضطظعغفقكلمنهويلآلألإلا\x22'/^|~¢£¬¦¥𝅗𝅥𝅘𝅥𝅘𝅥𝅮𝅘𝅥𝅯𝅘𝅥𝅰𝅘𝅥𝅱" + + "𝅘𝅥𝅲𝆹𝅥𝆺𝅥𝆹𝅥𝅮𝆺𝅥𝅮𝆹𝅥𝅯𝆺𝅥𝅯ıȷαεζηκλμνξοστυψ∇∂ϝٮڡٯ0,1,2,3,4,5,6,7,8,9,(a)(b)(c" + + ")(d)(e)(f)(g)(h)(i)(j)(k)(l)(m)(n)(o)(p)(q)(r)(s)(t)(u)(v)(w)(x)(y)(z)〔s" + + "〕wzhvsdppvwcmcmdmrdjほかココサ手字双デ二多解天交映無料前後再新初終生販声吹演投捕一三遊左中右指走打禁空合満有月申割営配〔" + + "本〕〔三〕〔二〕〔安〕〔点〕〔打〕〔盗〕〔勝〕〔敗〕得可丽丸乁你侮侻倂偺備僧像㒞免兔兤具㒹內冗冤仌冬况凵刃㓟刻剆剷㔕勇勉勤勺包匆北卉卑博即卽" + + "卿灰及叟叫叱吆咞吸呈周咢哶唐啓啣善喙喫喳嗂圖嘆圗噑噴切壮城埴堍型堲報墬売壷夆夢奢姬娛娧姘婦㛮嬈嬾寃寘寧寳寿将尢㞁屠屮峀岍嵃嵮嵫嵼巡巢㠯巽帨帽" + + "幩㡢㡼庰庳庶廊廾舁弢㣇形彫㣣徚忍志忹悁㤺㤜悔惇慈慌慎慺憎憲憤憯懞懲懶成戛扝抱拔捐挽拼捨掃揤搢揅掩㨮摩摾撝摷㩬敏敬旣書晉㬙暑㬈㫤冒冕最暜肭䏙朗" + + "望朡杞杓㭉柺枅桒梅梎栟椔㮝楂榣槪檨櫛㰘次歔㱎歲殟殺殻汎沿泍汧洖派海流浩浸涅洴港湮㴳滋滇淹潮濆瀹瀞瀛㶖灊災灷炭煅熜爨爵牐犀犕獺王㺬玥㺸瑇瑜瑱璅" + + "瓊㼛甤甾異瘐㿼䀈直眞真睊䀹瞋䁆䂖硎碌磌䃣祖福秫䄯穀穊穏䈂篆築䈧糒䊠糨糣紀絣䌁緇縂繅䌴䍙罺羕翺者聠聰䏕育脃䐋脾媵舄辞䑫芑芋芝劳花芳芽苦若茝荣莭" + + "茣莽菧著荓菊菌菜䔫蓱蓳蔖蕤䕝䕡䕫虐虜虧虩蚩蚈蜎蛢蝹蜨蝫螆蟡蠁䗹衠衣裗裞䘵裺㒻䚾䛇誠諭變豕貫賁贛起跋趼跰軔輸邔郱鄑鄛鈸鋗鋘鉼鏹鐕開䦕閷䧦雃嶲霣" + + "䩮䩶韠䪲頋頩飢䬳餩馧駂駾䯎鬒鱀鳽䳎䳭鵧䳸麻䵖黹黾鼅鼏鼖鼻" + +var mappingIndex = []uint16{ // 1650 elements + // Entry 0 - 3F + 0x0000, 0x0000, 0x0001, 0x0004, 0x0005, 0x0008, 0x0009, 0x000a, + 0x000d, 0x0010, 0x0011, 0x0012, 0x0017, 0x001c, 0x0021, 0x0024, + 0x0027, 0x002a, 0x002b, 0x002e, 0x0031, 0x0034, 0x0035, 0x0036, + 0x0037, 0x0038, 0x0039, 0x003c, 0x003f, 0x0042, 0x0045, 0x0048, + 0x004b, 0x004c, 0x004d, 0x0051, 0x0054, 0x0055, 0x005a, 0x005e, + 0x0062, 0x0066, 0x006a, 0x006e, 0x0074, 0x007a, 0x0080, 0x0086, + 0x008c, 0x0092, 0x0098, 0x009e, 0x00a4, 0x00aa, 0x00b0, 0x00b6, + 0x00bc, 0x00c2, 0x00c8, 0x00ce, 0x00d4, 0x00da, 0x00e0, 0x00e6, + // Entry 40 - 7F + 0x00ec, 0x00f2, 0x00f8, 0x00fe, 0x0104, 0x010a, 0x0110, 0x0116, + 0x011c, 0x0122, 0x0128, 0x012e, 0x0137, 0x013d, 0x0146, 0x014c, + 0x0152, 0x0158, 0x015e, 0x0164, 0x016a, 0x0170, 0x0172, 0x0174, + 0x0176, 0x0178, 0x017a, 0x017c, 0x017e, 0x0180, 0x0181, 0x0182, + 0x0183, 0x0185, 0x0186, 0x0187, 0x0188, 0x0189, 0x018a, 0x018c, + 0x018d, 0x018e, 0x018f, 0x0191, 0x0193, 0x0195, 0x0197, 0x0199, + 0x019b, 0x019d, 0x019f, 0x01a0, 0x01a2, 0x01a4, 0x01a6, 0x01a8, + 0x01aa, 0x01ac, 0x01ae, 0x01b0, 0x01b1, 0x01b3, 0x01b5, 0x01b6, + // Entry 80 - BF + 0x01b8, 0x01ba, 0x01bc, 0x01be, 0x01c0, 0x01c2, 0x01c4, 0x01c6, + 0x01c8, 0x01ca, 0x01cc, 0x01ce, 0x01d0, 0x01d2, 0x01d4, 0x01d6, + 0x01d8, 0x01da, 0x01dc, 0x01de, 0x01e0, 0x01e2, 0x01e4, 0x01e5, + 0x01e7, 0x01e9, 0x01eb, 0x01ed, 0x01ef, 0x01f1, 0x01f3, 0x01f5, + 0x01f7, 0x01f9, 0x01fb, 0x01fd, 0x0202, 0x0207, 0x020c, 0x0211, + 0x0216, 0x021b, 0x0220, 0x0225, 0x022a, 0x022f, 0x0234, 0x0239, + 0x023e, 0x0243, 0x0248, 0x024d, 0x0252, 0x0257, 0x025c, 0x0261, + 0x0266, 0x026b, 0x0270, 0x0275, 0x027a, 0x027e, 0x0282, 0x0287, + // Entry C0 - FF + 0x0289, 0x028e, 0x0293, 0x0297, 0x029b, 0x02a0, 0x02a5, 0x02aa, + 0x02af, 0x02b1, 0x02b6, 0x02bb, 0x02c0, 0x02c2, 0x02c7, 0x02c8, + 0x02cd, 0x02d1, 0x02d5, 0x02da, 0x02e0, 0x02e9, 0x02ef, 0x02f8, + 0x02fa, 0x02fc, 0x02fe, 0x0300, 0x030c, 0x030d, 0x030e, 0x030f, + 0x0310, 0x0311, 0x0312, 0x0313, 0x0314, 0x0315, 0x0316, 0x0317, + 0x0319, 0x031b, 0x031d, 0x031e, 0x0320, 0x0322, 0x0324, 0x0326, + 0x0328, 0x032a, 0x032c, 0x032e, 0x0330, 0x0335, 0x033a, 0x0340, + 0x0345, 0x034a, 0x034f, 0x0354, 0x0359, 0x035e, 0x0363, 0x0368, + // Entry 100 - 13F + 0x036d, 0x0372, 0x0377, 0x037c, 0x0380, 0x0382, 0x0384, 0x0386, + 0x038a, 0x038c, 0x038e, 0x0393, 0x0399, 0x03a2, 0x03a8, 0x03b1, + 0x03b3, 0x03b5, 0x03b7, 0x03b9, 0x03bb, 0x03bd, 0x03bf, 0x03c1, + 0x03c3, 0x03c5, 0x03c7, 0x03cb, 0x03cf, 0x03d3, 0x03d7, 0x03db, + 0x03df, 0x03e3, 0x03e7, 0x03eb, 0x03ef, 0x03f3, 0x03ff, 0x0401, + 0x0406, 0x0408, 0x040a, 0x040c, 0x040e, 0x040f, 0x0413, 0x0417, + 0x041d, 0x0423, 0x0428, 0x042d, 0x0432, 0x0437, 0x043c, 0x0441, + 0x0446, 0x044b, 0x0450, 0x0455, 0x045a, 0x045f, 0x0464, 0x0469, + // Entry 140 - 17F + 0x046e, 0x0473, 0x0478, 0x047d, 0x0482, 0x0487, 0x048c, 0x0491, + 0x0496, 0x049b, 0x04a0, 0x04a5, 0x04aa, 0x04af, 0x04b4, 0x04bc, + 0x04c4, 0x04c9, 0x04ce, 0x04d3, 0x04d8, 0x04dd, 0x04e2, 0x04e7, + 0x04ec, 0x04f1, 0x04f6, 0x04fb, 0x0500, 0x0505, 0x050a, 0x050f, + 0x0514, 0x0519, 0x051e, 0x0523, 0x0528, 0x052d, 0x0532, 0x0537, + 0x053c, 0x0541, 0x0546, 0x054b, 0x0550, 0x0555, 0x055a, 0x055f, + 0x0564, 0x0569, 0x056e, 0x0573, 0x0578, 0x057a, 0x057c, 0x057e, + 0x0580, 0x0582, 0x0584, 0x0586, 0x0588, 0x058a, 0x058c, 0x058e, + // Entry 180 - 1BF + 0x0590, 0x0592, 0x0594, 0x0596, 0x059c, 0x05a2, 0x05a4, 0x05a6, + 0x05a8, 0x05aa, 0x05ac, 0x05ae, 0x05b0, 0x05b2, 0x05b4, 0x05b6, + 0x05b8, 0x05ba, 0x05bc, 0x05be, 0x05c0, 0x05c4, 0x05c8, 0x05cc, + 0x05d0, 0x05d4, 0x05d8, 0x05dc, 0x05e0, 0x05e4, 0x05e9, 0x05ee, + 0x05f3, 0x05f5, 0x05f7, 0x05fd, 0x0609, 0x0615, 0x0621, 0x062a, + 0x0636, 0x063f, 0x0648, 0x0657, 0x0663, 0x066c, 0x0675, 0x067e, + 0x068a, 0x0696, 0x069f, 0x06a8, 0x06ae, 0x06b7, 0x06c3, 0x06cf, + 0x06d5, 0x06e4, 0x06f6, 0x0705, 0x070e, 0x071d, 0x072c, 0x0738, + // Entry 1C0 - 1FF + 0x0741, 0x074a, 0x0753, 0x075f, 0x076e, 0x077a, 0x0783, 0x078c, + 0x0795, 0x079b, 0x07a1, 0x07a7, 0x07ad, 0x07b6, 0x07bf, 0x07ce, + 0x07d7, 0x07e3, 0x07f2, 0x07fb, 0x0801, 0x0807, 0x0816, 0x0822, + 0x0831, 0x083a, 0x0849, 0x084f, 0x0858, 0x0861, 0x086a, 0x0873, + 0x087c, 0x0888, 0x0891, 0x0897, 0x08a0, 0x08a9, 0x08b2, 0x08be, + 0x08c7, 0x08d0, 0x08d9, 0x08e8, 0x08f4, 0x08fa, 0x0909, 0x090f, + 0x091b, 0x0927, 0x0930, 0x0939, 0x0942, 0x094e, 0x0954, 0x095d, + 0x0969, 0x096f, 0x097e, 0x0987, 0x098b, 0x098f, 0x0993, 0x0997, + // Entry 200 - 23F + 0x099b, 0x099f, 0x09a3, 0x09a7, 0x09ab, 0x09af, 0x09b4, 0x09b9, + 0x09be, 0x09c3, 0x09c8, 0x09cd, 0x09d2, 0x09d7, 0x09dc, 0x09e1, + 0x09e6, 0x09eb, 0x09f0, 0x09f5, 0x09fa, 0x09fc, 0x09fe, 0x0a00, + 0x0a02, 0x0a04, 0x0a06, 0x0a0c, 0x0a12, 0x0a18, 0x0a1e, 0x0a2a, + 0x0a2c, 0x0a2e, 0x0a30, 0x0a32, 0x0a34, 0x0a36, 0x0a38, 0x0a3c, + 0x0a3e, 0x0a40, 0x0a42, 0x0a44, 0x0a46, 0x0a48, 0x0a4a, 0x0a4c, + 0x0a4e, 0x0a50, 0x0a52, 0x0a54, 0x0a56, 0x0a58, 0x0a5a, 0x0a5f, + 0x0a65, 0x0a6c, 0x0a74, 0x0a76, 0x0a78, 0x0a7a, 0x0a7c, 0x0a7e, + // Entry 240 - 27F + 0x0a80, 0x0a82, 0x0a84, 0x0a86, 0x0a88, 0x0a8a, 0x0a8c, 0x0a8e, + 0x0a90, 0x0a96, 0x0a98, 0x0a9a, 0x0a9c, 0x0a9e, 0x0aa0, 0x0aa2, + 0x0aa4, 0x0aa6, 0x0aa8, 0x0aaa, 0x0aac, 0x0aae, 0x0ab0, 0x0ab2, + 0x0ab4, 0x0ab9, 0x0abe, 0x0ac2, 0x0ac6, 0x0aca, 0x0ace, 0x0ad2, + 0x0ad6, 0x0ada, 0x0ade, 0x0ae2, 0x0ae7, 0x0aec, 0x0af1, 0x0af6, + 0x0afb, 0x0b00, 0x0b05, 0x0b0a, 0x0b0f, 0x0b14, 0x0b19, 0x0b1e, + 0x0b23, 0x0b28, 0x0b2d, 0x0b32, 0x0b37, 0x0b3c, 0x0b41, 0x0b46, + 0x0b4b, 0x0b50, 0x0b52, 0x0b54, 0x0b56, 0x0b58, 0x0b5a, 0x0b5c, + // Entry 280 - 2BF + 0x0b5e, 0x0b62, 0x0b66, 0x0b6a, 0x0b6e, 0x0b72, 0x0b76, 0x0b7a, + 0x0b7c, 0x0b7e, 0x0b80, 0x0b82, 0x0b86, 0x0b8a, 0x0b8e, 0x0b92, + 0x0b96, 0x0b9a, 0x0b9e, 0x0ba0, 0x0ba2, 0x0ba4, 0x0ba6, 0x0ba8, + 0x0baa, 0x0bac, 0x0bb0, 0x0bb4, 0x0bba, 0x0bc0, 0x0bc4, 0x0bc8, + 0x0bcc, 0x0bd0, 0x0bd4, 0x0bd8, 0x0bdc, 0x0be0, 0x0be4, 0x0be8, + 0x0bec, 0x0bf0, 0x0bf4, 0x0bf8, 0x0bfc, 0x0c00, 0x0c04, 0x0c08, + 0x0c0c, 0x0c10, 0x0c14, 0x0c18, 0x0c1c, 0x0c20, 0x0c24, 0x0c28, + 0x0c2c, 0x0c30, 0x0c34, 0x0c36, 0x0c38, 0x0c3a, 0x0c3c, 0x0c3e, + // Entry 2C0 - 2FF + 0x0c40, 0x0c42, 0x0c44, 0x0c46, 0x0c48, 0x0c4a, 0x0c4c, 0x0c4e, + 0x0c50, 0x0c52, 0x0c54, 0x0c56, 0x0c58, 0x0c5a, 0x0c5c, 0x0c5e, + 0x0c60, 0x0c62, 0x0c64, 0x0c66, 0x0c68, 0x0c6a, 0x0c6c, 0x0c6e, + 0x0c70, 0x0c72, 0x0c74, 0x0c76, 0x0c78, 0x0c7a, 0x0c7c, 0x0c7e, + 0x0c80, 0x0c82, 0x0c86, 0x0c8a, 0x0c8e, 0x0c92, 0x0c96, 0x0c9a, + 0x0c9e, 0x0ca2, 0x0ca4, 0x0ca8, 0x0cac, 0x0cb0, 0x0cb4, 0x0cb8, + 0x0cbc, 0x0cc0, 0x0cc4, 0x0cc8, 0x0ccc, 0x0cd0, 0x0cd4, 0x0cd8, + 0x0cdc, 0x0ce0, 0x0ce4, 0x0ce8, 0x0cec, 0x0cf0, 0x0cf4, 0x0cf8, + // Entry 300 - 33F + 0x0cfc, 0x0d00, 0x0d04, 0x0d08, 0x0d0c, 0x0d10, 0x0d14, 0x0d18, + 0x0d1c, 0x0d20, 0x0d24, 0x0d28, 0x0d2c, 0x0d30, 0x0d34, 0x0d38, + 0x0d3c, 0x0d40, 0x0d44, 0x0d48, 0x0d4c, 0x0d50, 0x0d54, 0x0d58, + 0x0d5c, 0x0d60, 0x0d64, 0x0d68, 0x0d6c, 0x0d70, 0x0d74, 0x0d78, + 0x0d7c, 0x0d80, 0x0d84, 0x0d88, 0x0d8c, 0x0d90, 0x0d94, 0x0d98, + 0x0d9c, 0x0da0, 0x0da4, 0x0da8, 0x0dac, 0x0db0, 0x0db4, 0x0db8, + 0x0dbc, 0x0dc0, 0x0dc4, 0x0dc8, 0x0dcc, 0x0dd0, 0x0dd4, 0x0dd8, + 0x0ddc, 0x0de0, 0x0de4, 0x0de8, 0x0dec, 0x0df0, 0x0df4, 0x0df8, + // Entry 340 - 37F + 0x0dfc, 0x0e00, 0x0e04, 0x0e08, 0x0e0c, 0x0e10, 0x0e14, 0x0e18, + 0x0e1d, 0x0e22, 0x0e27, 0x0e2c, 0x0e31, 0x0e36, 0x0e3a, 0x0e3e, + 0x0e42, 0x0e46, 0x0e4a, 0x0e4e, 0x0e52, 0x0e56, 0x0e5a, 0x0e5e, + 0x0e62, 0x0e66, 0x0e6a, 0x0e6e, 0x0e72, 0x0e76, 0x0e7a, 0x0e7e, + 0x0e82, 0x0e86, 0x0e8a, 0x0e8e, 0x0e92, 0x0e96, 0x0e9a, 0x0e9e, + 0x0ea2, 0x0ea6, 0x0eaa, 0x0eae, 0x0eb2, 0x0eb6, 0x0ebc, 0x0ec2, + 0x0ec8, 0x0ecc, 0x0ed0, 0x0ed4, 0x0ed8, 0x0edc, 0x0ee0, 0x0ee4, + 0x0ee8, 0x0eec, 0x0ef0, 0x0ef4, 0x0ef8, 0x0efc, 0x0f00, 0x0f04, + // Entry 380 - 3BF + 0x0f08, 0x0f0c, 0x0f10, 0x0f14, 0x0f18, 0x0f1c, 0x0f20, 0x0f24, + 0x0f28, 0x0f2c, 0x0f30, 0x0f34, 0x0f38, 0x0f3e, 0x0f44, 0x0f4a, + 0x0f50, 0x0f56, 0x0f5c, 0x0f62, 0x0f68, 0x0f6e, 0x0f74, 0x0f7a, + 0x0f80, 0x0f86, 0x0f8c, 0x0f92, 0x0f98, 0x0f9e, 0x0fa4, 0x0faa, + 0x0fb0, 0x0fb6, 0x0fbc, 0x0fc2, 0x0fc8, 0x0fce, 0x0fd4, 0x0fda, + 0x0fe0, 0x0fe6, 0x0fec, 0x0ff2, 0x0ff8, 0x0ffe, 0x1004, 0x100a, + 0x1010, 0x1016, 0x101c, 0x1022, 0x1028, 0x102e, 0x1034, 0x103a, + 0x1040, 0x1046, 0x104c, 0x1052, 0x1058, 0x105e, 0x1064, 0x106a, + // Entry 3C0 - 3FF + 0x1070, 0x1076, 0x107c, 0x1082, 0x1088, 0x108e, 0x1094, 0x109a, + 0x10a0, 0x10a6, 0x10ac, 0x10b2, 0x10b8, 0x10be, 0x10c4, 0x10ca, + 0x10d0, 0x10d6, 0x10dc, 0x10e2, 0x10e8, 0x10ee, 0x10f4, 0x10fa, + 0x1100, 0x1106, 0x110c, 0x1112, 0x1118, 0x111e, 0x1124, 0x112a, + 0x1130, 0x1136, 0x113c, 0x1142, 0x1148, 0x114e, 0x1154, 0x115a, + 0x1160, 0x1166, 0x116c, 0x1172, 0x1178, 0x1180, 0x1188, 0x1190, + 0x1198, 0x11a0, 0x11a8, 0x11b0, 0x11b6, 0x11d7, 0x11e6, 0x11ee, + 0x11ef, 0x11f0, 0x11f1, 0x11f2, 0x11f3, 0x11f4, 0x11f5, 0x11f6, + // Entry 400 - 43F + 0x11f7, 0x11f8, 0x11f9, 0x11fa, 0x11fb, 0x11fc, 0x11fd, 0x11fe, + 0x11ff, 0x1200, 0x1201, 0x1205, 0x1209, 0x120d, 0x1211, 0x1215, + 0x1219, 0x121b, 0x121d, 0x121f, 0x1221, 0x1223, 0x1225, 0x1227, + 0x1229, 0x122b, 0x122d, 0x122f, 0x1231, 0x1233, 0x1235, 0x1237, + 0x1239, 0x123b, 0x123d, 0x123f, 0x1241, 0x1243, 0x1245, 0x1247, + 0x1249, 0x124b, 0x124d, 0x124f, 0x1251, 0x1253, 0x1255, 0x1257, + 0x1259, 0x125b, 0x125d, 0x125f, 0x1263, 0x1267, 0x126b, 0x126f, + 0x1270, 0x1271, 0x1272, 0x1273, 0x1274, 0x1275, 0x1277, 0x1279, + // Entry 440 - 47F + 0x127b, 0x127d, 0x127f, 0x1287, 0x128f, 0x129b, 0x12a7, 0x12b3, + 0x12bf, 0x12cb, 0x12d3, 0x12db, 0x12e7, 0x12f3, 0x12ff, 0x130b, + 0x130d, 0x130f, 0x1311, 0x1313, 0x1315, 0x1317, 0x1319, 0x131b, + 0x131d, 0x131f, 0x1321, 0x1323, 0x1325, 0x1327, 0x1329, 0x132b, + 0x132e, 0x1331, 0x1333, 0x1335, 0x1337, 0x1339, 0x133b, 0x133d, + 0x133f, 0x1341, 0x1343, 0x1345, 0x1347, 0x1349, 0x134b, 0x134d, + 0x1350, 0x1353, 0x1356, 0x1359, 0x135c, 0x135f, 0x1362, 0x1365, + 0x1368, 0x136b, 0x136e, 0x1371, 0x1374, 0x1377, 0x137a, 0x137d, + // Entry 480 - 4BF + 0x1380, 0x1383, 0x1386, 0x1389, 0x138c, 0x138f, 0x1392, 0x1395, + 0x1398, 0x139b, 0x13a2, 0x13a4, 0x13a6, 0x13a8, 0x13ab, 0x13ad, + 0x13af, 0x13b1, 0x13b3, 0x13b5, 0x13bb, 0x13c1, 0x13c4, 0x13c7, + 0x13ca, 0x13cd, 0x13d0, 0x13d3, 0x13d6, 0x13d9, 0x13dc, 0x13df, + 0x13e2, 0x13e5, 0x13e8, 0x13eb, 0x13ee, 0x13f1, 0x13f4, 0x13f7, + 0x13fa, 0x13fd, 0x1400, 0x1403, 0x1406, 0x1409, 0x140c, 0x140f, + 0x1412, 0x1415, 0x1418, 0x141b, 0x141e, 0x1421, 0x1424, 0x1427, + 0x142a, 0x142d, 0x1430, 0x1433, 0x1436, 0x1439, 0x143c, 0x143f, + // Entry 4C0 - 4FF + 0x1442, 0x1445, 0x1448, 0x1451, 0x145a, 0x1463, 0x146c, 0x1475, + 0x147e, 0x1487, 0x1490, 0x1499, 0x149c, 0x149f, 0x14a2, 0x14a5, + 0x14a8, 0x14ab, 0x14ae, 0x14b1, 0x14b4, 0x14b7, 0x14ba, 0x14bd, + 0x14c0, 0x14c3, 0x14c6, 0x14c9, 0x14cc, 0x14cf, 0x14d2, 0x14d5, + 0x14d8, 0x14db, 0x14de, 0x14e1, 0x14e4, 0x14e7, 0x14ea, 0x14ed, + 0x14f0, 0x14f3, 0x14f6, 0x14f9, 0x14fc, 0x14ff, 0x1502, 0x1505, + 0x1508, 0x150b, 0x150e, 0x1511, 0x1514, 0x1517, 0x151a, 0x151d, + 0x1520, 0x1523, 0x1526, 0x1529, 0x152c, 0x152f, 0x1532, 0x1535, + // Entry 500 - 53F + 0x1538, 0x153b, 0x153e, 0x1541, 0x1544, 0x1547, 0x154a, 0x154d, + 0x1550, 0x1553, 0x1556, 0x1559, 0x155c, 0x155f, 0x1562, 0x1565, + 0x1568, 0x156b, 0x156e, 0x1571, 0x1574, 0x1577, 0x157a, 0x157d, + 0x1580, 0x1583, 0x1586, 0x1589, 0x158c, 0x158f, 0x1592, 0x1595, + 0x1598, 0x159b, 0x159e, 0x15a1, 0x15a4, 0x15a7, 0x15aa, 0x15ad, + 0x15b0, 0x15b3, 0x15b6, 0x15b9, 0x15bc, 0x15bf, 0x15c2, 0x15c5, + 0x15c8, 0x15cb, 0x15ce, 0x15d1, 0x15d4, 0x15d7, 0x15da, 0x15dd, + 0x15e0, 0x15e3, 0x15e6, 0x15e9, 0x15ec, 0x15ef, 0x15f2, 0x15f5, + // Entry 540 - 57F + 0x15f8, 0x15fb, 0x15fe, 0x1601, 0x1604, 0x1607, 0x160a, 0x160d, + 0x1610, 0x1613, 0x1616, 0x1619, 0x161c, 0x161f, 0x1622, 0x1625, + 0x1628, 0x162b, 0x162e, 0x1631, 0x1634, 0x1637, 0x163a, 0x163d, + 0x1640, 0x1643, 0x1646, 0x1649, 0x164c, 0x164f, 0x1652, 0x1655, + 0x1658, 0x165b, 0x165e, 0x1661, 0x1664, 0x1667, 0x166a, 0x166d, + 0x1670, 0x1673, 0x1676, 0x1679, 0x167c, 0x167f, 0x1682, 0x1685, + 0x1688, 0x168b, 0x168e, 0x1691, 0x1694, 0x1697, 0x169a, 0x169d, + 0x16a0, 0x16a3, 0x16a6, 0x16a9, 0x16ac, 0x16af, 0x16b2, 0x16b5, + // Entry 580 - 5BF + 0x16b8, 0x16bb, 0x16be, 0x16c1, 0x16c4, 0x16c7, 0x16ca, 0x16cd, + 0x16d0, 0x16d3, 0x16d6, 0x16d9, 0x16dc, 0x16df, 0x16e2, 0x16e5, + 0x16e8, 0x16eb, 0x16ee, 0x16f1, 0x16f4, 0x16f7, 0x16fa, 0x16fd, + 0x1700, 0x1703, 0x1706, 0x1709, 0x170c, 0x170f, 0x1712, 0x1715, + 0x1718, 0x171b, 0x171e, 0x1721, 0x1724, 0x1727, 0x172a, 0x172d, + 0x1730, 0x1733, 0x1736, 0x1739, 0x173c, 0x173f, 0x1742, 0x1745, + 0x1748, 0x174b, 0x174e, 0x1751, 0x1754, 0x1757, 0x175a, 0x175d, + 0x1760, 0x1763, 0x1766, 0x1769, 0x176c, 0x176f, 0x1772, 0x1775, + // Entry 5C0 - 5FF + 0x1778, 0x177b, 0x177e, 0x1781, 0x1784, 0x1787, 0x178a, 0x178d, + 0x1790, 0x1793, 0x1796, 0x1799, 0x179c, 0x179f, 0x17a2, 0x17a5, + 0x17a8, 0x17ab, 0x17ae, 0x17b1, 0x17b4, 0x17b7, 0x17ba, 0x17bd, + 0x17c0, 0x17c3, 0x17c6, 0x17c9, 0x17cc, 0x17cf, 0x17d2, 0x17d5, + 0x17d8, 0x17db, 0x17de, 0x17e1, 0x17e4, 0x17e7, 0x17ea, 0x17ed, + 0x17f0, 0x17f3, 0x17f6, 0x17f9, 0x17fc, 0x17ff, 0x1802, 0x1805, + 0x1808, 0x180b, 0x180e, 0x1811, 0x1814, 0x1817, 0x181a, 0x181d, + 0x1820, 0x1823, 0x1826, 0x1829, 0x182c, 0x182f, 0x1832, 0x1835, + // Entry 600 - 63F + 0x1838, 0x183b, 0x183e, 0x1841, 0x1844, 0x1847, 0x184a, 0x184d, + 0x1850, 0x1853, 0x1856, 0x1859, 0x185c, 0x185f, 0x1862, 0x1865, + 0x1868, 0x186b, 0x186e, 0x1871, 0x1874, 0x1877, 0x187a, 0x187d, + 0x1880, 0x1883, 0x1886, 0x1889, 0x188c, 0x188f, 0x1892, 0x1895, + 0x1898, 0x189b, 0x189e, 0x18a1, 0x18a4, 0x18a7, 0x18aa, 0x18ad, + 0x18b0, 0x18b3, 0x18b6, 0x18b9, 0x18bc, 0x18bf, 0x18c2, 0x18c5, + 0x18c8, 0x18cb, 0x18ce, 0x18d1, 0x18d4, 0x18d7, 0x18da, 0x18dd, + 0x18e0, 0x18e3, 0x18e6, 0x18e9, 0x18ec, 0x18ef, 0x18f2, 0x18f5, + // Entry 640 - 67F + 0x18f8, 0x18fb, 0x18fe, 0x1901, 0x1904, 0x1907, 0x190a, 0x190d, + 0x1910, 0x1913, 0x1916, 0x1919, 0x191c, 0x191f, 0x1922, 0x1925, + 0x1928, 0x192b, 0x192e, 0x1931, 0x1934, 0x1937, 0x193a, 0x193d, + 0x1940, 0x1943, 0x1946, 0x1949, 0x194c, 0x194f, 0x1952, 0x1955, + 0x1958, 0x195b, 0x195e, 0x1961, 0x1964, 0x1967, 0x196a, 0x196d, + 0x1970, 0x1973, 0x1976, 0x1979, 0x197c, 0x197f, 0x1982, 0x1985, + 0x1988, 0x198b, +} // Size: 3324 bytes var xorData string = "" + // Size: 4862 bytes "\x02\x0c\x09\x02\xb0\xec\x02\xad\xd8\x02\xad\xd9\x02\x06\x07\x02\x0f\x12" + @@ -547,7 +690,7 @@ func (t *idnaTrie) lookupStringUnsafe(s string) uint16 { return 0 } -// idnaTrie. Total size: 30288 bytes (29.58 KiB). Checksum: c0cd84404a2f6f19. +// idnaTrie. Total size: 30196 bytes (29.49 KiB). Checksum: e2ae95a945f04016. type idnaTrie struct{} func newIdnaTrie(i int) *idnaTrie { @@ -600,11 +743,11 @@ var idnaValues = [8192]uint16{ 0xd2: 0x0040, 0xd3: 0x0040, 0xd4: 0x0040, 0xd5: 0x0040, 0xd6: 0x0040, 0xd7: 0x0040, 0xd8: 0x0040, 0xd9: 0x0040, 0xda: 0x0040, 0xdb: 0x0040, 0xdc: 0x0040, 0xdd: 0x0040, 0xde: 0x0040, 0xdf: 0x0040, 0xe0: 0x000a, 0xe1: 0x0018, 0xe2: 0x0018, 0xe3: 0x0018, - 0xe4: 0x0018, 0xe5: 0x0018, 0xe6: 0x0018, 0xe7: 0x0018, 0xe8: 0x001a, 0xe9: 0x0018, - 0xea: 0x0039, 0xeb: 0x0018, 0xec: 0x0018, 0xed: 0x03c0, 0xee: 0x0018, 0xef: 0x004a, - 0xf0: 0x0018, 0xf1: 0x0018, 0xf2: 0x0069, 0xf3: 0x0079, 0xf4: 0x008a, 0xf5: 0x0005, - 0xf6: 0x0018, 0xf7: 0x0008, 0xf8: 0x00aa, 0xf9: 0x00c9, 0xfa: 0x00d9, 0xfb: 0x0018, - 0xfc: 0x00e9, 0xfd: 0x0119, 0xfe: 0x0149, 0xff: 0x0018, + 0xe4: 0x0018, 0xe5: 0x0018, 0xe6: 0x0018, 0xe7: 0x0018, 0xe8: 0x0012, 0xe9: 0x0018, + 0xea: 0x0019, 0xeb: 0x0018, 0xec: 0x0018, 0xed: 0x03c0, 0xee: 0x0018, 0xef: 0x0022, + 0xf0: 0x0018, 0xf1: 0x0018, 0xf2: 0x0029, 0xf3: 0x0031, 0xf4: 0x003a, 0xf5: 0x0005, + 0xf6: 0x0018, 0xf7: 0x0008, 0xf8: 0x0042, 0xf9: 0x0049, 0xfa: 0x0051, 0xfb: 0x0018, + 0xfc: 0x0059, 0xfd: 0x0061, 0xfe: 0x0069, 0xff: 0x0018, // Block 0x4, offset 0x100 0x100: 0xe00d, 0x101: 0x0008, 0x102: 0xe00d, 0x103: 0x0008, 0x104: 0xe00d, 0x105: 0x0008, 0x106: 0xe00d, 0x107: 0x0008, 0x108: 0xe00d, 0x109: 0x0008, 0x10a: 0xe00d, 0x10b: 0x0008, @@ -614,12 +757,12 @@ var idnaValues = [8192]uint16{ 0x11e: 0xe00d, 0x11f: 0x0008, 0x120: 0xe00d, 0x121: 0x0008, 0x122: 0xe00d, 0x123: 0x0008, 0x124: 0xe00d, 0x125: 0x0008, 0x126: 0xe00d, 0x127: 0x0008, 0x128: 0xe00d, 0x129: 0x0008, 0x12a: 0xe00d, 0x12b: 0x0008, 0x12c: 0xe00d, 0x12d: 0x0008, 0x12e: 0xe00d, 0x12f: 0x0008, - 0x130: 0x0179, 0x131: 0x0008, 0x132: 0x0035, 0x133: 0x004d, 0x134: 0xe00d, 0x135: 0x0008, + 0x130: 0x0071, 0x131: 0x0008, 0x132: 0x0035, 0x133: 0x004d, 0x134: 0xe00d, 0x135: 0x0008, 0x136: 0xe00d, 0x137: 0x0008, 0x138: 0x0008, 0x139: 0xe01d, 0x13a: 0x0008, 0x13b: 0xe03d, - 0x13c: 0x0008, 0x13d: 0xe01d, 0x13e: 0x0008, 0x13f: 0x0199, + 0x13c: 0x0008, 0x13d: 0xe01d, 0x13e: 0x0008, 0x13f: 0x0079, // Block 0x5, offset 0x140 - 0x140: 0x0199, 0x141: 0xe01d, 0x142: 0x0008, 0x143: 0xe03d, 0x144: 0x0008, 0x145: 0xe01d, - 0x146: 0x0008, 0x147: 0xe07d, 0x148: 0x0008, 0x149: 0x01b9, 0x14a: 0xe00d, 0x14b: 0x0008, + 0x140: 0x0079, 0x141: 0xe01d, 0x142: 0x0008, 0x143: 0xe03d, 0x144: 0x0008, 0x145: 0xe01d, + 0x146: 0x0008, 0x147: 0xe07d, 0x148: 0x0008, 0x149: 0x0081, 0x14a: 0xe00d, 0x14b: 0x0008, 0x14c: 0xe00d, 0x14d: 0x0008, 0x14e: 0xe00d, 0x14f: 0x0008, 0x150: 0xe00d, 0x151: 0x0008, 0x152: 0xe00d, 0x153: 0x0008, 0x154: 0xe00d, 0x155: 0x0008, 0x156: 0xe00d, 0x157: 0x0008, 0x158: 0xe00d, 0x159: 0x0008, 0x15a: 0xe00d, 0x15b: 0x0008, 0x15c: 0xe00d, 0x15d: 0x0008, @@ -628,7 +771,7 @@ var idnaValues = [8192]uint16{ 0x16a: 0xe00d, 0x16b: 0x0008, 0x16c: 0xe00d, 0x16d: 0x0008, 0x16e: 0xe00d, 0x16f: 0x0008, 0x170: 0xe00d, 0x171: 0x0008, 0x172: 0xe00d, 0x173: 0x0008, 0x174: 0xe00d, 0x175: 0x0008, 0x176: 0xe00d, 0x177: 0x0008, 0x178: 0x0065, 0x179: 0xe01d, 0x17a: 0x0008, 0x17b: 0xe03d, - 0x17c: 0x0008, 0x17d: 0xe01d, 0x17e: 0x0008, 0x17f: 0x01d9, + 0x17c: 0x0008, 0x17d: 0xe01d, 0x17e: 0x0008, 0x17f: 0x0089, // Block 0x6, offset 0x180 0x180: 0x0008, 0x181: 0x007d, 0x182: 0xe00d, 0x183: 0x0008, 0x184: 0xe00d, 0x185: 0x0008, 0x186: 0x007d, 0x187: 0xe07d, 0x188: 0x0008, 0x189: 0x0095, 0x18a: 0x00ad, 0x18b: 0xe03d, @@ -642,8 +785,8 @@ var idnaValues = [8192]uint16{ 0x1b6: 0x0008, 0x1b7: 0x01e5, 0x1b8: 0xe00d, 0x1b9: 0x0008, 0x1ba: 0x0008, 0x1bb: 0x0008, 0x1bc: 0xe00d, 0x1bd: 0x0008, 0x1be: 0x0008, 0x1bf: 0x0008, // Block 0x7, offset 0x1c0 - 0x1c0: 0x0008, 0x1c1: 0x0008, 0x1c2: 0x0008, 0x1c3: 0x0008, 0x1c4: 0x01e9, 0x1c5: 0x01e9, - 0x1c6: 0x01e9, 0x1c7: 0x01fd, 0x1c8: 0x0215, 0x1c9: 0x022d, 0x1ca: 0x0245, 0x1cb: 0x025d, + 0x1c0: 0x0008, 0x1c1: 0x0008, 0x1c2: 0x0008, 0x1c3: 0x0008, 0x1c4: 0x0091, 0x1c5: 0x0091, + 0x1c6: 0x0091, 0x1c7: 0x01fd, 0x1c8: 0x0215, 0x1c9: 0x022d, 0x1ca: 0x0245, 0x1cb: 0x025d, 0x1cc: 0x0275, 0x1cd: 0xe01d, 0x1ce: 0x0008, 0x1cf: 0xe0fd, 0x1d0: 0x0008, 0x1d1: 0xe01d, 0x1d2: 0x0008, 0x1d3: 0xe03d, 0x1d4: 0x0008, 0x1d5: 0xe01d, 0x1d6: 0x0008, 0x1d7: 0xe07d, 0x1d8: 0x0008, 0x1d9: 0xe01d, 0x1da: 0x0008, 0x1db: 0xe03d, 0x1dc: 0x0008, 0x1dd: 0x0008, @@ -663,22 +806,22 @@ var idnaValues = [8192]uint16{ 0x224: 0xe00d, 0x225: 0x0008, 0x226: 0xe00d, 0x227: 0x0008, 0x228: 0xe00d, 0x229: 0x0008, 0x22a: 0xe00d, 0x22b: 0x0008, 0x22c: 0xe00d, 0x22d: 0x0008, 0x22e: 0xe00d, 0x22f: 0x0008, 0x230: 0xe00d, 0x231: 0x0008, 0x232: 0xe00d, 0x233: 0x0008, 0x234: 0x0008, 0x235: 0x0008, - 0x236: 0x0008, 0x237: 0x0008, 0x238: 0x0008, 0x239: 0x0008, 0x23a: 0x0209, 0x23b: 0xe03d, - 0x23c: 0x0008, 0x23d: 0x031d, 0x23e: 0x0229, 0x23f: 0x0008, + 0x236: 0x0008, 0x237: 0x0008, 0x238: 0x0008, 0x239: 0x0008, 0x23a: 0x0099, 0x23b: 0xe03d, + 0x23c: 0x0008, 0x23d: 0x031d, 0x23e: 0x00a1, 0x23f: 0x0008, // Block 0x9, offset 0x240 0x240: 0x0008, 0x241: 0x0008, 0x242: 0x0018, 0x243: 0x0018, 0x244: 0x0018, 0x245: 0x0018, 0x246: 0x0008, 0x247: 0x0008, 0x248: 0x0008, 0x249: 0x0008, 0x24a: 0x0008, 0x24b: 0x0008, 0x24c: 0x0008, 0x24d: 0x0008, 0x24e: 0x0008, 0x24f: 0x0008, 0x250: 0x0008, 0x251: 0x0008, 0x252: 0x0018, 0x253: 0x0018, 0x254: 0x0018, 0x255: 0x0018, 0x256: 0x0018, 0x257: 0x0018, - 0x258: 0x029a, 0x259: 0x02ba, 0x25a: 0x02da, 0x25b: 0x02fa, 0x25c: 0x031a, 0x25d: 0x033a, - 0x25e: 0x0018, 0x25f: 0x0018, 0x260: 0x03ad, 0x261: 0x0359, 0x262: 0x01d9, 0x263: 0x0369, + 0x258: 0x00d2, 0x259: 0x00da, 0x25a: 0x00e2, 0x25b: 0x00ea, 0x25c: 0x00f2, 0x25d: 0x00fa, + 0x25e: 0x0018, 0x25f: 0x0018, 0x260: 0x03ad, 0x261: 0x0101, 0x262: 0x0089, 0x263: 0x0109, 0x264: 0x03c5, 0x265: 0x0018, 0x266: 0x0018, 0x267: 0x0018, 0x268: 0x0018, 0x269: 0x0018, 0x26a: 0x0018, 0x26b: 0x0018, 0x26c: 0x0008, 0x26d: 0x0018, 0x26e: 0x0008, 0x26f: 0x0018, 0x270: 0x0018, 0x271: 0x0018, 0x272: 0x0018, 0x273: 0x0018, 0x274: 0x0018, 0x275: 0x0018, 0x276: 0x0018, 0x277: 0x0018, 0x278: 0x0018, 0x279: 0x0018, 0x27a: 0x0018, 0x27b: 0x0018, 0x27c: 0x0018, 0x27d: 0x0018, 0x27e: 0x0018, 0x27f: 0x0018, // Block 0xa, offset 0x280 - 0x280: 0x03dd, 0x281: 0x03dd, 0x282: 0x3308, 0x283: 0x03f5, 0x284: 0x0379, 0x285: 0x040d, + 0x280: 0x03dd, 0x281: 0x03dd, 0x282: 0x3308, 0x283: 0x03f5, 0x284: 0x0111, 0x285: 0x040d, 0x286: 0x3308, 0x287: 0x3308, 0x288: 0x3308, 0x289: 0x3308, 0x28a: 0x3308, 0x28b: 0x3308, 0x28c: 0x3308, 0x28d: 0x3308, 0x28e: 0x3308, 0x28f: 0x33c0, 0x290: 0x3308, 0x291: 0x3308, 0x292: 0x3308, 0x293: 0x3308, 0x294: 0x3308, 0x295: 0x3308, 0x296: 0x3308, 0x297: 0x3308, @@ -687,10 +830,10 @@ var idnaValues = [8192]uint16{ 0x2a4: 0x3308, 0x2a5: 0x3308, 0x2a6: 0x3308, 0x2a7: 0x3308, 0x2a8: 0x3308, 0x2a9: 0x3308, 0x2aa: 0x3308, 0x2ab: 0x3308, 0x2ac: 0x3308, 0x2ad: 0x3308, 0x2ae: 0x3308, 0x2af: 0x3308, 0x2b0: 0xe00d, 0x2b1: 0x0008, 0x2b2: 0xe00d, 0x2b3: 0x0008, 0x2b4: 0x0425, 0x2b5: 0x0008, - 0x2b6: 0xe00d, 0x2b7: 0x0008, 0x2b8: 0x0040, 0x2b9: 0x0040, 0x2ba: 0x03a2, 0x2bb: 0x0008, - 0x2bc: 0x0008, 0x2bd: 0x0008, 0x2be: 0x03c2, 0x2bf: 0x043d, + 0x2b6: 0xe00d, 0x2b7: 0x0008, 0x2b8: 0x0040, 0x2b9: 0x0040, 0x2ba: 0x011a, 0x2bb: 0x0008, + 0x2bc: 0x0008, 0x2bd: 0x0008, 0x2be: 0x0122, 0x2bf: 0x043d, // Block 0xb, offset 0x2c0 - 0x2c0: 0x0040, 0x2c1: 0x0040, 0x2c2: 0x0040, 0x2c3: 0x0040, 0x2c4: 0x008a, 0x2c5: 0x03d2, + 0x2c0: 0x0040, 0x2c1: 0x0040, 0x2c2: 0x0040, 0x2c3: 0x0040, 0x2c4: 0x003a, 0x2c5: 0x012a, 0x2c6: 0xe155, 0x2c7: 0x0455, 0x2c8: 0xe12d, 0x2c9: 0xe13d, 0x2ca: 0xe12d, 0x2cb: 0x0040, 0x2cc: 0x03dd, 0x2cd: 0x0040, 0x2ce: 0x046d, 0x2cf: 0x0485, 0x2d0: 0x0008, 0x2d1: 0xe105, 0x2d2: 0xe105, 0x2d3: 0xe105, 0x2d4: 0xe105, 0x2d5: 0xe105, 0x2d6: 0xe105, 0x2d7: 0xe105, @@ -782,8 +925,8 @@ var idnaValues = [8192]uint16{ 0x49e: 0x3308, 0x49f: 0x3308, 0x4a0: 0x0808, 0x4a1: 0x0808, 0x4a2: 0x0808, 0x4a3: 0x0808, 0x4a4: 0x0808, 0x4a5: 0x0808, 0x4a6: 0x0808, 0x4a7: 0x0808, 0x4a8: 0x0808, 0x4a9: 0x0808, 0x4aa: 0x0018, 0x4ab: 0x0818, 0x4ac: 0x0818, 0x4ad: 0x0818, 0x4ae: 0x0a08, 0x4af: 0x0a08, - 0x4b0: 0x3308, 0x4b1: 0x0c08, 0x4b2: 0x0c08, 0x4b3: 0x0c08, 0x4b4: 0x0808, 0x4b5: 0x0429, - 0x4b6: 0x0451, 0x4b7: 0x0479, 0x4b8: 0x04a1, 0x4b9: 0x0a08, 0x4ba: 0x0a08, 0x4bb: 0x0a08, + 0x4b0: 0x3308, 0x4b1: 0x0c08, 0x4b2: 0x0c08, 0x4b3: 0x0c08, 0x4b4: 0x0808, 0x4b5: 0x0139, + 0x4b6: 0x0141, 0x4b7: 0x0149, 0x4b8: 0x0151, 0x4b9: 0x0a08, 0x4ba: 0x0a08, 0x4bb: 0x0a08, 0x4bc: 0x0a08, 0x4bd: 0x0a08, 0x4be: 0x0a08, 0x4bf: 0x0a08, // Block 0x13, offset 0x4c0 0x4c0: 0x0c08, 0x4c1: 0x0a08, 0x4c2: 0x0a08, 0x4c3: 0x0c08, 0x4c4: 0x0c08, 0x4c5: 0x0c08, @@ -826,8 +969,8 @@ var idnaValues = [8192]uint16{ 0x586: 0x3308, 0x587: 0x3308, 0x588: 0x3308, 0x589: 0x3008, 0x58a: 0x3008, 0x58b: 0x3008, 0x58c: 0x3008, 0x58d: 0x3b08, 0x58e: 0x3008, 0x58f: 0x3008, 0x590: 0x0008, 0x591: 0x3308, 0x592: 0x3308, 0x593: 0x3308, 0x594: 0x3308, 0x595: 0x3308, 0x596: 0x3308, 0x597: 0x3308, - 0x598: 0x04c9, 0x599: 0x0501, 0x59a: 0x0539, 0x59b: 0x0571, 0x59c: 0x05a9, 0x59d: 0x05e1, - 0x59e: 0x0619, 0x59f: 0x0651, 0x5a0: 0x0008, 0x5a1: 0x0008, 0x5a2: 0x3308, 0x5a3: 0x3308, + 0x598: 0x0159, 0x599: 0x0161, 0x59a: 0x0169, 0x59b: 0x0171, 0x59c: 0x0179, 0x59d: 0x0181, + 0x59e: 0x0189, 0x59f: 0x0191, 0x5a0: 0x0008, 0x5a1: 0x0008, 0x5a2: 0x3308, 0x5a3: 0x3308, 0x5a4: 0x0018, 0x5a5: 0x0018, 0x5a6: 0x0008, 0x5a7: 0x0008, 0x5a8: 0x0008, 0x5a9: 0x0008, 0x5aa: 0x0008, 0x5ab: 0x0008, 0x5ac: 0x0008, 0x5ad: 0x0008, 0x5ae: 0x0008, 0x5af: 0x0008, 0x5b0: 0x0018, 0x5b1: 0x0008, 0x5b2: 0x0008, 0x5b3: 0x0008, 0x5b4: 0x0008, 0x5b5: 0x0008, @@ -850,8 +993,8 @@ var idnaValues = [8192]uint16{ 0x606: 0x0040, 0x607: 0x3008, 0x608: 0x3008, 0x609: 0x0040, 0x60a: 0x0040, 0x60b: 0x3008, 0x60c: 0x3008, 0x60d: 0x3b08, 0x60e: 0x0008, 0x60f: 0x0040, 0x610: 0x0040, 0x611: 0x0040, 0x612: 0x0040, 0x613: 0x0040, 0x614: 0x0040, 0x615: 0x0040, 0x616: 0x0040, 0x617: 0x3008, - 0x618: 0x0040, 0x619: 0x0040, 0x61a: 0x0040, 0x61b: 0x0040, 0x61c: 0x0689, 0x61d: 0x06c1, - 0x61e: 0x0040, 0x61f: 0x06f9, 0x620: 0x0008, 0x621: 0x0008, 0x622: 0x3308, 0x623: 0x3308, + 0x618: 0x0040, 0x619: 0x0040, 0x61a: 0x0040, 0x61b: 0x0040, 0x61c: 0x0199, 0x61d: 0x01a1, + 0x61e: 0x0040, 0x61f: 0x01a9, 0x620: 0x0008, 0x621: 0x0008, 0x622: 0x3308, 0x623: 0x3308, 0x624: 0x0040, 0x625: 0x0040, 0x626: 0x0008, 0x627: 0x0008, 0x628: 0x0008, 0x629: 0x0008, 0x62a: 0x0008, 0x62b: 0x0008, 0x62c: 0x0008, 0x62d: 0x0008, 0x62e: 0x0008, 0x62f: 0x0008, 0x630: 0x0008, 0x631: 0x0008, 0x632: 0x0018, 0x633: 0x0018, 0x634: 0x0018, 0x635: 0x0018, @@ -866,16 +1009,16 @@ var idnaValues = [8192]uint16{ 0x65e: 0x0008, 0x65f: 0x0008, 0x660: 0x0008, 0x661: 0x0008, 0x662: 0x0008, 0x663: 0x0008, 0x664: 0x0008, 0x665: 0x0008, 0x666: 0x0008, 0x667: 0x0008, 0x668: 0x0008, 0x669: 0x0040, 0x66a: 0x0008, 0x66b: 0x0008, 0x66c: 0x0008, 0x66d: 0x0008, 0x66e: 0x0008, 0x66f: 0x0008, - 0x670: 0x0008, 0x671: 0x0040, 0x672: 0x0008, 0x673: 0x0731, 0x674: 0x0040, 0x675: 0x0008, - 0x676: 0x0769, 0x677: 0x0040, 0x678: 0x0008, 0x679: 0x0008, 0x67a: 0x0040, 0x67b: 0x0040, + 0x670: 0x0008, 0x671: 0x0040, 0x672: 0x0008, 0x673: 0x01b1, 0x674: 0x0040, 0x675: 0x0008, + 0x676: 0x01b9, 0x677: 0x0040, 0x678: 0x0008, 0x679: 0x0008, 0x67a: 0x0040, 0x67b: 0x0040, 0x67c: 0x3308, 0x67d: 0x0040, 0x67e: 0x3008, 0x67f: 0x3008, // Block 0x1a, offset 0x680 0x680: 0x3008, 0x681: 0x3308, 0x682: 0x3308, 0x683: 0x0040, 0x684: 0x0040, 0x685: 0x0040, 0x686: 0x0040, 0x687: 0x3308, 0x688: 0x3308, 0x689: 0x0040, 0x68a: 0x0040, 0x68b: 0x3308, 0x68c: 0x3308, 0x68d: 0x3b08, 0x68e: 0x0040, 0x68f: 0x0040, 0x690: 0x0040, 0x691: 0x3308, 0x692: 0x0040, 0x693: 0x0040, 0x694: 0x0040, 0x695: 0x0040, 0x696: 0x0040, 0x697: 0x0040, - 0x698: 0x0040, 0x699: 0x07a1, 0x69a: 0x07d9, 0x69b: 0x0811, 0x69c: 0x0008, 0x69d: 0x0040, - 0x69e: 0x0849, 0x69f: 0x0040, 0x6a0: 0x0040, 0x6a1: 0x0040, 0x6a2: 0x0040, 0x6a3: 0x0040, + 0x698: 0x0040, 0x699: 0x01c1, 0x69a: 0x01c9, 0x69b: 0x01d1, 0x69c: 0x0008, 0x69d: 0x0040, + 0x69e: 0x01d9, 0x69f: 0x0040, 0x6a0: 0x0040, 0x6a1: 0x0040, 0x6a2: 0x0040, 0x6a3: 0x0040, 0x6a4: 0x0040, 0x6a5: 0x0040, 0x6a6: 0x0008, 0x6a7: 0x0008, 0x6a8: 0x0008, 0x6a9: 0x0008, 0x6aa: 0x0008, 0x6ab: 0x0008, 0x6ac: 0x0008, 0x6ad: 0x0008, 0x6ae: 0x0008, 0x6af: 0x0008, 0x6b0: 0x3308, 0x6b1: 0x3308, 0x6b2: 0x0008, 0x6b3: 0x0008, 0x6b4: 0x0008, 0x6b5: 0x3308, @@ -922,7 +1065,7 @@ var idnaValues = [8192]uint16{ 0x786: 0x0040, 0x787: 0x3008, 0x788: 0x3008, 0x789: 0x0040, 0x78a: 0x0040, 0x78b: 0x3008, 0x78c: 0x3008, 0x78d: 0x3b08, 0x78e: 0x0040, 0x78f: 0x0040, 0x790: 0x0040, 0x791: 0x0040, 0x792: 0x0040, 0x793: 0x0040, 0x794: 0x0040, 0x795: 0x3308, 0x796: 0x3308, 0x797: 0x3008, - 0x798: 0x0040, 0x799: 0x0040, 0x79a: 0x0040, 0x79b: 0x0040, 0x79c: 0x0881, 0x79d: 0x08b9, + 0x798: 0x0040, 0x799: 0x0040, 0x79a: 0x0040, 0x79b: 0x0040, 0x79c: 0x01e1, 0x79d: 0x01e9, 0x79e: 0x0040, 0x79f: 0x0008, 0x7a0: 0x0008, 0x7a1: 0x0008, 0x7a2: 0x3308, 0x7a3: 0x3308, 0x7a4: 0x0040, 0x7a5: 0x0040, 0x7a6: 0x0008, 0x7a7: 0x0008, 0x7a8: 0x0008, 0x7a9: 0x0008, 0x7aa: 0x0008, 0x7ab: 0x0008, 0x7ac: 0x0008, 0x7ad: 0x0008, 0x7ae: 0x0008, 0x7af: 0x0008, @@ -998,32 +1141,32 @@ var idnaValues = [8192]uint16{ 0x91e: 0x0008, 0x91f: 0x0008, 0x920: 0x0008, 0x921: 0x0008, 0x922: 0x0008, 0x923: 0x0008, 0x924: 0x0040, 0x925: 0x0008, 0x926: 0x0040, 0x927: 0x0008, 0x928: 0x0008, 0x929: 0x0008, 0x92a: 0x0008, 0x92b: 0x0008, 0x92c: 0x0008, 0x92d: 0x0008, 0x92e: 0x0008, 0x92f: 0x0008, - 0x930: 0x0008, 0x931: 0x3308, 0x932: 0x0008, 0x933: 0x0929, 0x934: 0x3308, 0x935: 0x3308, + 0x930: 0x0008, 0x931: 0x3308, 0x932: 0x0008, 0x933: 0x01f9, 0x934: 0x3308, 0x935: 0x3308, 0x936: 0x3308, 0x937: 0x3308, 0x938: 0x3308, 0x939: 0x3308, 0x93a: 0x3b08, 0x93b: 0x3308, 0x93c: 0x3308, 0x93d: 0x0008, 0x93e: 0x0040, 0x93f: 0x0040, // Block 0x25, offset 0x940 - 0x940: 0x0008, 0x941: 0x0008, 0x942: 0x0008, 0x943: 0x09d1, 0x944: 0x0008, 0x945: 0x0008, + 0x940: 0x0008, 0x941: 0x0008, 0x942: 0x0008, 0x943: 0x0211, 0x944: 0x0008, 0x945: 0x0008, 0x946: 0x0008, 0x947: 0x0008, 0x948: 0x0040, 0x949: 0x0008, 0x94a: 0x0008, 0x94b: 0x0008, - 0x94c: 0x0008, 0x94d: 0x0a09, 0x94e: 0x0008, 0x94f: 0x0008, 0x950: 0x0008, 0x951: 0x0008, - 0x952: 0x0a41, 0x953: 0x0008, 0x954: 0x0008, 0x955: 0x0008, 0x956: 0x0008, 0x957: 0x0a79, - 0x958: 0x0008, 0x959: 0x0008, 0x95a: 0x0008, 0x95b: 0x0008, 0x95c: 0x0ab1, 0x95d: 0x0008, + 0x94c: 0x0008, 0x94d: 0x0219, 0x94e: 0x0008, 0x94f: 0x0008, 0x950: 0x0008, 0x951: 0x0008, + 0x952: 0x0221, 0x953: 0x0008, 0x954: 0x0008, 0x955: 0x0008, 0x956: 0x0008, 0x957: 0x0229, + 0x958: 0x0008, 0x959: 0x0008, 0x95a: 0x0008, 0x95b: 0x0008, 0x95c: 0x0231, 0x95d: 0x0008, 0x95e: 0x0008, 0x95f: 0x0008, 0x960: 0x0008, 0x961: 0x0008, 0x962: 0x0008, 0x963: 0x0008, - 0x964: 0x0008, 0x965: 0x0008, 0x966: 0x0008, 0x967: 0x0008, 0x968: 0x0008, 0x969: 0x0ae9, + 0x964: 0x0008, 0x965: 0x0008, 0x966: 0x0008, 0x967: 0x0008, 0x968: 0x0008, 0x969: 0x0239, 0x96a: 0x0008, 0x96b: 0x0008, 0x96c: 0x0008, 0x96d: 0x0040, 0x96e: 0x0040, 0x96f: 0x0040, - 0x970: 0x0040, 0x971: 0x3308, 0x972: 0x3308, 0x973: 0x0b21, 0x974: 0x3308, 0x975: 0x0b59, - 0x976: 0x0b91, 0x977: 0x0bc9, 0x978: 0x0c19, 0x979: 0x0c51, 0x97a: 0x3308, 0x97b: 0x3308, + 0x970: 0x0040, 0x971: 0x3308, 0x972: 0x3308, 0x973: 0x0241, 0x974: 0x3308, 0x975: 0x0249, + 0x976: 0x0251, 0x977: 0x0259, 0x978: 0x0261, 0x979: 0x0269, 0x97a: 0x3308, 0x97b: 0x3308, 0x97c: 0x3308, 0x97d: 0x3308, 0x97e: 0x3308, 0x97f: 0x3008, // Block 0x26, offset 0x980 - 0x980: 0x3308, 0x981: 0x0ca1, 0x982: 0x3308, 0x983: 0x3308, 0x984: 0x3b08, 0x985: 0x0018, + 0x980: 0x3308, 0x981: 0x0271, 0x982: 0x3308, 0x983: 0x3308, 0x984: 0x3b08, 0x985: 0x0018, 0x986: 0x3308, 0x987: 0x3308, 0x988: 0x0008, 0x989: 0x0008, 0x98a: 0x0008, 0x98b: 0x0008, 0x98c: 0x0008, 0x98d: 0x3308, 0x98e: 0x3308, 0x98f: 0x3308, 0x990: 0x3308, 0x991: 0x3308, - 0x992: 0x3308, 0x993: 0x0cd9, 0x994: 0x3308, 0x995: 0x3308, 0x996: 0x3308, 0x997: 0x3308, - 0x998: 0x0040, 0x999: 0x3308, 0x99a: 0x3308, 0x99b: 0x3308, 0x99c: 0x3308, 0x99d: 0x0d11, - 0x99e: 0x3308, 0x99f: 0x3308, 0x9a0: 0x3308, 0x9a1: 0x3308, 0x9a2: 0x0d49, 0x9a3: 0x3308, - 0x9a4: 0x3308, 0x9a5: 0x3308, 0x9a6: 0x3308, 0x9a7: 0x0d81, 0x9a8: 0x3308, 0x9a9: 0x3308, - 0x9aa: 0x3308, 0x9ab: 0x3308, 0x9ac: 0x0db9, 0x9ad: 0x3308, 0x9ae: 0x3308, 0x9af: 0x3308, + 0x992: 0x3308, 0x993: 0x0279, 0x994: 0x3308, 0x995: 0x3308, 0x996: 0x3308, 0x997: 0x3308, + 0x998: 0x0040, 0x999: 0x3308, 0x99a: 0x3308, 0x99b: 0x3308, 0x99c: 0x3308, 0x99d: 0x0281, + 0x99e: 0x3308, 0x99f: 0x3308, 0x9a0: 0x3308, 0x9a1: 0x3308, 0x9a2: 0x0289, 0x9a3: 0x3308, + 0x9a4: 0x3308, 0x9a5: 0x3308, 0x9a6: 0x3308, 0x9a7: 0x0291, 0x9a8: 0x3308, 0x9a9: 0x3308, + 0x9aa: 0x3308, 0x9ab: 0x3308, 0x9ac: 0x0299, 0x9ad: 0x3308, 0x9ae: 0x3308, 0x9af: 0x3308, 0x9b0: 0x3308, 0x9b1: 0x3308, 0x9b2: 0x3308, 0x9b3: 0x3308, 0x9b4: 0x3308, 0x9b5: 0x3308, - 0x9b6: 0x3308, 0x9b7: 0x3308, 0x9b8: 0x3308, 0x9b9: 0x0df1, 0x9ba: 0x3308, 0x9bb: 0x3308, + 0x9b6: 0x3308, 0x9b7: 0x3308, 0x9b8: 0x3308, 0x9b9: 0x02a1, 0x9ba: 0x3308, 0x9bb: 0x3308, 0x9bc: 0x3308, 0x9bd: 0x0040, 0x9be: 0x0018, 0x9bf: 0x0018, // Block 0x27, offset 0x9c0 0x9c0: 0x0008, 0x9c1: 0x0008, 0x9c2: 0x0008, 0x9c3: 0x0008, 0x9c4: 0x0008, 0x9c5: 0x0008, @@ -1033,34 +1176,34 @@ var idnaValues = [8192]uint16{ 0x9d8: 0x0008, 0x9d9: 0x0008, 0x9da: 0x0008, 0x9db: 0x0008, 0x9dc: 0x0008, 0x9dd: 0x0008, 0x9de: 0x0008, 0x9df: 0x0008, 0x9e0: 0x0008, 0x9e1: 0x0008, 0x9e2: 0x0008, 0x9e3: 0x0008, 0x9e4: 0x0008, 0x9e5: 0x0008, 0x9e6: 0x0008, 0x9e7: 0x0008, 0x9e8: 0x0008, 0x9e9: 0x0008, - 0x9ea: 0x0008, 0x9eb: 0x0008, 0x9ec: 0x0039, 0x9ed: 0x0ed1, 0x9ee: 0x0ee9, 0x9ef: 0x0008, - 0x9f0: 0x0ef9, 0x9f1: 0x0f09, 0x9f2: 0x0f19, 0x9f3: 0x0f31, 0x9f4: 0x0249, 0x9f5: 0x0f41, - 0x9f6: 0x0259, 0x9f7: 0x0f51, 0x9f8: 0x0359, 0x9f9: 0x0f61, 0x9fa: 0x0f71, 0x9fb: 0x0008, - 0x9fc: 0x00d9, 0x9fd: 0x0f81, 0x9fe: 0x0f99, 0x9ff: 0x0269, + 0x9ea: 0x0008, 0x9eb: 0x0008, 0x9ec: 0x0019, 0x9ed: 0x02e1, 0x9ee: 0x02e9, 0x9ef: 0x0008, + 0x9f0: 0x02f1, 0x9f1: 0x02f9, 0x9f2: 0x0301, 0x9f3: 0x0309, 0x9f4: 0x00a9, 0x9f5: 0x0311, + 0x9f6: 0x00b1, 0x9f7: 0x0319, 0x9f8: 0x0101, 0x9f9: 0x0321, 0x9fa: 0x0329, 0x9fb: 0x0008, + 0x9fc: 0x0051, 0x9fd: 0x0331, 0x9fe: 0x0339, 0x9ff: 0x00b9, // Block 0x28, offset 0xa00 - 0xa00: 0x0fa9, 0xa01: 0x0fb9, 0xa02: 0x0279, 0xa03: 0x0039, 0xa04: 0x0fc9, 0xa05: 0x0fe1, - 0xa06: 0x05b5, 0xa07: 0x0ee9, 0xa08: 0x0ef9, 0xa09: 0x0f09, 0xa0a: 0x0ff9, 0xa0b: 0x1011, - 0xa0c: 0x1029, 0xa0d: 0x0f31, 0xa0e: 0x0008, 0xa0f: 0x0f51, 0xa10: 0x0f61, 0xa11: 0x1041, - 0xa12: 0x00d9, 0xa13: 0x1059, 0xa14: 0x05cd, 0xa15: 0x05cd, 0xa16: 0x0f99, 0xa17: 0x0fa9, - 0xa18: 0x0fb9, 0xa19: 0x05b5, 0xa1a: 0x1071, 0xa1b: 0x1089, 0xa1c: 0x05e5, 0xa1d: 0x1099, - 0xa1e: 0x10b1, 0xa1f: 0x10c9, 0xa20: 0x10e1, 0xa21: 0x10f9, 0xa22: 0x0f41, 0xa23: 0x0269, - 0xa24: 0x0fb9, 0xa25: 0x1089, 0xa26: 0x1099, 0xa27: 0x10b1, 0xa28: 0x1111, 0xa29: 0x10e1, - 0xa2a: 0x10f9, 0xa2b: 0x0008, 0xa2c: 0x0008, 0xa2d: 0x0008, 0xa2e: 0x0008, 0xa2f: 0x0008, + 0xa00: 0x0341, 0xa01: 0x0349, 0xa02: 0x00c1, 0xa03: 0x0019, 0xa04: 0x0351, 0xa05: 0x0359, + 0xa06: 0x05b5, 0xa07: 0x02e9, 0xa08: 0x02f1, 0xa09: 0x02f9, 0xa0a: 0x0361, 0xa0b: 0x0369, + 0xa0c: 0x0371, 0xa0d: 0x0309, 0xa0e: 0x0008, 0xa0f: 0x0319, 0xa10: 0x0321, 0xa11: 0x0379, + 0xa12: 0x0051, 0xa13: 0x0381, 0xa14: 0x05cd, 0xa15: 0x05cd, 0xa16: 0x0339, 0xa17: 0x0341, + 0xa18: 0x0349, 0xa19: 0x05b5, 0xa1a: 0x0389, 0xa1b: 0x0391, 0xa1c: 0x05e5, 0xa1d: 0x0399, + 0xa1e: 0x03a1, 0xa1f: 0x03a9, 0xa20: 0x03b1, 0xa21: 0x03b9, 0xa22: 0x0311, 0xa23: 0x00b9, + 0xa24: 0x0349, 0xa25: 0x0391, 0xa26: 0x0399, 0xa27: 0x03a1, 0xa28: 0x03c1, 0xa29: 0x03b1, + 0xa2a: 0x03b9, 0xa2b: 0x0008, 0xa2c: 0x0008, 0xa2d: 0x0008, 0xa2e: 0x0008, 0xa2f: 0x0008, 0xa30: 0x0008, 0xa31: 0x0008, 0xa32: 0x0008, 0xa33: 0x0008, 0xa34: 0x0008, 0xa35: 0x0008, - 0xa36: 0x0008, 0xa37: 0x0008, 0xa38: 0x1129, 0xa39: 0x0008, 0xa3a: 0x0008, 0xa3b: 0x0008, + 0xa36: 0x0008, 0xa37: 0x0008, 0xa38: 0x03c9, 0xa39: 0x0008, 0xa3a: 0x0008, 0xa3b: 0x0008, 0xa3c: 0x0008, 0xa3d: 0x0008, 0xa3e: 0x0008, 0xa3f: 0x0008, // Block 0x29, offset 0xa40 0xa40: 0x0008, 0xa41: 0x0008, 0xa42: 0x0008, 0xa43: 0x0008, 0xa44: 0x0008, 0xa45: 0x0008, 0xa46: 0x0008, 0xa47: 0x0008, 0xa48: 0x0008, 0xa49: 0x0008, 0xa4a: 0x0008, 0xa4b: 0x0008, 0xa4c: 0x0008, 0xa4d: 0x0008, 0xa4e: 0x0008, 0xa4f: 0x0008, 0xa50: 0x0008, 0xa51: 0x0008, 0xa52: 0x0008, 0xa53: 0x0008, 0xa54: 0x0008, 0xa55: 0x0008, 0xa56: 0x0008, 0xa57: 0x0008, - 0xa58: 0x0008, 0xa59: 0x0008, 0xa5a: 0x0008, 0xa5b: 0x1141, 0xa5c: 0x1159, 0xa5d: 0x1169, - 0xa5e: 0x1181, 0xa5f: 0x1029, 0xa60: 0x1199, 0xa61: 0x11a9, 0xa62: 0x11c1, 0xa63: 0x11d9, - 0xa64: 0x11f1, 0xa65: 0x1209, 0xa66: 0x1221, 0xa67: 0x05fd, 0xa68: 0x1239, 0xa69: 0x1251, - 0xa6a: 0xe17d, 0xa6b: 0x1269, 0xa6c: 0x1281, 0xa6d: 0x1299, 0xa6e: 0x12b1, 0xa6f: 0x12c9, - 0xa70: 0x12e1, 0xa71: 0x12f9, 0xa72: 0x1311, 0xa73: 0x1329, 0xa74: 0x1341, 0xa75: 0x1359, - 0xa76: 0x1371, 0xa77: 0x1389, 0xa78: 0x0615, 0xa79: 0x13a1, 0xa7a: 0x13b9, 0xa7b: 0x13d1, - 0xa7c: 0x13e1, 0xa7d: 0x13f9, 0xa7e: 0x1411, 0xa7f: 0x1429, + 0xa58: 0x0008, 0xa59: 0x0008, 0xa5a: 0x0008, 0xa5b: 0x03d1, 0xa5c: 0x03d9, 0xa5d: 0x03e1, + 0xa5e: 0x03e9, 0xa5f: 0x0371, 0xa60: 0x03f1, 0xa61: 0x03f9, 0xa62: 0x0401, 0xa63: 0x0409, + 0xa64: 0x0411, 0xa65: 0x0419, 0xa66: 0x0421, 0xa67: 0x05fd, 0xa68: 0x0429, 0xa69: 0x0431, + 0xa6a: 0xe17d, 0xa6b: 0x0439, 0xa6c: 0x0441, 0xa6d: 0x0449, 0xa6e: 0x0451, 0xa6f: 0x0459, + 0xa70: 0x0461, 0xa71: 0x0469, 0xa72: 0x0471, 0xa73: 0x0479, 0xa74: 0x0481, 0xa75: 0x0489, + 0xa76: 0x0491, 0xa77: 0x0499, 0xa78: 0x0615, 0xa79: 0x04a1, 0xa7a: 0x04a9, 0xa7b: 0x04b1, + 0xa7c: 0x04b9, 0xa7d: 0x04c1, 0xa7e: 0x04c9, 0xa7f: 0x04d1, // Block 0x2a, offset 0xa80 0xa80: 0xe00d, 0xa81: 0x0008, 0xa82: 0xe00d, 0xa83: 0x0008, 0xa84: 0xe00d, 0xa85: 0x0008, 0xa86: 0xe00d, 0xa87: 0x0008, 0xa88: 0xe00d, 0xa89: 0x0008, 0xa8a: 0xe00d, 0xa8b: 0x0008, @@ -1079,7 +1222,7 @@ var idnaValues = [8192]uint16{ 0xacc: 0xe00d, 0xacd: 0x0008, 0xace: 0xe00d, 0xacf: 0x0008, 0xad0: 0xe00d, 0xad1: 0x0008, 0xad2: 0xe00d, 0xad3: 0x0008, 0xad4: 0xe00d, 0xad5: 0x0008, 0xad6: 0x0008, 0xad7: 0x0008, 0xad8: 0x0008, 0xad9: 0x0008, 0xada: 0x062d, 0xadb: 0x064d, 0xadc: 0x0008, 0xadd: 0x0008, - 0xade: 0x1441, 0xadf: 0x0008, 0xae0: 0xe00d, 0xae1: 0x0008, 0xae2: 0xe00d, 0xae3: 0x0008, + 0xade: 0x04d9, 0xadf: 0x0008, 0xae0: 0xe00d, 0xae1: 0x0008, 0xae2: 0xe00d, 0xae3: 0x0008, 0xae4: 0xe00d, 0xae5: 0x0008, 0xae6: 0xe00d, 0xae7: 0x0008, 0xae8: 0xe00d, 0xae9: 0x0008, 0xaea: 0xe00d, 0xaeb: 0x0008, 0xaec: 0xe00d, 0xaed: 0x0008, 0xaee: 0xe00d, 0xaef: 0x0008, 0xaf0: 0xe00d, 0xaf1: 0x0008, 0xaf2: 0xe00d, 0xaf3: 0x0008, 0xaf4: 0xe00d, 0xaf5: 0x0008, @@ -1094,33 +1237,33 @@ var idnaValues = [8192]uint16{ 0xb1e: 0x0040, 0xb1f: 0xe045, 0xb20: 0x0008, 0xb21: 0x0008, 0xb22: 0x0008, 0xb23: 0x0008, 0xb24: 0x0008, 0xb25: 0x0008, 0xb26: 0x0008, 0xb27: 0x0008, 0xb28: 0xe045, 0xb29: 0xe045, 0xb2a: 0xe045, 0xb2b: 0xe045, 0xb2c: 0xe045, 0xb2d: 0xe045, 0xb2e: 0xe045, 0xb2f: 0xe045, - 0xb30: 0x0008, 0xb31: 0x1459, 0xb32: 0x0008, 0xb33: 0x1471, 0xb34: 0x0008, 0xb35: 0x1489, - 0xb36: 0x0008, 0xb37: 0x14a1, 0xb38: 0x0008, 0xb39: 0x14b9, 0xb3a: 0x0008, 0xb3b: 0x14d1, - 0xb3c: 0x0008, 0xb3d: 0x14e9, 0xb3e: 0x0040, 0xb3f: 0x0040, + 0xb30: 0x0008, 0xb31: 0x04e1, 0xb32: 0x0008, 0xb33: 0x04e9, 0xb34: 0x0008, 0xb35: 0x04f1, + 0xb36: 0x0008, 0xb37: 0x04f9, 0xb38: 0x0008, 0xb39: 0x0501, 0xb3a: 0x0008, 0xb3b: 0x0509, + 0xb3c: 0x0008, 0xb3d: 0x0511, 0xb3e: 0x0040, 0xb3f: 0x0040, // Block 0x2d, offset 0xb40 - 0xb40: 0x1501, 0xb41: 0x1531, 0xb42: 0x1561, 0xb43: 0x1591, 0xb44: 0x15c1, 0xb45: 0x15f1, - 0xb46: 0x1621, 0xb47: 0x1651, 0xb48: 0x1501, 0xb49: 0x1531, 0xb4a: 0x1561, 0xb4b: 0x1591, - 0xb4c: 0x15c1, 0xb4d: 0x15f1, 0xb4e: 0x1621, 0xb4f: 0x1651, 0xb50: 0x1681, 0xb51: 0x16b1, - 0xb52: 0x16e1, 0xb53: 0x1711, 0xb54: 0x1741, 0xb55: 0x1771, 0xb56: 0x17a1, 0xb57: 0x17d1, - 0xb58: 0x1681, 0xb59: 0x16b1, 0xb5a: 0x16e1, 0xb5b: 0x1711, 0xb5c: 0x1741, 0xb5d: 0x1771, - 0xb5e: 0x17a1, 0xb5f: 0x17d1, 0xb60: 0x1801, 0xb61: 0x1831, 0xb62: 0x1861, 0xb63: 0x1891, - 0xb64: 0x18c1, 0xb65: 0x18f1, 0xb66: 0x1921, 0xb67: 0x1951, 0xb68: 0x1801, 0xb69: 0x1831, - 0xb6a: 0x1861, 0xb6b: 0x1891, 0xb6c: 0x18c1, 0xb6d: 0x18f1, 0xb6e: 0x1921, 0xb6f: 0x1951, - 0xb70: 0x0008, 0xb71: 0x0008, 0xb72: 0x1981, 0xb73: 0x19b1, 0xb74: 0x19d9, 0xb75: 0x0040, - 0xb76: 0x0008, 0xb77: 0x1a01, 0xb78: 0xe045, 0xb79: 0xe045, 0xb7a: 0x0665, 0xb7b: 0x1459, - 0xb7c: 0x19b1, 0xb7d: 0x067e, 0xb7e: 0x1a31, 0xb7f: 0x069e, + 0xb40: 0x0519, 0xb41: 0x0521, 0xb42: 0x0529, 0xb43: 0x0531, 0xb44: 0x0539, 0xb45: 0x0541, + 0xb46: 0x0549, 0xb47: 0x0551, 0xb48: 0x0519, 0xb49: 0x0521, 0xb4a: 0x0529, 0xb4b: 0x0531, + 0xb4c: 0x0539, 0xb4d: 0x0541, 0xb4e: 0x0549, 0xb4f: 0x0551, 0xb50: 0x0559, 0xb51: 0x0561, + 0xb52: 0x0569, 0xb53: 0x0571, 0xb54: 0x0579, 0xb55: 0x0581, 0xb56: 0x0589, 0xb57: 0x0591, + 0xb58: 0x0559, 0xb59: 0x0561, 0xb5a: 0x0569, 0xb5b: 0x0571, 0xb5c: 0x0579, 0xb5d: 0x0581, + 0xb5e: 0x0589, 0xb5f: 0x0591, 0xb60: 0x0599, 0xb61: 0x05a1, 0xb62: 0x05a9, 0xb63: 0x05b1, + 0xb64: 0x05b9, 0xb65: 0x05c1, 0xb66: 0x05c9, 0xb67: 0x05d1, 0xb68: 0x0599, 0xb69: 0x05a1, + 0xb6a: 0x05a9, 0xb6b: 0x05b1, 0xb6c: 0x05b9, 0xb6d: 0x05c1, 0xb6e: 0x05c9, 0xb6f: 0x05d1, + 0xb70: 0x0008, 0xb71: 0x0008, 0xb72: 0x05d9, 0xb73: 0x05e1, 0xb74: 0x05e9, 0xb75: 0x0040, + 0xb76: 0x0008, 0xb77: 0x05f1, 0xb78: 0xe045, 0xb79: 0xe045, 0xb7a: 0x0665, 0xb7b: 0x04e1, + 0xb7c: 0x05e1, 0xb7d: 0x067e, 0xb7e: 0x05f9, 0xb7f: 0x069e, // Block 0x2e, offset 0xb80 - 0xb80: 0x06be, 0xb81: 0x1a4a, 0xb82: 0x1a79, 0xb83: 0x1aa9, 0xb84: 0x1ad1, 0xb85: 0x0040, - 0xb86: 0x0008, 0xb87: 0x1af9, 0xb88: 0x06dd, 0xb89: 0x1471, 0xb8a: 0x06f5, 0xb8b: 0x1489, - 0xb8c: 0x1aa9, 0xb8d: 0x1b2a, 0xb8e: 0x1b5a, 0xb8f: 0x1b8a, 0xb90: 0x0008, 0xb91: 0x0008, - 0xb92: 0x0008, 0xb93: 0x1bb9, 0xb94: 0x0040, 0xb95: 0x0040, 0xb96: 0x0008, 0xb97: 0x0008, - 0xb98: 0xe045, 0xb99: 0xe045, 0xb9a: 0x070d, 0xb9b: 0x14a1, 0xb9c: 0x0040, 0xb9d: 0x1bd2, - 0xb9e: 0x1c02, 0xb9f: 0x1c32, 0xba0: 0x0008, 0xba1: 0x0008, 0xba2: 0x0008, 0xba3: 0x1c61, + 0xb80: 0x06be, 0xb81: 0x0602, 0xb82: 0x0609, 0xb83: 0x0611, 0xb84: 0x0619, 0xb85: 0x0040, + 0xb86: 0x0008, 0xb87: 0x0621, 0xb88: 0x06dd, 0xb89: 0x04e9, 0xb8a: 0x06f5, 0xb8b: 0x04f1, + 0xb8c: 0x0611, 0xb8d: 0x062a, 0xb8e: 0x0632, 0xb8f: 0x063a, 0xb90: 0x0008, 0xb91: 0x0008, + 0xb92: 0x0008, 0xb93: 0x0641, 0xb94: 0x0040, 0xb95: 0x0040, 0xb96: 0x0008, 0xb97: 0x0008, + 0xb98: 0xe045, 0xb99: 0xe045, 0xb9a: 0x070d, 0xb9b: 0x04f9, 0xb9c: 0x0040, 0xb9d: 0x064a, + 0xb9e: 0x0652, 0xb9f: 0x065a, 0xba0: 0x0008, 0xba1: 0x0008, 0xba2: 0x0008, 0xba3: 0x0661, 0xba4: 0x0008, 0xba5: 0x0008, 0xba6: 0x0008, 0xba7: 0x0008, 0xba8: 0xe045, 0xba9: 0xe045, - 0xbaa: 0x0725, 0xbab: 0x14d1, 0xbac: 0xe04d, 0xbad: 0x1c7a, 0xbae: 0x03d2, 0xbaf: 0x1caa, - 0xbb0: 0x0040, 0xbb1: 0x0040, 0xbb2: 0x1cb9, 0xbb3: 0x1ce9, 0xbb4: 0x1d11, 0xbb5: 0x0040, - 0xbb6: 0x0008, 0xbb7: 0x1d39, 0xbb8: 0x073d, 0xbb9: 0x14b9, 0xbba: 0x0515, 0xbbb: 0x14e9, - 0xbbc: 0x1ce9, 0xbbd: 0x0756, 0xbbe: 0x0776, 0xbbf: 0x0040, + 0xbaa: 0x0725, 0xbab: 0x0509, 0xbac: 0xe04d, 0xbad: 0x066a, 0xbae: 0x012a, 0xbaf: 0x0672, + 0xbb0: 0x0040, 0xbb1: 0x0040, 0xbb2: 0x0679, 0xbb3: 0x0681, 0xbb4: 0x0689, 0xbb5: 0x0040, + 0xbb6: 0x0008, 0xbb7: 0x0691, 0xbb8: 0x073d, 0xbb9: 0x0501, 0xbba: 0x0515, 0xbbb: 0x0511, + 0xbbc: 0x0681, 0xbbd: 0x0756, 0xbbe: 0x0776, 0xbbf: 0x0040, // Block 0x2f, offset 0xbc0 0xbc0: 0x000a, 0xbc1: 0x000a, 0xbc2: 0x000a, 0xbc3: 0x000a, 0xbc4: 0x000a, 0xbc5: 0x000a, 0xbc6: 0x000a, 0xbc7: 0x000a, 0xbc8: 0x000a, 0xbc9: 0x000a, 0xbca: 0x000a, 0xbcb: 0x03c0, @@ -1130,72 +1273,72 @@ var idnaValues = [8192]uint16{ 0xbde: 0x0018, 0xbdf: 0x0018, 0xbe0: 0x0018, 0xbe1: 0x0018, 0xbe2: 0x0018, 0xbe3: 0x0018, 0xbe4: 0x0040, 0xbe5: 0x0040, 0xbe6: 0x0040, 0xbe7: 0x0018, 0xbe8: 0x0040, 0xbe9: 0x0040, 0xbea: 0x0340, 0xbeb: 0x0340, 0xbec: 0x0340, 0xbed: 0x0340, 0xbee: 0x0340, 0xbef: 0x000a, - 0xbf0: 0x0018, 0xbf1: 0x0018, 0xbf2: 0x0018, 0xbf3: 0x1d69, 0xbf4: 0x1da1, 0xbf5: 0x0018, - 0xbf6: 0x1df1, 0xbf7: 0x1e29, 0xbf8: 0x0018, 0xbf9: 0x0018, 0xbfa: 0x0018, 0xbfb: 0x0018, - 0xbfc: 0x1e7a, 0xbfd: 0x0018, 0xbfe: 0x07b6, 0xbff: 0x0018, + 0xbf0: 0x0018, 0xbf1: 0x0018, 0xbf2: 0x0018, 0xbf3: 0x0699, 0xbf4: 0x06a1, 0xbf5: 0x0018, + 0xbf6: 0x06a9, 0xbf7: 0x06b1, 0xbf8: 0x0018, 0xbf9: 0x0018, 0xbfa: 0x0018, 0xbfb: 0x0018, + 0xbfc: 0x06ba, 0xbfd: 0x0018, 0xbfe: 0x07b6, 0xbff: 0x0018, // Block 0x30, offset 0xc00 0xc00: 0x0018, 0xc01: 0x0018, 0xc02: 0x0018, 0xc03: 0x0018, 0xc04: 0x0018, 0xc05: 0x0018, - 0xc06: 0x0018, 0xc07: 0x1e92, 0xc08: 0x1eaa, 0xc09: 0x1ec2, 0xc0a: 0x0018, 0xc0b: 0x0018, + 0xc06: 0x0018, 0xc07: 0x06c2, 0xc08: 0x06ca, 0xc09: 0x06d2, 0xc0a: 0x0018, 0xc0b: 0x0018, 0xc0c: 0x0018, 0xc0d: 0x0018, 0xc0e: 0x0018, 0xc0f: 0x0018, 0xc10: 0x0018, 0xc11: 0x0018, - 0xc12: 0x0018, 0xc13: 0x0018, 0xc14: 0x0018, 0xc15: 0x0018, 0xc16: 0x0018, 0xc17: 0x1ed9, + 0xc12: 0x0018, 0xc13: 0x0018, 0xc14: 0x0018, 0xc15: 0x0018, 0xc16: 0x0018, 0xc17: 0x06d9, 0xc18: 0x0018, 0xc19: 0x0018, 0xc1a: 0x0018, 0xc1b: 0x0018, 0xc1c: 0x0018, 0xc1d: 0x0018, 0xc1e: 0x0018, 0xc1f: 0x000a, 0xc20: 0x03c0, 0xc21: 0x0340, 0xc22: 0x0340, 0xc23: 0x0340, 0xc24: 0x03c0, 0xc25: 0x0040, 0xc26: 0x0040, 0xc27: 0x0040, 0xc28: 0x0040, 0xc29: 0x0040, 0xc2a: 0x0340, 0xc2b: 0x0340, 0xc2c: 0x0340, 0xc2d: 0x0340, 0xc2e: 0x0340, 0xc2f: 0x0340, - 0xc30: 0x1f41, 0xc31: 0x0f41, 0xc32: 0x0040, 0xc33: 0x0040, 0xc34: 0x1f51, 0xc35: 0x1f61, - 0xc36: 0x1f71, 0xc37: 0x1f81, 0xc38: 0x1f91, 0xc39: 0x1fa1, 0xc3a: 0x1fb2, 0xc3b: 0x07d5, - 0xc3c: 0x1fc2, 0xc3d: 0x1fd2, 0xc3e: 0x1fe2, 0xc3f: 0x0f71, + 0xc30: 0x06e1, 0xc31: 0x0311, 0xc32: 0x0040, 0xc33: 0x0040, 0xc34: 0x06e9, 0xc35: 0x06f1, + 0xc36: 0x06f9, 0xc37: 0x0701, 0xc38: 0x0709, 0xc39: 0x0711, 0xc3a: 0x071a, 0xc3b: 0x07d5, + 0xc3c: 0x0722, 0xc3d: 0x072a, 0xc3e: 0x0732, 0xc3f: 0x0329, // Block 0x31, offset 0xc40 - 0xc40: 0x1f41, 0xc41: 0x00c9, 0xc42: 0x0069, 0xc43: 0x0079, 0xc44: 0x1f51, 0xc45: 0x1f61, - 0xc46: 0x1f71, 0xc47: 0x1f81, 0xc48: 0x1f91, 0xc49: 0x1fa1, 0xc4a: 0x1fb2, 0xc4b: 0x07ed, - 0xc4c: 0x1fc2, 0xc4d: 0x1fd2, 0xc4e: 0x1fe2, 0xc4f: 0x0040, 0xc50: 0x0039, 0xc51: 0x0f09, - 0xc52: 0x00d9, 0xc53: 0x0369, 0xc54: 0x0ff9, 0xc55: 0x0249, 0xc56: 0x0f51, 0xc57: 0x0359, - 0xc58: 0x0f61, 0xc59: 0x0f71, 0xc5a: 0x0f99, 0xc5b: 0x01d9, 0xc5c: 0x0fa9, 0xc5d: 0x0040, + 0xc40: 0x06e1, 0xc41: 0x0049, 0xc42: 0x0029, 0xc43: 0x0031, 0xc44: 0x06e9, 0xc45: 0x06f1, + 0xc46: 0x06f9, 0xc47: 0x0701, 0xc48: 0x0709, 0xc49: 0x0711, 0xc4a: 0x071a, 0xc4b: 0x07ed, + 0xc4c: 0x0722, 0xc4d: 0x072a, 0xc4e: 0x0732, 0xc4f: 0x0040, 0xc50: 0x0019, 0xc51: 0x02f9, + 0xc52: 0x0051, 0xc53: 0x0109, 0xc54: 0x0361, 0xc55: 0x00a9, 0xc56: 0x0319, 0xc57: 0x0101, + 0xc58: 0x0321, 0xc59: 0x0329, 0xc5a: 0x0339, 0xc5b: 0x0089, 0xc5c: 0x0341, 0xc5d: 0x0040, 0xc5e: 0x0040, 0xc5f: 0x0040, 0xc60: 0x0018, 0xc61: 0x0018, 0xc62: 0x0018, 0xc63: 0x0018, - 0xc64: 0x0018, 0xc65: 0x0018, 0xc66: 0x0018, 0xc67: 0x0018, 0xc68: 0x1ff1, 0xc69: 0x0018, + 0xc64: 0x0018, 0xc65: 0x0018, 0xc66: 0x0018, 0xc67: 0x0018, 0xc68: 0x0739, 0xc69: 0x0018, 0xc6a: 0x0018, 0xc6b: 0x0018, 0xc6c: 0x0018, 0xc6d: 0x0018, 0xc6e: 0x0018, 0xc6f: 0x0018, 0xc70: 0x0018, 0xc71: 0x0018, 0xc72: 0x0018, 0xc73: 0x0018, 0xc74: 0x0018, 0xc75: 0x0018, 0xc76: 0x0018, 0xc77: 0x0018, 0xc78: 0x0018, 0xc79: 0x0018, 0xc7a: 0x0018, 0xc7b: 0x0018, 0xc7c: 0x0018, 0xc7d: 0x0018, 0xc7e: 0x0018, 0xc7f: 0x0018, // Block 0x32, offset 0xc80 - 0xc80: 0x0806, 0xc81: 0x0826, 0xc82: 0x1159, 0xc83: 0x0845, 0xc84: 0x0018, 0xc85: 0x0866, - 0xc86: 0x0886, 0xc87: 0x1011, 0xc88: 0x0018, 0xc89: 0x08a5, 0xc8a: 0x0f31, 0xc8b: 0x0249, - 0xc8c: 0x0249, 0xc8d: 0x0249, 0xc8e: 0x0249, 0xc8f: 0x2009, 0xc90: 0x0f41, 0xc91: 0x0f41, - 0xc92: 0x0359, 0xc93: 0x0359, 0xc94: 0x0018, 0xc95: 0x0f71, 0xc96: 0x2021, 0xc97: 0x0018, - 0xc98: 0x0018, 0xc99: 0x0f99, 0xc9a: 0x2039, 0xc9b: 0x0269, 0xc9c: 0x0269, 0xc9d: 0x0269, - 0xc9e: 0x0018, 0xc9f: 0x0018, 0xca0: 0x2049, 0xca1: 0x08c5, 0xca2: 0x2061, 0xca3: 0x0018, - 0xca4: 0x13d1, 0xca5: 0x0018, 0xca6: 0x2079, 0xca7: 0x0018, 0xca8: 0x13d1, 0xca9: 0x0018, - 0xcaa: 0x0f51, 0xcab: 0x2091, 0xcac: 0x0ee9, 0xcad: 0x1159, 0xcae: 0x0018, 0xcaf: 0x0f09, - 0xcb0: 0x0f09, 0xcb1: 0x1199, 0xcb2: 0x0040, 0xcb3: 0x0f61, 0xcb4: 0x00d9, 0xcb5: 0x20a9, - 0xcb6: 0x20c1, 0xcb7: 0x20d9, 0xcb8: 0x20f1, 0xcb9: 0x0f41, 0xcba: 0x0018, 0xcbb: 0x08e5, - 0xcbc: 0x2109, 0xcbd: 0x10b1, 0xcbe: 0x10b1, 0xcbf: 0x2109, + 0xc80: 0x0806, 0xc81: 0x0826, 0xc82: 0x03d9, 0xc83: 0x0845, 0xc84: 0x0018, 0xc85: 0x0866, + 0xc86: 0x0886, 0xc87: 0x0369, 0xc88: 0x0018, 0xc89: 0x08a5, 0xc8a: 0x0309, 0xc8b: 0x00a9, + 0xc8c: 0x00a9, 0xc8d: 0x00a9, 0xc8e: 0x00a9, 0xc8f: 0x0741, 0xc90: 0x0311, 0xc91: 0x0311, + 0xc92: 0x0101, 0xc93: 0x0101, 0xc94: 0x0018, 0xc95: 0x0329, 0xc96: 0x0749, 0xc97: 0x0018, + 0xc98: 0x0018, 0xc99: 0x0339, 0xc9a: 0x0751, 0xc9b: 0x00b9, 0xc9c: 0x00b9, 0xc9d: 0x00b9, + 0xc9e: 0x0018, 0xc9f: 0x0018, 0xca0: 0x0759, 0xca1: 0x08c5, 0xca2: 0x0761, 0xca3: 0x0018, + 0xca4: 0x04b1, 0xca5: 0x0018, 0xca6: 0x0769, 0xca7: 0x0018, 0xca8: 0x04b1, 0xca9: 0x0018, + 0xcaa: 0x0319, 0xcab: 0x0771, 0xcac: 0x02e9, 0xcad: 0x03d9, 0xcae: 0x0018, 0xcaf: 0x02f9, + 0xcb0: 0x02f9, 0xcb1: 0x03f1, 0xcb2: 0x0040, 0xcb3: 0x0321, 0xcb4: 0x0051, 0xcb5: 0x0779, + 0xcb6: 0x0781, 0xcb7: 0x0789, 0xcb8: 0x0791, 0xcb9: 0x0311, 0xcba: 0x0018, 0xcbb: 0x08e5, + 0xcbc: 0x0799, 0xcbd: 0x03a1, 0xcbe: 0x03a1, 0xcbf: 0x0799, // Block 0x33, offset 0xcc0 - 0xcc0: 0x0905, 0xcc1: 0x0018, 0xcc2: 0x0018, 0xcc3: 0x0018, 0xcc4: 0x0018, 0xcc5: 0x0ef9, - 0xcc6: 0x0ef9, 0xcc7: 0x0f09, 0xcc8: 0x0f41, 0xcc9: 0x0259, 0xcca: 0x0018, 0xccb: 0x0018, - 0xccc: 0x0018, 0xccd: 0x0018, 0xcce: 0x0008, 0xccf: 0x0018, 0xcd0: 0x2121, 0xcd1: 0x2151, - 0xcd2: 0x2181, 0xcd3: 0x21b9, 0xcd4: 0x21e9, 0xcd5: 0x2219, 0xcd6: 0x2249, 0xcd7: 0x2279, - 0xcd8: 0x22a9, 0xcd9: 0x22d9, 0xcda: 0x2309, 0xcdb: 0x2339, 0xcdc: 0x2369, 0xcdd: 0x2399, - 0xcde: 0x23c9, 0xcdf: 0x23f9, 0xce0: 0x0f41, 0xce1: 0x2421, 0xce2: 0x091d, 0xce3: 0x2439, - 0xce4: 0x1089, 0xce5: 0x2451, 0xce6: 0x093d, 0xce7: 0x2469, 0xce8: 0x2491, 0xce9: 0x0369, - 0xcea: 0x24a9, 0xceb: 0x095d, 0xcec: 0x0359, 0xced: 0x1159, 0xcee: 0x0ef9, 0xcef: 0x0f61, - 0xcf0: 0x0f41, 0xcf1: 0x2421, 0xcf2: 0x097d, 0xcf3: 0x2439, 0xcf4: 0x1089, 0xcf5: 0x2451, - 0xcf6: 0x099d, 0xcf7: 0x2469, 0xcf8: 0x2491, 0xcf9: 0x0369, 0xcfa: 0x24a9, 0xcfb: 0x09bd, - 0xcfc: 0x0359, 0xcfd: 0x1159, 0xcfe: 0x0ef9, 0xcff: 0x0f61, + 0xcc0: 0x0905, 0xcc1: 0x0018, 0xcc2: 0x0018, 0xcc3: 0x0018, 0xcc4: 0x0018, 0xcc5: 0x02f1, + 0xcc6: 0x02f1, 0xcc7: 0x02f9, 0xcc8: 0x0311, 0xcc9: 0x00b1, 0xcca: 0x0018, 0xccb: 0x0018, + 0xccc: 0x0018, 0xccd: 0x0018, 0xcce: 0x0008, 0xccf: 0x0018, 0xcd0: 0x07a1, 0xcd1: 0x07a9, + 0xcd2: 0x07b1, 0xcd3: 0x07b9, 0xcd4: 0x07c1, 0xcd5: 0x07c9, 0xcd6: 0x07d1, 0xcd7: 0x07d9, + 0xcd8: 0x07e1, 0xcd9: 0x07e9, 0xcda: 0x07f1, 0xcdb: 0x07f9, 0xcdc: 0x0801, 0xcdd: 0x0809, + 0xcde: 0x0811, 0xcdf: 0x0819, 0xce0: 0x0311, 0xce1: 0x0821, 0xce2: 0x091d, 0xce3: 0x0829, + 0xce4: 0x0391, 0xce5: 0x0831, 0xce6: 0x093d, 0xce7: 0x0839, 0xce8: 0x0841, 0xce9: 0x0109, + 0xcea: 0x0849, 0xceb: 0x095d, 0xcec: 0x0101, 0xced: 0x03d9, 0xcee: 0x02f1, 0xcef: 0x0321, + 0xcf0: 0x0311, 0xcf1: 0x0821, 0xcf2: 0x097d, 0xcf3: 0x0829, 0xcf4: 0x0391, 0xcf5: 0x0831, + 0xcf6: 0x099d, 0xcf7: 0x0839, 0xcf8: 0x0841, 0xcf9: 0x0109, 0xcfa: 0x0849, 0xcfb: 0x09bd, + 0xcfc: 0x0101, 0xcfd: 0x03d9, 0xcfe: 0x02f1, 0xcff: 0x0321, // Block 0x34, offset 0xd00 0xd00: 0x0018, 0xd01: 0x0018, 0xd02: 0x0018, 0xd03: 0x0018, 0xd04: 0x0018, 0xd05: 0x0018, 0xd06: 0x0018, 0xd07: 0x0018, 0xd08: 0x0018, 0xd09: 0x0018, 0xd0a: 0x0018, 0xd0b: 0x0040, 0xd0c: 0x0040, 0xd0d: 0x0040, 0xd0e: 0x0040, 0xd0f: 0x0040, 0xd10: 0x0040, 0xd11: 0x0040, 0xd12: 0x0040, 0xd13: 0x0040, 0xd14: 0x0040, 0xd15: 0x0040, 0xd16: 0x0040, 0xd17: 0x0040, 0xd18: 0x0040, 0xd19: 0x0040, 0xd1a: 0x0040, 0xd1b: 0x0040, 0xd1c: 0x0040, 0xd1d: 0x0040, - 0xd1e: 0x0040, 0xd1f: 0x0040, 0xd20: 0x00c9, 0xd21: 0x0069, 0xd22: 0x0079, 0xd23: 0x1f51, - 0xd24: 0x1f61, 0xd25: 0x1f71, 0xd26: 0x1f81, 0xd27: 0x1f91, 0xd28: 0x1fa1, 0xd29: 0x2601, - 0xd2a: 0x2619, 0xd2b: 0x2631, 0xd2c: 0x2649, 0xd2d: 0x2661, 0xd2e: 0x2679, 0xd2f: 0x2691, - 0xd30: 0x26a9, 0xd31: 0x26c1, 0xd32: 0x26d9, 0xd33: 0x26f1, 0xd34: 0x0a1e, 0xd35: 0x0a3e, + 0xd1e: 0x0040, 0xd1f: 0x0040, 0xd20: 0x0049, 0xd21: 0x0029, 0xd22: 0x0031, 0xd23: 0x06e9, + 0xd24: 0x06f1, 0xd25: 0x06f9, 0xd26: 0x0701, 0xd27: 0x0709, 0xd28: 0x0711, 0xd29: 0x0879, + 0xd2a: 0x0881, 0xd2b: 0x0889, 0xd2c: 0x0891, 0xd2d: 0x0899, 0xd2e: 0x08a1, 0xd2f: 0x08a9, + 0xd30: 0x08b1, 0xd31: 0x08b9, 0xd32: 0x08c1, 0xd33: 0x08c9, 0xd34: 0x0a1e, 0xd35: 0x0a3e, 0xd36: 0x0a5e, 0xd37: 0x0a7e, 0xd38: 0x0a9e, 0xd39: 0x0abe, 0xd3a: 0x0ade, 0xd3b: 0x0afe, - 0xd3c: 0x0b1e, 0xd3d: 0x270a, 0xd3e: 0x2732, 0xd3f: 0x275a, + 0xd3c: 0x0b1e, 0xd3d: 0x08d2, 0xd3e: 0x08da, 0xd3f: 0x08e2, // Block 0x35, offset 0xd40 - 0xd40: 0x2782, 0xd41: 0x27aa, 0xd42: 0x27d2, 0xd43: 0x27fa, 0xd44: 0x2822, 0xd45: 0x284a, - 0xd46: 0x2872, 0xd47: 0x289a, 0xd48: 0x0040, 0xd49: 0x0040, 0xd4a: 0x0040, 0xd4b: 0x0040, + 0xd40: 0x08ea, 0xd41: 0x08f2, 0xd42: 0x08fa, 0xd43: 0x0902, 0xd44: 0x090a, 0xd45: 0x0912, + 0xd46: 0x091a, 0xd47: 0x0922, 0xd48: 0x0040, 0xd49: 0x0040, 0xd4a: 0x0040, 0xd4b: 0x0040, 0xd4c: 0x0040, 0xd4d: 0x0040, 0xd4e: 0x0040, 0xd4f: 0x0040, 0xd50: 0x0040, 0xd51: 0x0040, 0xd52: 0x0040, 0xd53: 0x0040, 0xd54: 0x0040, 0xd55: 0x0040, 0xd56: 0x0040, 0xd57: 0x0040, 0xd58: 0x0040, 0xd59: 0x0040, 0xd5a: 0x0040, 0xd5b: 0x0040, 0xd5c: 0x0b3e, 0xd5d: 0x0b5e, @@ -1203,17 +1346,17 @@ var idnaValues = [8192]uint16{ 0xd64: 0x0c3e, 0xd65: 0x0c5e, 0xd66: 0x0c7e, 0xd67: 0x0c9e, 0xd68: 0x0cbe, 0xd69: 0x0cde, 0xd6a: 0x0cfe, 0xd6b: 0x0d1e, 0xd6c: 0x0d3e, 0xd6d: 0x0d5e, 0xd6e: 0x0d7e, 0xd6f: 0x0d9e, 0xd70: 0x0dbe, 0xd71: 0x0dde, 0xd72: 0x0dfe, 0xd73: 0x0e1e, 0xd74: 0x0e3e, 0xd75: 0x0e5e, - 0xd76: 0x0039, 0xd77: 0x0ee9, 0xd78: 0x1159, 0xd79: 0x0ef9, 0xd7a: 0x0f09, 0xd7b: 0x1199, - 0xd7c: 0x0f31, 0xd7d: 0x0249, 0xd7e: 0x0f41, 0xd7f: 0x0259, + 0xd76: 0x0019, 0xd77: 0x02e9, 0xd78: 0x03d9, 0xd79: 0x02f1, 0xd7a: 0x02f9, 0xd7b: 0x03f1, + 0xd7c: 0x0309, 0xd7d: 0x00a9, 0xd7e: 0x0311, 0xd7f: 0x00b1, // Block 0x36, offset 0xd80 - 0xd80: 0x0f51, 0xd81: 0x0359, 0xd82: 0x0f61, 0xd83: 0x0f71, 0xd84: 0x00d9, 0xd85: 0x0f99, - 0xd86: 0x2039, 0xd87: 0x0269, 0xd88: 0x01d9, 0xd89: 0x0fa9, 0xd8a: 0x0fb9, 0xd8b: 0x1089, - 0xd8c: 0x0279, 0xd8d: 0x0369, 0xd8e: 0x0289, 0xd8f: 0x13d1, 0xd90: 0x0039, 0xd91: 0x0ee9, - 0xd92: 0x1159, 0xd93: 0x0ef9, 0xd94: 0x0f09, 0xd95: 0x1199, 0xd96: 0x0f31, 0xd97: 0x0249, - 0xd98: 0x0f41, 0xd99: 0x0259, 0xd9a: 0x0f51, 0xd9b: 0x0359, 0xd9c: 0x0f61, 0xd9d: 0x0f71, - 0xd9e: 0x00d9, 0xd9f: 0x0f99, 0xda0: 0x2039, 0xda1: 0x0269, 0xda2: 0x01d9, 0xda3: 0x0fa9, - 0xda4: 0x0fb9, 0xda5: 0x1089, 0xda6: 0x0279, 0xda7: 0x0369, 0xda8: 0x0289, 0xda9: 0x13d1, - 0xdaa: 0x1f41, 0xdab: 0x0018, 0xdac: 0x0018, 0xdad: 0x0018, 0xdae: 0x0018, 0xdaf: 0x0018, + 0xd80: 0x0319, 0xd81: 0x0101, 0xd82: 0x0321, 0xd83: 0x0329, 0xd84: 0x0051, 0xd85: 0x0339, + 0xd86: 0x0751, 0xd87: 0x00b9, 0xd88: 0x0089, 0xd89: 0x0341, 0xd8a: 0x0349, 0xd8b: 0x0391, + 0xd8c: 0x00c1, 0xd8d: 0x0109, 0xd8e: 0x00c9, 0xd8f: 0x04b1, 0xd90: 0x0019, 0xd91: 0x02e9, + 0xd92: 0x03d9, 0xd93: 0x02f1, 0xd94: 0x02f9, 0xd95: 0x03f1, 0xd96: 0x0309, 0xd97: 0x00a9, + 0xd98: 0x0311, 0xd99: 0x00b1, 0xd9a: 0x0319, 0xd9b: 0x0101, 0xd9c: 0x0321, 0xd9d: 0x0329, + 0xd9e: 0x0051, 0xd9f: 0x0339, 0xda0: 0x0751, 0xda1: 0x00b9, 0xda2: 0x0089, 0xda3: 0x0341, + 0xda4: 0x0349, 0xda5: 0x0391, 0xda6: 0x00c1, 0xda7: 0x0109, 0xda8: 0x00c9, 0xda9: 0x04b1, + 0xdaa: 0x06e1, 0xdab: 0x0018, 0xdac: 0x0018, 0xdad: 0x0018, 0xdae: 0x0018, 0xdaf: 0x0018, 0xdb0: 0x0018, 0xdb1: 0x0018, 0xdb2: 0x0018, 0xdb3: 0x0018, 0xdb4: 0x0018, 0xdb5: 0x0018, 0xdb6: 0x0018, 0xdb7: 0x0018, 0xdb8: 0x0018, 0xdb9: 0x0018, 0xdba: 0x0018, 0xdbb: 0x0018, 0xdbc: 0x0018, 0xdbd: 0x0018, 0xdbe: 0x0018, 0xdbf: 0x0018, @@ -1223,12 +1366,12 @@ var idnaValues = [8192]uint16{ 0xdcc: 0x0008, 0xdcd: 0x0008, 0xdce: 0x0008, 0xdcf: 0x0008, 0xdd0: 0x0008, 0xdd1: 0x0008, 0xdd2: 0x0008, 0xdd3: 0x0008, 0xdd4: 0x0008, 0xdd5: 0x0008, 0xdd6: 0x0008, 0xdd7: 0x0008, 0xdd8: 0x0008, 0xdd9: 0x0008, 0xdda: 0x0008, 0xddb: 0x0008, 0xddc: 0x0008, 0xddd: 0x0008, - 0xdde: 0x0008, 0xddf: 0x0040, 0xde0: 0xe00d, 0xde1: 0x0008, 0xde2: 0x2971, 0xde3: 0x0ed5, - 0xde4: 0x2989, 0xde5: 0x0008, 0xde6: 0x0008, 0xde7: 0xe07d, 0xde8: 0x0008, 0xde9: 0xe01d, - 0xdea: 0x0008, 0xdeb: 0xe03d, 0xdec: 0x0008, 0xded: 0x0fe1, 0xdee: 0x1281, 0xdef: 0x0fc9, - 0xdf0: 0x1141, 0xdf1: 0x0008, 0xdf2: 0xe00d, 0xdf3: 0x0008, 0xdf4: 0x0008, 0xdf5: 0xe01d, + 0xdde: 0x0008, 0xddf: 0x0040, 0xde0: 0xe00d, 0xde1: 0x0008, 0xde2: 0x0941, 0xde3: 0x0ed5, + 0xde4: 0x0949, 0xde5: 0x0008, 0xde6: 0x0008, 0xde7: 0xe07d, 0xde8: 0x0008, 0xde9: 0xe01d, + 0xdea: 0x0008, 0xdeb: 0xe03d, 0xdec: 0x0008, 0xded: 0x0359, 0xdee: 0x0441, 0xdef: 0x0351, + 0xdf0: 0x03d1, 0xdf1: 0x0008, 0xdf2: 0xe00d, 0xdf3: 0x0008, 0xdf4: 0x0008, 0xdf5: 0xe01d, 0xdf6: 0x0008, 0xdf7: 0x0008, 0xdf8: 0x0008, 0xdf9: 0x0008, 0xdfa: 0x0008, 0xdfb: 0x0008, - 0xdfc: 0x0259, 0xdfd: 0x1089, 0xdfe: 0x29a1, 0xdff: 0x29b9, + 0xdfc: 0x00b1, 0xdfd: 0x0391, 0xdfe: 0x0951, 0xdff: 0x0959, // Block 0x38, offset 0xe00 0xe00: 0xe00d, 0xe01: 0x0008, 0xe02: 0xe00d, 0xe03: 0x0008, 0xe04: 0xe00d, 0xe05: 0x0008, 0xe06: 0xe00d, 0xe07: 0x0008, 0xe08: 0xe00d, 0xe09: 0x0008, 0xe0a: 0xe00d, 0xe0b: 0x0008, @@ -1254,7 +1397,7 @@ var idnaValues = [8192]uint16{ 0xe76: 0x0040, 0xe77: 0x0040, 0xe78: 0x0040, 0xe79: 0x0040, 0xe7a: 0x0040, 0xe7b: 0x0040, 0xe7c: 0x0040, 0xe7d: 0x0040, 0xe7e: 0x0040, 0xe7f: 0x0040, // Block 0x3a, offset 0xe80 - 0xe80: 0x000a, 0xe81: 0x0018, 0xe82: 0x29d1, 0xe83: 0x0018, 0xe84: 0x0018, 0xe85: 0x0008, + 0xe80: 0x000a, 0xe81: 0x0018, 0xe82: 0x0961, 0xe83: 0x0018, 0xe84: 0x0018, 0xe85: 0x0008, 0xe86: 0x0008, 0xe87: 0x0008, 0xe88: 0x0018, 0xe89: 0x0018, 0xe8a: 0x0018, 0xe8b: 0x0018, 0xe8c: 0x0018, 0xe8d: 0x0018, 0xe8e: 0x0018, 0xe8f: 0x0018, 0xe90: 0x0018, 0xe91: 0x0018, 0xe92: 0x0018, 0xe93: 0x0018, 0xe94: 0x0018, 0xe95: 0x0018, 0xe96: 0x0018, 0xe97: 0x0018, @@ -1290,17 +1433,17 @@ var idnaValues = [8192]uint16{ 0xf36: 0x0008, 0xf37: 0x0008, 0xf38: 0x0008, 0xf39: 0x0008, 0xf3a: 0x0008, 0xf3b: 0x0008, 0xf3c: 0x0008, 0xf3d: 0x0008, 0xf3e: 0x0008, 0xf3f: 0x0008, // Block 0x3d, offset 0xf40 - 0xf40: 0x36a2, 0xf41: 0x36d2, 0xf42: 0x3702, 0xf43: 0x3732, 0xf44: 0x32d5, 0xf45: 0x32f5, + 0xf40: 0x0b82, 0xf41: 0x0b8a, 0xf42: 0x0b92, 0xf43: 0x0b9a, 0xf44: 0x32d5, 0xf45: 0x32f5, 0xf46: 0x3315, 0xf47: 0x3335, 0xf48: 0x0018, 0xf49: 0x0018, 0xf4a: 0x0018, 0xf4b: 0x0018, - 0xf4c: 0x0018, 0xf4d: 0x0018, 0xf4e: 0x0018, 0xf4f: 0x0018, 0xf50: 0x3355, 0xf51: 0x3761, - 0xf52: 0x3779, 0xf53: 0x3791, 0xf54: 0x37a9, 0xf55: 0x37c1, 0xf56: 0x37d9, 0xf57: 0x37f1, - 0xf58: 0x3809, 0xf59: 0x3821, 0xf5a: 0x3839, 0xf5b: 0x3851, 0xf5c: 0x3869, 0xf5d: 0x3881, - 0xf5e: 0x3899, 0xf5f: 0x38b1, 0xf60: 0x3375, 0xf61: 0x3395, 0xf62: 0x33b5, 0xf63: 0x33d5, + 0xf4c: 0x0018, 0xf4d: 0x0018, 0xf4e: 0x0018, 0xf4f: 0x0018, 0xf50: 0x3355, 0xf51: 0x0ba1, + 0xf52: 0x0ba9, 0xf53: 0x0bb1, 0xf54: 0x0bb9, 0xf55: 0x0bc1, 0xf56: 0x0bc9, 0xf57: 0x0bd1, + 0xf58: 0x0bd9, 0xf59: 0x0be1, 0xf5a: 0x0be9, 0xf5b: 0x0bf1, 0xf5c: 0x0bf9, 0xf5d: 0x0c01, + 0xf5e: 0x0c09, 0xf5f: 0x0c11, 0xf60: 0x3375, 0xf61: 0x3395, 0xf62: 0x33b5, 0xf63: 0x33d5, 0xf64: 0x33f5, 0xf65: 0x33f5, 0xf66: 0x3415, 0xf67: 0x3435, 0xf68: 0x3455, 0xf69: 0x3475, 0xf6a: 0x3495, 0xf6b: 0x34b5, 0xf6c: 0x34d5, 0xf6d: 0x34f5, 0xf6e: 0x3515, 0xf6f: 0x3535, 0xf70: 0x3555, 0xf71: 0x3575, 0xf72: 0x3595, 0xf73: 0x35b5, 0xf74: 0x35d5, 0xf75: 0x35f5, 0xf76: 0x3615, 0xf77: 0x3635, 0xf78: 0x3655, 0xf79: 0x3675, 0xf7a: 0x3695, 0xf7b: 0x36b5, - 0xf7c: 0x38c9, 0xf7d: 0x3901, 0xf7e: 0x36d5, 0xf7f: 0x0018, + 0xf7c: 0x0c19, 0xf7d: 0x0c21, 0xf7e: 0x36d5, 0xf7f: 0x0018, // Block 0x3e, offset 0xf80 0xf80: 0x36f5, 0xf81: 0x3715, 0xf82: 0x3735, 0xf83: 0x3755, 0xf84: 0x3775, 0xf85: 0x3795, 0xf86: 0x37b5, 0xf87: 0x37d5, 0xf88: 0x37f5, 0xf89: 0x3815, 0xf8a: 0x3835, 0xf8b: 0x3855, @@ -1310,13 +1453,13 @@ var idnaValues = [8192]uint16{ 0xf9e: 0x3ab5, 0xf9f: 0x3ad5, 0xfa0: 0x3af5, 0xfa1: 0x3b15, 0xfa2: 0x3b35, 0xfa3: 0x3b55, 0xfa4: 0x3b75, 0xfa5: 0x3b95, 0xfa6: 0x1295, 0xfa7: 0x3bb5, 0xfa8: 0x3bd5, 0xfa9: 0x3bf5, 0xfaa: 0x3c15, 0xfab: 0x3c35, 0xfac: 0x3c55, 0xfad: 0x3c75, 0xfae: 0x23b5, 0xfaf: 0x3c95, - 0xfb0: 0x3cb5, 0xfb1: 0x3939, 0xfb2: 0x3951, 0xfb3: 0x3969, 0xfb4: 0x3981, 0xfb5: 0x3999, - 0xfb6: 0x39b1, 0xfb7: 0x39c9, 0xfb8: 0x39e1, 0xfb9: 0x39f9, 0xfba: 0x3a11, 0xfbb: 0x3a29, - 0xfbc: 0x3a41, 0xfbd: 0x3a59, 0xfbe: 0x3a71, 0xfbf: 0x3a89, + 0xfb0: 0x3cb5, 0xfb1: 0x0c29, 0xfb2: 0x0c31, 0xfb3: 0x0c39, 0xfb4: 0x0c41, 0xfb5: 0x0c49, + 0xfb6: 0x0c51, 0xfb7: 0x0c59, 0xfb8: 0x0c61, 0xfb9: 0x0c69, 0xfba: 0x0c71, 0xfbb: 0x0c79, + 0xfbc: 0x0c81, 0xfbd: 0x0c89, 0xfbe: 0x0c91, 0xfbf: 0x0c99, // Block 0x3f, offset 0xfc0 - 0xfc0: 0x3aa1, 0xfc1: 0x3ac9, 0xfc2: 0x3af1, 0xfc3: 0x3b19, 0xfc4: 0x3b41, 0xfc5: 0x3b69, - 0xfc6: 0x3b91, 0xfc7: 0x3bb9, 0xfc8: 0x3be1, 0xfc9: 0x3c09, 0xfca: 0x3c39, 0xfcb: 0x3c69, - 0xfcc: 0x3c99, 0xfcd: 0x3cd5, 0xfce: 0x3cb1, 0xfcf: 0x3cf5, 0xfd0: 0x3d15, 0xfd1: 0x3d2d, + 0xfc0: 0x0ca1, 0xfc1: 0x0ca9, 0xfc2: 0x0cb1, 0xfc3: 0x0cb9, 0xfc4: 0x0cc1, 0xfc5: 0x0cc9, + 0xfc6: 0x0cd1, 0xfc7: 0x0cd9, 0xfc8: 0x0ce1, 0xfc9: 0x0ce9, 0xfca: 0x0cf1, 0xfcb: 0x0cf9, + 0xfcc: 0x0d01, 0xfcd: 0x3cd5, 0xfce: 0x0d09, 0xfcf: 0x3cf5, 0xfd0: 0x3d15, 0xfd1: 0x3d2d, 0xfd2: 0x3d45, 0xfd3: 0x3d5d, 0xfd4: 0x3d75, 0xfd5: 0x3d75, 0xfd6: 0x3d5d, 0xfd7: 0x3d8d, 0xfd8: 0x07d5, 0xfd9: 0x3da5, 0xfda: 0x3dbd, 0xfdb: 0x3dd5, 0xfdc: 0x3ded, 0xfdd: 0x3e05, 0xfde: 0x3e1d, 0xfdf: 0x3e35, 0xfe0: 0x3e4d, 0xfe1: 0x3e65, 0xfe2: 0x3e7d, 0xfe3: 0x3e95, @@ -1324,769 +1467,769 @@ var idnaValues = [8192]uint16{ 0xfea: 0x3ef5, 0xfeb: 0x3f0d, 0xfec: 0x3f25, 0xfed: 0x3f3d, 0xfee: 0x3f55, 0xfef: 0x3f55, 0xff0: 0x3f6d, 0xff1: 0x3f6d, 0xff2: 0x3f6d, 0xff3: 0x3f85, 0xff4: 0x3f9d, 0xff5: 0x3fb5, 0xff6: 0x3fcd, 0xff7: 0x3fb5, 0xff8: 0x3fe5, 0xff9: 0x3ffd, 0xffa: 0x3f85, 0xffb: 0x4015, - 0xffc: 0x402d, 0xffd: 0x402d, 0xffe: 0x402d, 0xfff: 0x3cc9, + 0xffc: 0x402d, 0xffd: 0x402d, 0xffe: 0x402d, 0xfff: 0x0d11, // Block 0x40, offset 0x1000 - 0x1000: 0x3d01, 0x1001: 0x3d69, 0x1002: 0x3dd1, 0x1003: 0x3e39, 0x1004: 0x3e89, 0x1005: 0x3ef1, - 0x1006: 0x3f41, 0x1007: 0x3f91, 0x1008: 0x4011, 0x1009: 0x4079, 0x100a: 0x40c9, 0x100b: 0x4119, - 0x100c: 0x4169, 0x100d: 0x41d1, 0x100e: 0x4239, 0x100f: 0x4289, 0x1010: 0x42d9, 0x1011: 0x4311, - 0x1012: 0x4361, 0x1013: 0x43c9, 0x1014: 0x4431, 0x1015: 0x4469, 0x1016: 0x44e9, 0x1017: 0x4581, - 0x1018: 0x4601, 0x1019: 0x4651, 0x101a: 0x46d1, 0x101b: 0x4751, 0x101c: 0x47b9, 0x101d: 0x4809, - 0x101e: 0x4859, 0x101f: 0x48a9, 0x1020: 0x4911, 0x1021: 0x4991, 0x1022: 0x49f9, 0x1023: 0x4a49, - 0x1024: 0x4a99, 0x1025: 0x4ae9, 0x1026: 0x4b21, 0x1027: 0x4b59, 0x1028: 0x4b91, 0x1029: 0x4bc9, - 0x102a: 0x4c19, 0x102b: 0x4c69, 0x102c: 0x4ce9, 0x102d: 0x4d39, 0x102e: 0x4da1, 0x102f: 0x4e21, - 0x1030: 0x4e71, 0x1031: 0x4ea9, 0x1032: 0x4ee1, 0x1033: 0x4f61, 0x1034: 0x4fc9, 0x1035: 0x5049, - 0x1036: 0x5099, 0x1037: 0x5119, 0x1038: 0x5151, 0x1039: 0x51a1, 0x103a: 0x51f1, 0x103b: 0x5241, - 0x103c: 0x5291, 0x103d: 0x52e1, 0x103e: 0x5349, 0x103f: 0x5399, + 0x1000: 0x10f9, 0x1001: 0x1101, 0x1002: 0x40a5, 0x1003: 0x1109, 0x1004: 0x1111, 0x1005: 0x1119, + 0x1006: 0x1121, 0x1007: 0x1129, 0x1008: 0x40c5, 0x1009: 0x1131, 0x100a: 0x1139, 0x100b: 0x1141, + 0x100c: 0x40e5, 0x100d: 0x40e5, 0x100e: 0x1149, 0x100f: 0x1151, 0x1010: 0x1159, 0x1011: 0x4105, + 0x1012: 0x4125, 0x1013: 0x4145, 0x1014: 0x4165, 0x1015: 0x4185, 0x1016: 0x1161, 0x1017: 0x1169, + 0x1018: 0x1171, 0x1019: 0x1179, 0x101a: 0x1181, 0x101b: 0x41a5, 0x101c: 0x1189, 0x101d: 0x1191, + 0x101e: 0x1199, 0x101f: 0x41c5, 0x1020: 0x41e5, 0x1021: 0x11a1, 0x1022: 0x4205, 0x1023: 0x4225, + 0x1024: 0x4245, 0x1025: 0x11a9, 0x1026: 0x4265, 0x1027: 0x11b1, 0x1028: 0x11b9, 0x1029: 0x10f9, + 0x102a: 0x4285, 0x102b: 0x42a5, 0x102c: 0x42c5, 0x102d: 0x42e5, 0x102e: 0x11c1, 0x102f: 0x11c9, + 0x1030: 0x11d1, 0x1031: 0x11d9, 0x1032: 0x4305, 0x1033: 0x11e1, 0x1034: 0x11e9, 0x1035: 0x11f1, + 0x1036: 0x4325, 0x1037: 0x11f9, 0x1038: 0x1201, 0x1039: 0x11f9, 0x103a: 0x1209, 0x103b: 0x1211, + 0x103c: 0x4345, 0x103d: 0x1219, 0x103e: 0x1221, 0x103f: 0x1219, // Block 0x41, offset 0x1040 - 0x1040: 0x53d1, 0x1041: 0x5421, 0x1042: 0x5471, 0x1043: 0x54c1, 0x1044: 0x5529, 0x1045: 0x5579, - 0x1046: 0x55c9, 0x1047: 0x5619, 0x1048: 0x5699, 0x1049: 0x5701, 0x104a: 0x5739, 0x104b: 0x57b9, - 0x104c: 0x57f1, 0x104d: 0x5859, 0x104e: 0x58c1, 0x104f: 0x5911, 0x1050: 0x5961, 0x1051: 0x59b1, - 0x1052: 0x5a19, 0x1053: 0x5a51, 0x1054: 0x5aa1, 0x1055: 0x5b09, 0x1056: 0x5b41, 0x1057: 0x5bc1, - 0x1058: 0x5c11, 0x1059: 0x5c39, 0x105a: 0x5c61, 0x105b: 0x5c89, 0x105c: 0x5cb1, 0x105d: 0x5cd9, - 0x105e: 0x5d01, 0x105f: 0x5d29, 0x1060: 0x5d51, 0x1061: 0x5d79, 0x1062: 0x5da1, 0x1063: 0x5dd1, - 0x1064: 0x5e01, 0x1065: 0x5e31, 0x1066: 0x5e61, 0x1067: 0x5e91, 0x1068: 0x5ec1, 0x1069: 0x5ef1, - 0x106a: 0x5f21, 0x106b: 0x5f51, 0x106c: 0x5f81, 0x106d: 0x5fb1, 0x106e: 0x5fe1, 0x106f: 0x6011, - 0x1070: 0x6041, 0x1071: 0x4045, 0x1072: 0x6071, 0x1073: 0x6089, 0x1074: 0x4065, 0x1075: 0x60a1, - 0x1076: 0x60b9, 0x1077: 0x60d1, 0x1078: 0x4085, 0x1079: 0x4085, 0x107a: 0x60e9, 0x107b: 0x6101, - 0x107c: 0x6139, 0x107d: 0x6171, 0x107e: 0x61a9, 0x107f: 0x61e1, + 0x1040: 0x4365, 0x1041: 0x4385, 0x1042: 0x0040, 0x1043: 0x1229, 0x1044: 0x1231, 0x1045: 0x1239, + 0x1046: 0x1241, 0x1047: 0x0040, 0x1048: 0x1249, 0x1049: 0x1251, 0x104a: 0x1259, 0x104b: 0x1261, + 0x104c: 0x1269, 0x104d: 0x1271, 0x104e: 0x1199, 0x104f: 0x1279, 0x1050: 0x1281, 0x1051: 0x1289, + 0x1052: 0x43a5, 0x1053: 0x1291, 0x1054: 0x1121, 0x1055: 0x43c5, 0x1056: 0x43e5, 0x1057: 0x1299, + 0x1058: 0x0040, 0x1059: 0x4405, 0x105a: 0x12a1, 0x105b: 0x12a9, 0x105c: 0x12b1, 0x105d: 0x12b9, + 0x105e: 0x12c1, 0x105f: 0x12c9, 0x1060: 0x12d1, 0x1061: 0x12d9, 0x1062: 0x12e1, 0x1063: 0x12e9, + 0x1064: 0x12f1, 0x1065: 0x12f9, 0x1066: 0x1301, 0x1067: 0x1309, 0x1068: 0x1311, 0x1069: 0x1319, + 0x106a: 0x1321, 0x106b: 0x1329, 0x106c: 0x1331, 0x106d: 0x1339, 0x106e: 0x1341, 0x106f: 0x1349, + 0x1070: 0x1351, 0x1071: 0x1359, 0x1072: 0x1361, 0x1073: 0x1369, 0x1074: 0x1371, 0x1075: 0x1379, + 0x1076: 0x1381, 0x1077: 0x1389, 0x1078: 0x1391, 0x1079: 0x1399, 0x107a: 0x13a1, 0x107b: 0x13a9, + 0x107c: 0x13b1, 0x107d: 0x13b9, 0x107e: 0x13c1, 0x107f: 0x4425, // Block 0x42, offset 0x1080 - 0x1080: 0x6249, 0x1081: 0x6261, 0x1082: 0x40a5, 0x1083: 0x6279, 0x1084: 0x6291, 0x1085: 0x62a9, - 0x1086: 0x62c1, 0x1087: 0x62d9, 0x1088: 0x40c5, 0x1089: 0x62f1, 0x108a: 0x6319, 0x108b: 0x6331, - 0x108c: 0x40e5, 0x108d: 0x40e5, 0x108e: 0x6349, 0x108f: 0x6361, 0x1090: 0x6379, 0x1091: 0x4105, - 0x1092: 0x4125, 0x1093: 0x4145, 0x1094: 0x4165, 0x1095: 0x4185, 0x1096: 0x6391, 0x1097: 0x63a9, - 0x1098: 0x63c1, 0x1099: 0x63d9, 0x109a: 0x63f1, 0x109b: 0x41a5, 0x109c: 0x6409, 0x109d: 0x6421, - 0x109e: 0x6439, 0x109f: 0x41c5, 0x10a0: 0x41e5, 0x10a1: 0x6451, 0x10a2: 0x4205, 0x10a3: 0x4225, - 0x10a4: 0x4245, 0x10a5: 0x6469, 0x10a6: 0x4265, 0x10a7: 0x6481, 0x10a8: 0x64b1, 0x10a9: 0x6249, - 0x10aa: 0x4285, 0x10ab: 0x42a5, 0x10ac: 0x42c5, 0x10ad: 0x42e5, 0x10ae: 0x64e9, 0x10af: 0x6529, - 0x10b0: 0x6571, 0x10b1: 0x6589, 0x10b2: 0x4305, 0x10b3: 0x65a1, 0x10b4: 0x65b9, 0x10b5: 0x65d1, - 0x10b6: 0x4325, 0x10b7: 0x65e9, 0x10b8: 0x6601, 0x10b9: 0x65e9, 0x10ba: 0x6619, 0x10bb: 0x6631, - 0x10bc: 0x4345, 0x10bd: 0x6649, 0x10be: 0x6661, 0x10bf: 0x6649, + 0x1080: 0xe00d, 0x1081: 0x0008, 0x1082: 0xe00d, 0x1083: 0x0008, 0x1084: 0xe00d, 0x1085: 0x0008, + 0x1086: 0xe00d, 0x1087: 0x0008, 0x1088: 0xe00d, 0x1089: 0x0008, 0x108a: 0xe00d, 0x108b: 0x0008, + 0x108c: 0xe00d, 0x108d: 0x0008, 0x108e: 0xe00d, 0x108f: 0x0008, 0x1090: 0xe00d, 0x1091: 0x0008, + 0x1092: 0xe00d, 0x1093: 0x0008, 0x1094: 0xe00d, 0x1095: 0x0008, 0x1096: 0xe00d, 0x1097: 0x0008, + 0x1098: 0xe00d, 0x1099: 0x0008, 0x109a: 0xe00d, 0x109b: 0x0008, 0x109c: 0xe00d, 0x109d: 0x0008, + 0x109e: 0xe00d, 0x109f: 0x0008, 0x10a0: 0xe00d, 0x10a1: 0x0008, 0x10a2: 0xe00d, 0x10a3: 0x0008, + 0x10a4: 0xe00d, 0x10a5: 0x0008, 0x10a6: 0xe00d, 0x10a7: 0x0008, 0x10a8: 0xe00d, 0x10a9: 0x0008, + 0x10aa: 0xe00d, 0x10ab: 0x0008, 0x10ac: 0xe00d, 0x10ad: 0x0008, 0x10ae: 0x0008, 0x10af: 0x3308, + 0x10b0: 0x3318, 0x10b1: 0x3318, 0x10b2: 0x3318, 0x10b3: 0x0018, 0x10b4: 0x3308, 0x10b5: 0x3308, + 0x10b6: 0x3308, 0x10b7: 0x3308, 0x10b8: 0x3308, 0x10b9: 0x3308, 0x10ba: 0x3308, 0x10bb: 0x3308, + 0x10bc: 0x3308, 0x10bd: 0x3308, 0x10be: 0x0018, 0x10bf: 0x0008, // Block 0x43, offset 0x10c0 - 0x10c0: 0x4365, 0x10c1: 0x4385, 0x10c2: 0x0040, 0x10c3: 0x6679, 0x10c4: 0x6691, 0x10c5: 0x66a9, - 0x10c6: 0x66c1, 0x10c7: 0x0040, 0x10c8: 0x66f9, 0x10c9: 0x6711, 0x10ca: 0x6729, 0x10cb: 0x6741, - 0x10cc: 0x6759, 0x10cd: 0x6771, 0x10ce: 0x6439, 0x10cf: 0x6789, 0x10d0: 0x67a1, 0x10d1: 0x67b9, - 0x10d2: 0x43a5, 0x10d3: 0x67d1, 0x10d4: 0x62c1, 0x10d5: 0x43c5, 0x10d6: 0x43e5, 0x10d7: 0x67e9, - 0x10d8: 0x0040, 0x10d9: 0x4405, 0x10da: 0x6801, 0x10db: 0x6819, 0x10dc: 0x6831, 0x10dd: 0x6849, - 0x10de: 0x6861, 0x10df: 0x6891, 0x10e0: 0x68c1, 0x10e1: 0x68e9, 0x10e2: 0x6911, 0x10e3: 0x6939, - 0x10e4: 0x6961, 0x10e5: 0x6989, 0x10e6: 0x69b1, 0x10e7: 0x69d9, 0x10e8: 0x6a01, 0x10e9: 0x6a29, - 0x10ea: 0x6a59, 0x10eb: 0x6a89, 0x10ec: 0x6ab9, 0x10ed: 0x6ae9, 0x10ee: 0x6b19, 0x10ef: 0x6b49, - 0x10f0: 0x6b79, 0x10f1: 0x6ba9, 0x10f2: 0x6bd9, 0x10f3: 0x6c09, 0x10f4: 0x6c39, 0x10f5: 0x6c69, - 0x10f6: 0x6c99, 0x10f7: 0x6cc9, 0x10f8: 0x6cf9, 0x10f9: 0x6d29, 0x10fa: 0x6d59, 0x10fb: 0x6d89, - 0x10fc: 0x6db9, 0x10fd: 0x6de9, 0x10fe: 0x6e19, 0x10ff: 0x4425, + 0x10c0: 0xe00d, 0x10c1: 0x0008, 0x10c2: 0xe00d, 0x10c3: 0x0008, 0x10c4: 0xe00d, 0x10c5: 0x0008, + 0x10c6: 0xe00d, 0x10c7: 0x0008, 0x10c8: 0xe00d, 0x10c9: 0x0008, 0x10ca: 0xe00d, 0x10cb: 0x0008, + 0x10cc: 0xe00d, 0x10cd: 0x0008, 0x10ce: 0xe00d, 0x10cf: 0x0008, 0x10d0: 0xe00d, 0x10d1: 0x0008, + 0x10d2: 0xe00d, 0x10d3: 0x0008, 0x10d4: 0xe00d, 0x10d5: 0x0008, 0x10d6: 0xe00d, 0x10d7: 0x0008, + 0x10d8: 0xe00d, 0x10d9: 0x0008, 0x10da: 0xe00d, 0x10db: 0x0008, 0x10dc: 0x02d1, 0x10dd: 0x13c9, + 0x10de: 0x3308, 0x10df: 0x3308, 0x10e0: 0x0008, 0x10e1: 0x0008, 0x10e2: 0x0008, 0x10e3: 0x0008, + 0x10e4: 0x0008, 0x10e5: 0x0008, 0x10e6: 0x0008, 0x10e7: 0x0008, 0x10e8: 0x0008, 0x10e9: 0x0008, + 0x10ea: 0x0008, 0x10eb: 0x0008, 0x10ec: 0x0008, 0x10ed: 0x0008, 0x10ee: 0x0008, 0x10ef: 0x0008, + 0x10f0: 0x0008, 0x10f1: 0x0008, 0x10f2: 0x0008, 0x10f3: 0x0008, 0x10f4: 0x0008, 0x10f5: 0x0008, + 0x10f6: 0x0008, 0x10f7: 0x0008, 0x10f8: 0x0008, 0x10f9: 0x0008, 0x10fa: 0x0008, 0x10fb: 0x0008, + 0x10fc: 0x0008, 0x10fd: 0x0008, 0x10fe: 0x0008, 0x10ff: 0x0008, // Block 0x44, offset 0x1100 - 0x1100: 0xe00d, 0x1101: 0x0008, 0x1102: 0xe00d, 0x1103: 0x0008, 0x1104: 0xe00d, 0x1105: 0x0008, - 0x1106: 0xe00d, 0x1107: 0x0008, 0x1108: 0xe00d, 0x1109: 0x0008, 0x110a: 0xe00d, 0x110b: 0x0008, - 0x110c: 0xe00d, 0x110d: 0x0008, 0x110e: 0xe00d, 0x110f: 0x0008, 0x1110: 0xe00d, 0x1111: 0x0008, - 0x1112: 0xe00d, 0x1113: 0x0008, 0x1114: 0xe00d, 0x1115: 0x0008, 0x1116: 0xe00d, 0x1117: 0x0008, - 0x1118: 0xe00d, 0x1119: 0x0008, 0x111a: 0xe00d, 0x111b: 0x0008, 0x111c: 0xe00d, 0x111d: 0x0008, - 0x111e: 0xe00d, 0x111f: 0x0008, 0x1120: 0xe00d, 0x1121: 0x0008, 0x1122: 0xe00d, 0x1123: 0x0008, + 0x1100: 0x0018, 0x1101: 0x0018, 0x1102: 0x0018, 0x1103: 0x0018, 0x1104: 0x0018, 0x1105: 0x0018, + 0x1106: 0x0018, 0x1107: 0x0018, 0x1108: 0x0018, 0x1109: 0x0018, 0x110a: 0x0018, 0x110b: 0x0018, + 0x110c: 0x0018, 0x110d: 0x0018, 0x110e: 0x0018, 0x110f: 0x0018, 0x1110: 0x0018, 0x1111: 0x0018, + 0x1112: 0x0018, 0x1113: 0x0018, 0x1114: 0x0018, 0x1115: 0x0018, 0x1116: 0x0018, 0x1117: 0x0008, + 0x1118: 0x0008, 0x1119: 0x0008, 0x111a: 0x0008, 0x111b: 0x0008, 0x111c: 0x0008, 0x111d: 0x0008, + 0x111e: 0x0008, 0x111f: 0x0008, 0x1120: 0x0018, 0x1121: 0x0018, 0x1122: 0xe00d, 0x1123: 0x0008, 0x1124: 0xe00d, 0x1125: 0x0008, 0x1126: 0xe00d, 0x1127: 0x0008, 0x1128: 0xe00d, 0x1129: 0x0008, - 0x112a: 0xe00d, 0x112b: 0x0008, 0x112c: 0xe00d, 0x112d: 0x0008, 0x112e: 0x0008, 0x112f: 0x3308, - 0x1130: 0x3318, 0x1131: 0x3318, 0x1132: 0x3318, 0x1133: 0x0018, 0x1134: 0x3308, 0x1135: 0x3308, - 0x1136: 0x3308, 0x1137: 0x3308, 0x1138: 0x3308, 0x1139: 0x3308, 0x113a: 0x3308, 0x113b: 0x3308, - 0x113c: 0x3308, 0x113d: 0x3308, 0x113e: 0x0018, 0x113f: 0x0008, + 0x112a: 0xe00d, 0x112b: 0x0008, 0x112c: 0xe00d, 0x112d: 0x0008, 0x112e: 0xe00d, 0x112f: 0x0008, + 0x1130: 0x0008, 0x1131: 0x0008, 0x1132: 0xe00d, 0x1133: 0x0008, 0x1134: 0xe00d, 0x1135: 0x0008, + 0x1136: 0xe00d, 0x1137: 0x0008, 0x1138: 0xe00d, 0x1139: 0x0008, 0x113a: 0xe00d, 0x113b: 0x0008, + 0x113c: 0xe00d, 0x113d: 0x0008, 0x113e: 0xe00d, 0x113f: 0x0008, // Block 0x45, offset 0x1140 0x1140: 0xe00d, 0x1141: 0x0008, 0x1142: 0xe00d, 0x1143: 0x0008, 0x1144: 0xe00d, 0x1145: 0x0008, 0x1146: 0xe00d, 0x1147: 0x0008, 0x1148: 0xe00d, 0x1149: 0x0008, 0x114a: 0xe00d, 0x114b: 0x0008, 0x114c: 0xe00d, 0x114d: 0x0008, 0x114e: 0xe00d, 0x114f: 0x0008, 0x1150: 0xe00d, 0x1151: 0x0008, 0x1152: 0xe00d, 0x1153: 0x0008, 0x1154: 0xe00d, 0x1155: 0x0008, 0x1156: 0xe00d, 0x1157: 0x0008, - 0x1158: 0xe00d, 0x1159: 0x0008, 0x115a: 0xe00d, 0x115b: 0x0008, 0x115c: 0x0ea1, 0x115d: 0x6e49, - 0x115e: 0x3308, 0x115f: 0x3308, 0x1160: 0x0008, 0x1161: 0x0008, 0x1162: 0x0008, 0x1163: 0x0008, - 0x1164: 0x0008, 0x1165: 0x0008, 0x1166: 0x0008, 0x1167: 0x0008, 0x1168: 0x0008, 0x1169: 0x0008, - 0x116a: 0x0008, 0x116b: 0x0008, 0x116c: 0x0008, 0x116d: 0x0008, 0x116e: 0x0008, 0x116f: 0x0008, - 0x1170: 0x0008, 0x1171: 0x0008, 0x1172: 0x0008, 0x1173: 0x0008, 0x1174: 0x0008, 0x1175: 0x0008, - 0x1176: 0x0008, 0x1177: 0x0008, 0x1178: 0x0008, 0x1179: 0x0008, 0x117a: 0x0008, 0x117b: 0x0008, - 0x117c: 0x0008, 0x117d: 0x0008, 0x117e: 0x0008, 0x117f: 0x0008, + 0x1158: 0xe00d, 0x1159: 0x0008, 0x115a: 0xe00d, 0x115b: 0x0008, 0x115c: 0xe00d, 0x115d: 0x0008, + 0x115e: 0xe00d, 0x115f: 0x0008, 0x1160: 0xe00d, 0x1161: 0x0008, 0x1162: 0xe00d, 0x1163: 0x0008, + 0x1164: 0xe00d, 0x1165: 0x0008, 0x1166: 0xe00d, 0x1167: 0x0008, 0x1168: 0xe00d, 0x1169: 0x0008, + 0x116a: 0xe00d, 0x116b: 0x0008, 0x116c: 0xe00d, 0x116d: 0x0008, 0x116e: 0xe00d, 0x116f: 0x0008, + 0x1170: 0xe0fd, 0x1171: 0x0008, 0x1172: 0x0008, 0x1173: 0x0008, 0x1174: 0x0008, 0x1175: 0x0008, + 0x1176: 0x0008, 0x1177: 0x0008, 0x1178: 0x0008, 0x1179: 0xe01d, 0x117a: 0x0008, 0x117b: 0xe03d, + 0x117c: 0x0008, 0x117d: 0x4445, 0x117e: 0xe00d, 0x117f: 0x0008, // Block 0x46, offset 0x1180 - 0x1180: 0x0018, 0x1181: 0x0018, 0x1182: 0x0018, 0x1183: 0x0018, 0x1184: 0x0018, 0x1185: 0x0018, - 0x1186: 0x0018, 0x1187: 0x0018, 0x1188: 0x0018, 0x1189: 0x0018, 0x118a: 0x0018, 0x118b: 0x0018, - 0x118c: 0x0018, 0x118d: 0x0018, 0x118e: 0x0018, 0x118f: 0x0018, 0x1190: 0x0018, 0x1191: 0x0018, - 0x1192: 0x0018, 0x1193: 0x0018, 0x1194: 0x0018, 0x1195: 0x0018, 0x1196: 0x0018, 0x1197: 0x0008, - 0x1198: 0x0008, 0x1199: 0x0008, 0x119a: 0x0008, 0x119b: 0x0008, 0x119c: 0x0008, 0x119d: 0x0008, - 0x119e: 0x0008, 0x119f: 0x0008, 0x11a0: 0x0018, 0x11a1: 0x0018, 0x11a2: 0xe00d, 0x11a3: 0x0008, + 0x1180: 0xe00d, 0x1181: 0x0008, 0x1182: 0xe00d, 0x1183: 0x0008, 0x1184: 0xe00d, 0x1185: 0x0008, + 0x1186: 0xe00d, 0x1187: 0x0008, 0x1188: 0x0008, 0x1189: 0x0018, 0x118a: 0x0018, 0x118b: 0xe03d, + 0x118c: 0x0008, 0x118d: 0x0409, 0x118e: 0x0008, 0x118f: 0x0008, 0x1190: 0xe00d, 0x1191: 0x0008, + 0x1192: 0xe00d, 0x1193: 0x0008, 0x1194: 0x0008, 0x1195: 0x0008, 0x1196: 0xe00d, 0x1197: 0x0008, + 0x1198: 0xe00d, 0x1199: 0x0008, 0x119a: 0xe00d, 0x119b: 0x0008, 0x119c: 0xe00d, 0x119d: 0x0008, + 0x119e: 0xe00d, 0x119f: 0x0008, 0x11a0: 0xe00d, 0x11a1: 0x0008, 0x11a2: 0xe00d, 0x11a3: 0x0008, 0x11a4: 0xe00d, 0x11a5: 0x0008, 0x11a6: 0xe00d, 0x11a7: 0x0008, 0x11a8: 0xe00d, 0x11a9: 0x0008, - 0x11aa: 0xe00d, 0x11ab: 0x0008, 0x11ac: 0xe00d, 0x11ad: 0x0008, 0x11ae: 0xe00d, 0x11af: 0x0008, - 0x11b0: 0x0008, 0x11b1: 0x0008, 0x11b2: 0xe00d, 0x11b3: 0x0008, 0x11b4: 0xe00d, 0x11b5: 0x0008, + 0x11aa: 0x13d1, 0x11ab: 0x0371, 0x11ac: 0x0401, 0x11ad: 0x13d9, 0x11ae: 0x0421, 0x11af: 0x0008, + 0x11b0: 0x13e1, 0x11b1: 0x13e9, 0x11b2: 0x0429, 0x11b3: 0x4465, 0x11b4: 0xe00d, 0x11b5: 0x0008, 0x11b6: 0xe00d, 0x11b7: 0x0008, 0x11b8: 0xe00d, 0x11b9: 0x0008, 0x11ba: 0xe00d, 0x11bb: 0x0008, 0x11bc: 0xe00d, 0x11bd: 0x0008, 0x11be: 0xe00d, 0x11bf: 0x0008, // Block 0x47, offset 0x11c0 - 0x11c0: 0xe00d, 0x11c1: 0x0008, 0x11c2: 0xe00d, 0x11c3: 0x0008, 0x11c4: 0xe00d, 0x11c5: 0x0008, - 0x11c6: 0xe00d, 0x11c7: 0x0008, 0x11c8: 0xe00d, 0x11c9: 0x0008, 0x11ca: 0xe00d, 0x11cb: 0x0008, - 0x11cc: 0xe00d, 0x11cd: 0x0008, 0x11ce: 0xe00d, 0x11cf: 0x0008, 0x11d0: 0xe00d, 0x11d1: 0x0008, - 0x11d2: 0xe00d, 0x11d3: 0x0008, 0x11d4: 0xe00d, 0x11d5: 0x0008, 0x11d6: 0xe00d, 0x11d7: 0x0008, - 0x11d8: 0xe00d, 0x11d9: 0x0008, 0x11da: 0xe00d, 0x11db: 0x0008, 0x11dc: 0xe00d, 0x11dd: 0x0008, - 0x11de: 0xe00d, 0x11df: 0x0008, 0x11e0: 0xe00d, 0x11e1: 0x0008, 0x11e2: 0xe00d, 0x11e3: 0x0008, - 0x11e4: 0xe00d, 0x11e5: 0x0008, 0x11e6: 0xe00d, 0x11e7: 0x0008, 0x11e8: 0xe00d, 0x11e9: 0x0008, - 0x11ea: 0xe00d, 0x11eb: 0x0008, 0x11ec: 0xe00d, 0x11ed: 0x0008, 0x11ee: 0xe00d, 0x11ef: 0x0008, - 0x11f0: 0xe0fd, 0x11f1: 0x0008, 0x11f2: 0x0008, 0x11f3: 0x0008, 0x11f4: 0x0008, 0x11f5: 0x0008, - 0x11f6: 0x0008, 0x11f7: 0x0008, 0x11f8: 0x0008, 0x11f9: 0xe01d, 0x11fa: 0x0008, 0x11fb: 0xe03d, - 0x11fc: 0x0008, 0x11fd: 0x4445, 0x11fe: 0xe00d, 0x11ff: 0x0008, + 0x11c0: 0x650d, 0x11c1: 0x652d, 0x11c2: 0x654d, 0x11c3: 0x656d, 0x11c4: 0x658d, 0x11c5: 0x65ad, + 0x11c6: 0x65cd, 0x11c7: 0x65ed, 0x11c8: 0x660d, 0x11c9: 0x662d, 0x11ca: 0x664d, 0x11cb: 0x666d, + 0x11cc: 0x668d, 0x11cd: 0x66ad, 0x11ce: 0x0008, 0x11cf: 0x0008, 0x11d0: 0x66cd, 0x11d1: 0x0008, + 0x11d2: 0x66ed, 0x11d3: 0x0008, 0x11d4: 0x0008, 0x11d5: 0x670d, 0x11d6: 0x672d, 0x11d7: 0x674d, + 0x11d8: 0x676d, 0x11d9: 0x678d, 0x11da: 0x67ad, 0x11db: 0x67cd, 0x11dc: 0x67ed, 0x11dd: 0x680d, + 0x11de: 0x682d, 0x11df: 0x0008, 0x11e0: 0x684d, 0x11e1: 0x0008, 0x11e2: 0x686d, 0x11e3: 0x0008, + 0x11e4: 0x0008, 0x11e5: 0x688d, 0x11e6: 0x68ad, 0x11e7: 0x0008, 0x11e8: 0x0008, 0x11e9: 0x0008, + 0x11ea: 0x68cd, 0x11eb: 0x68ed, 0x11ec: 0x690d, 0x11ed: 0x692d, 0x11ee: 0x694d, 0x11ef: 0x696d, + 0x11f0: 0x698d, 0x11f1: 0x69ad, 0x11f2: 0x69cd, 0x11f3: 0x69ed, 0x11f4: 0x6a0d, 0x11f5: 0x6a2d, + 0x11f6: 0x6a4d, 0x11f7: 0x6a6d, 0x11f8: 0x6a8d, 0x11f9: 0x6aad, 0x11fa: 0x6acd, 0x11fb: 0x6aed, + 0x11fc: 0x6b0d, 0x11fd: 0x6b2d, 0x11fe: 0x6b4d, 0x11ff: 0x6b6d, // Block 0x48, offset 0x1200 - 0x1200: 0xe00d, 0x1201: 0x0008, 0x1202: 0xe00d, 0x1203: 0x0008, 0x1204: 0xe00d, 0x1205: 0x0008, - 0x1206: 0xe00d, 0x1207: 0x0008, 0x1208: 0x0008, 0x1209: 0x0018, 0x120a: 0x0018, 0x120b: 0xe03d, - 0x120c: 0x0008, 0x120d: 0x11d9, 0x120e: 0x0008, 0x120f: 0x0008, 0x1210: 0xe00d, 0x1211: 0x0008, - 0x1212: 0xe00d, 0x1213: 0x0008, 0x1214: 0x0008, 0x1215: 0x0008, 0x1216: 0xe00d, 0x1217: 0x0008, - 0x1218: 0xe00d, 0x1219: 0x0008, 0x121a: 0xe00d, 0x121b: 0x0008, 0x121c: 0xe00d, 0x121d: 0x0008, - 0x121e: 0xe00d, 0x121f: 0x0008, 0x1220: 0xe00d, 0x1221: 0x0008, 0x1222: 0xe00d, 0x1223: 0x0008, - 0x1224: 0xe00d, 0x1225: 0x0008, 0x1226: 0xe00d, 0x1227: 0x0008, 0x1228: 0xe00d, 0x1229: 0x0008, - 0x122a: 0x6e61, 0x122b: 0x1029, 0x122c: 0x11c1, 0x122d: 0x6e79, 0x122e: 0x1221, 0x122f: 0x0008, - 0x1230: 0x6e91, 0x1231: 0x6ea9, 0x1232: 0x1239, 0x1233: 0x4465, 0x1234: 0xe00d, 0x1235: 0x0008, - 0x1236: 0xe00d, 0x1237: 0x0008, 0x1238: 0xe00d, 0x1239: 0x0008, 0x123a: 0xe00d, 0x123b: 0x0008, - 0x123c: 0xe00d, 0x123d: 0x0008, 0x123e: 0xe00d, 0x123f: 0x0008, + 0x1200: 0x7acd, 0x1201: 0x7aed, 0x1202: 0x7b0d, 0x1203: 0x7b2d, 0x1204: 0x7b4d, 0x1205: 0x7b6d, + 0x1206: 0x7b8d, 0x1207: 0x7bad, 0x1208: 0x7bcd, 0x1209: 0x7bed, 0x120a: 0x7c0d, 0x120b: 0x7c2d, + 0x120c: 0x7c4d, 0x120d: 0x7c6d, 0x120e: 0x7c8d, 0x120f: 0x1409, 0x1210: 0x1411, 0x1211: 0x1419, + 0x1212: 0x7cad, 0x1213: 0x7ccd, 0x1214: 0x7ced, 0x1215: 0x1421, 0x1216: 0x1429, 0x1217: 0x1431, + 0x1218: 0x7d0d, 0x1219: 0x7d2d, 0x121a: 0x0040, 0x121b: 0x0040, 0x121c: 0x0040, 0x121d: 0x0040, + 0x121e: 0x0040, 0x121f: 0x0040, 0x1220: 0x0040, 0x1221: 0x0040, 0x1222: 0x0040, 0x1223: 0x0040, + 0x1224: 0x0040, 0x1225: 0x0040, 0x1226: 0x0040, 0x1227: 0x0040, 0x1228: 0x0040, 0x1229: 0x0040, + 0x122a: 0x0040, 0x122b: 0x0040, 0x122c: 0x0040, 0x122d: 0x0040, 0x122e: 0x0040, 0x122f: 0x0040, + 0x1230: 0x0040, 0x1231: 0x0040, 0x1232: 0x0040, 0x1233: 0x0040, 0x1234: 0x0040, 0x1235: 0x0040, + 0x1236: 0x0040, 0x1237: 0x0040, 0x1238: 0x0040, 0x1239: 0x0040, 0x123a: 0x0040, 0x123b: 0x0040, + 0x123c: 0x0040, 0x123d: 0x0040, 0x123e: 0x0040, 0x123f: 0x0040, // Block 0x49, offset 0x1240 - 0x1240: 0x650d, 0x1241: 0x652d, 0x1242: 0x654d, 0x1243: 0x656d, 0x1244: 0x658d, 0x1245: 0x65ad, - 0x1246: 0x65cd, 0x1247: 0x65ed, 0x1248: 0x660d, 0x1249: 0x662d, 0x124a: 0x664d, 0x124b: 0x666d, - 0x124c: 0x668d, 0x124d: 0x66ad, 0x124e: 0x0008, 0x124f: 0x0008, 0x1250: 0x66cd, 0x1251: 0x0008, - 0x1252: 0x66ed, 0x1253: 0x0008, 0x1254: 0x0008, 0x1255: 0x670d, 0x1256: 0x672d, 0x1257: 0x674d, - 0x1258: 0x676d, 0x1259: 0x678d, 0x125a: 0x67ad, 0x125b: 0x67cd, 0x125c: 0x67ed, 0x125d: 0x680d, - 0x125e: 0x682d, 0x125f: 0x0008, 0x1260: 0x684d, 0x1261: 0x0008, 0x1262: 0x686d, 0x1263: 0x0008, - 0x1264: 0x0008, 0x1265: 0x688d, 0x1266: 0x68ad, 0x1267: 0x0008, 0x1268: 0x0008, 0x1269: 0x0008, - 0x126a: 0x68cd, 0x126b: 0x68ed, 0x126c: 0x690d, 0x126d: 0x692d, 0x126e: 0x694d, 0x126f: 0x696d, - 0x1270: 0x698d, 0x1271: 0x69ad, 0x1272: 0x69cd, 0x1273: 0x69ed, 0x1274: 0x6a0d, 0x1275: 0x6a2d, - 0x1276: 0x6a4d, 0x1277: 0x6a6d, 0x1278: 0x6a8d, 0x1279: 0x6aad, 0x127a: 0x6acd, 0x127b: 0x6aed, - 0x127c: 0x6b0d, 0x127d: 0x6b2d, 0x127e: 0x6b4d, 0x127f: 0x6b6d, + 0x1240: 0x1439, 0x1241: 0x1441, 0x1242: 0x1449, 0x1243: 0x7d4d, 0x1244: 0x7d6d, 0x1245: 0x1451, + 0x1246: 0x1451, 0x1247: 0x0040, 0x1248: 0x0040, 0x1249: 0x0040, 0x124a: 0x0040, 0x124b: 0x0040, + 0x124c: 0x0040, 0x124d: 0x0040, 0x124e: 0x0040, 0x124f: 0x0040, 0x1250: 0x0040, 0x1251: 0x0040, + 0x1252: 0x0040, 0x1253: 0x1459, 0x1254: 0x1461, 0x1255: 0x1469, 0x1256: 0x1471, 0x1257: 0x1479, + 0x1258: 0x0040, 0x1259: 0x0040, 0x125a: 0x0040, 0x125b: 0x0040, 0x125c: 0x0040, 0x125d: 0x1481, + 0x125e: 0x3308, 0x125f: 0x1489, 0x1260: 0x1491, 0x1261: 0x0779, 0x1262: 0x0791, 0x1263: 0x1499, + 0x1264: 0x14a1, 0x1265: 0x14a9, 0x1266: 0x14b1, 0x1267: 0x14b9, 0x1268: 0x14c1, 0x1269: 0x071a, + 0x126a: 0x14c9, 0x126b: 0x14d1, 0x126c: 0x14d9, 0x126d: 0x14e1, 0x126e: 0x14e9, 0x126f: 0x14f1, + 0x1270: 0x14f9, 0x1271: 0x1501, 0x1272: 0x1509, 0x1273: 0x1511, 0x1274: 0x1519, 0x1275: 0x1521, + 0x1276: 0x1529, 0x1277: 0x0040, 0x1278: 0x1531, 0x1279: 0x1539, 0x127a: 0x1541, 0x127b: 0x1549, + 0x127c: 0x1551, 0x127d: 0x0040, 0x127e: 0x1559, 0x127f: 0x0040, // Block 0x4a, offset 0x1280 - 0x1280: 0x7acd, 0x1281: 0x7aed, 0x1282: 0x7b0d, 0x1283: 0x7b2d, 0x1284: 0x7b4d, 0x1285: 0x7b6d, - 0x1286: 0x7b8d, 0x1287: 0x7bad, 0x1288: 0x7bcd, 0x1289: 0x7bed, 0x128a: 0x7c0d, 0x128b: 0x7c2d, - 0x128c: 0x7c4d, 0x128d: 0x7c6d, 0x128e: 0x7c8d, 0x128f: 0x6f19, 0x1290: 0x6f41, 0x1291: 0x6f69, - 0x1292: 0x7cad, 0x1293: 0x7ccd, 0x1294: 0x7ced, 0x1295: 0x6f91, 0x1296: 0x6fb9, 0x1297: 0x6fe1, - 0x1298: 0x7d0d, 0x1299: 0x7d2d, 0x129a: 0x0040, 0x129b: 0x0040, 0x129c: 0x0040, 0x129d: 0x0040, - 0x129e: 0x0040, 0x129f: 0x0040, 0x12a0: 0x0040, 0x12a1: 0x0040, 0x12a2: 0x0040, 0x12a3: 0x0040, - 0x12a4: 0x0040, 0x12a5: 0x0040, 0x12a6: 0x0040, 0x12a7: 0x0040, 0x12a8: 0x0040, 0x12a9: 0x0040, - 0x12aa: 0x0040, 0x12ab: 0x0040, 0x12ac: 0x0040, 0x12ad: 0x0040, 0x12ae: 0x0040, 0x12af: 0x0040, - 0x12b0: 0x0040, 0x12b1: 0x0040, 0x12b2: 0x0040, 0x12b3: 0x0040, 0x12b4: 0x0040, 0x12b5: 0x0040, - 0x12b6: 0x0040, 0x12b7: 0x0040, 0x12b8: 0x0040, 0x12b9: 0x0040, 0x12ba: 0x0040, 0x12bb: 0x0040, - 0x12bc: 0x0040, 0x12bd: 0x0040, 0x12be: 0x0040, 0x12bf: 0x0040, + 0x1280: 0x1561, 0x1281: 0x1569, 0x1282: 0x0040, 0x1283: 0x1571, 0x1284: 0x1579, 0x1285: 0x0040, + 0x1286: 0x1581, 0x1287: 0x1589, 0x1288: 0x1591, 0x1289: 0x1599, 0x128a: 0x15a1, 0x128b: 0x15a9, + 0x128c: 0x15b1, 0x128d: 0x15b9, 0x128e: 0x15c1, 0x128f: 0x15c9, 0x1290: 0x15d1, 0x1291: 0x15d1, + 0x1292: 0x15d9, 0x1293: 0x15d9, 0x1294: 0x15d9, 0x1295: 0x15d9, 0x1296: 0x15e1, 0x1297: 0x15e1, + 0x1298: 0x15e1, 0x1299: 0x15e1, 0x129a: 0x15e9, 0x129b: 0x15e9, 0x129c: 0x15e9, 0x129d: 0x15e9, + 0x129e: 0x15f1, 0x129f: 0x15f1, 0x12a0: 0x15f1, 0x12a1: 0x15f1, 0x12a2: 0x15f9, 0x12a3: 0x15f9, + 0x12a4: 0x15f9, 0x12a5: 0x15f9, 0x12a6: 0x1601, 0x12a7: 0x1601, 0x12a8: 0x1601, 0x12a9: 0x1601, + 0x12aa: 0x1609, 0x12ab: 0x1609, 0x12ac: 0x1609, 0x12ad: 0x1609, 0x12ae: 0x1611, 0x12af: 0x1611, + 0x12b0: 0x1611, 0x12b1: 0x1611, 0x12b2: 0x1619, 0x12b3: 0x1619, 0x12b4: 0x1619, 0x12b5: 0x1619, + 0x12b6: 0x1621, 0x12b7: 0x1621, 0x12b8: 0x1621, 0x12b9: 0x1621, 0x12ba: 0x1629, 0x12bb: 0x1629, + 0x12bc: 0x1629, 0x12bd: 0x1629, 0x12be: 0x1631, 0x12bf: 0x1631, // Block 0x4b, offset 0x12c0 - 0x12c0: 0x7009, 0x12c1: 0x7021, 0x12c2: 0x7039, 0x12c3: 0x7d4d, 0x12c4: 0x7d6d, 0x12c5: 0x7051, - 0x12c6: 0x7051, 0x12c7: 0x0040, 0x12c8: 0x0040, 0x12c9: 0x0040, 0x12ca: 0x0040, 0x12cb: 0x0040, - 0x12cc: 0x0040, 0x12cd: 0x0040, 0x12ce: 0x0040, 0x12cf: 0x0040, 0x12d0: 0x0040, 0x12d1: 0x0040, - 0x12d2: 0x0040, 0x12d3: 0x7069, 0x12d4: 0x7091, 0x12d5: 0x70b9, 0x12d6: 0x70e1, 0x12d7: 0x7109, - 0x12d8: 0x0040, 0x12d9: 0x0040, 0x12da: 0x0040, 0x12db: 0x0040, 0x12dc: 0x0040, 0x12dd: 0x7131, - 0x12de: 0x3308, 0x12df: 0x7159, 0x12e0: 0x7181, 0x12e1: 0x20a9, 0x12e2: 0x20f1, 0x12e3: 0x7199, - 0x12e4: 0x71b1, 0x12e5: 0x71c9, 0x12e6: 0x71e1, 0x12e7: 0x71f9, 0x12e8: 0x7211, 0x12e9: 0x1fb2, - 0x12ea: 0x7229, 0x12eb: 0x7251, 0x12ec: 0x7279, 0x12ed: 0x72b1, 0x12ee: 0x72e9, 0x12ef: 0x7311, - 0x12f0: 0x7339, 0x12f1: 0x7361, 0x12f2: 0x7389, 0x12f3: 0x73b1, 0x12f4: 0x73d9, 0x12f5: 0x7401, - 0x12f6: 0x7429, 0x12f7: 0x0040, 0x12f8: 0x7451, 0x12f9: 0x7479, 0x12fa: 0x74a1, 0x12fb: 0x74c9, - 0x12fc: 0x74f1, 0x12fd: 0x0040, 0x12fe: 0x7519, 0x12ff: 0x0040, + 0x12c0: 0x1631, 0x12c1: 0x1631, 0x12c2: 0x1639, 0x12c3: 0x1639, 0x12c4: 0x1641, 0x12c5: 0x1641, + 0x12c6: 0x1649, 0x12c7: 0x1649, 0x12c8: 0x1651, 0x12c9: 0x1651, 0x12ca: 0x1659, 0x12cb: 0x1659, + 0x12cc: 0x1661, 0x12cd: 0x1661, 0x12ce: 0x1669, 0x12cf: 0x1669, 0x12d0: 0x1669, 0x12d1: 0x1669, + 0x12d2: 0x1671, 0x12d3: 0x1671, 0x12d4: 0x1671, 0x12d5: 0x1671, 0x12d6: 0x1679, 0x12d7: 0x1679, + 0x12d8: 0x1679, 0x12d9: 0x1679, 0x12da: 0x1681, 0x12db: 0x1681, 0x12dc: 0x1681, 0x12dd: 0x1681, + 0x12de: 0x1689, 0x12df: 0x1689, 0x12e0: 0x1691, 0x12e1: 0x1691, 0x12e2: 0x1691, 0x12e3: 0x1691, + 0x12e4: 0x1699, 0x12e5: 0x1699, 0x12e6: 0x16a1, 0x12e7: 0x16a1, 0x12e8: 0x16a1, 0x12e9: 0x16a1, + 0x12ea: 0x16a9, 0x12eb: 0x16a9, 0x12ec: 0x16a9, 0x12ed: 0x16a9, 0x12ee: 0x16b1, 0x12ef: 0x16b1, + 0x12f0: 0x16b9, 0x12f1: 0x16b9, 0x12f2: 0x0818, 0x12f3: 0x0818, 0x12f4: 0x0818, 0x12f5: 0x0818, + 0x12f6: 0x0818, 0x12f7: 0x0818, 0x12f8: 0x0818, 0x12f9: 0x0818, 0x12fa: 0x0818, 0x12fb: 0x0818, + 0x12fc: 0x0818, 0x12fd: 0x0818, 0x12fe: 0x0818, 0x12ff: 0x0818, // Block 0x4c, offset 0x1300 - 0x1300: 0x7541, 0x1301: 0x7569, 0x1302: 0x0040, 0x1303: 0x7591, 0x1304: 0x75b9, 0x1305: 0x0040, - 0x1306: 0x75e1, 0x1307: 0x7609, 0x1308: 0x7631, 0x1309: 0x7659, 0x130a: 0x7681, 0x130b: 0x76a9, - 0x130c: 0x76d1, 0x130d: 0x76f9, 0x130e: 0x7721, 0x130f: 0x7749, 0x1310: 0x7771, 0x1311: 0x7771, - 0x1312: 0x7789, 0x1313: 0x7789, 0x1314: 0x7789, 0x1315: 0x7789, 0x1316: 0x77a1, 0x1317: 0x77a1, - 0x1318: 0x77a1, 0x1319: 0x77a1, 0x131a: 0x77b9, 0x131b: 0x77b9, 0x131c: 0x77b9, 0x131d: 0x77b9, - 0x131e: 0x77d1, 0x131f: 0x77d1, 0x1320: 0x77d1, 0x1321: 0x77d1, 0x1322: 0x77e9, 0x1323: 0x77e9, - 0x1324: 0x77e9, 0x1325: 0x77e9, 0x1326: 0x7801, 0x1327: 0x7801, 0x1328: 0x7801, 0x1329: 0x7801, - 0x132a: 0x7819, 0x132b: 0x7819, 0x132c: 0x7819, 0x132d: 0x7819, 0x132e: 0x7831, 0x132f: 0x7831, - 0x1330: 0x7831, 0x1331: 0x7831, 0x1332: 0x7849, 0x1333: 0x7849, 0x1334: 0x7849, 0x1335: 0x7849, - 0x1336: 0x7861, 0x1337: 0x7861, 0x1338: 0x7861, 0x1339: 0x7861, 0x133a: 0x7879, 0x133b: 0x7879, - 0x133c: 0x7879, 0x133d: 0x7879, 0x133e: 0x7891, 0x133f: 0x7891, + 0x1300: 0x0818, 0x1301: 0x0818, 0x1302: 0x0040, 0x1303: 0x0040, 0x1304: 0x0040, 0x1305: 0x0040, + 0x1306: 0x0040, 0x1307: 0x0040, 0x1308: 0x0040, 0x1309: 0x0040, 0x130a: 0x0040, 0x130b: 0x0040, + 0x130c: 0x0040, 0x130d: 0x0040, 0x130e: 0x0040, 0x130f: 0x0040, 0x1310: 0x0040, 0x1311: 0x0040, + 0x1312: 0x0040, 0x1313: 0x16c1, 0x1314: 0x16c1, 0x1315: 0x16c1, 0x1316: 0x16c1, 0x1317: 0x16c9, + 0x1318: 0x16c9, 0x1319: 0x16d1, 0x131a: 0x16d1, 0x131b: 0x16d9, 0x131c: 0x16d9, 0x131d: 0x0149, + 0x131e: 0x16e1, 0x131f: 0x16e1, 0x1320: 0x16e9, 0x1321: 0x16e9, 0x1322: 0x16f1, 0x1323: 0x16f1, + 0x1324: 0x16f9, 0x1325: 0x16f9, 0x1326: 0x16f9, 0x1327: 0x16f9, 0x1328: 0x1701, 0x1329: 0x1701, + 0x132a: 0x1709, 0x132b: 0x1709, 0x132c: 0x1711, 0x132d: 0x1711, 0x132e: 0x1719, 0x132f: 0x1719, + 0x1330: 0x1721, 0x1331: 0x1721, 0x1332: 0x1729, 0x1333: 0x1729, 0x1334: 0x1731, 0x1335: 0x1731, + 0x1336: 0x1739, 0x1337: 0x1739, 0x1338: 0x1739, 0x1339: 0x1741, 0x133a: 0x1741, 0x133b: 0x1741, + 0x133c: 0x1749, 0x133d: 0x1749, 0x133e: 0x1749, 0x133f: 0x1749, // Block 0x4d, offset 0x1340 - 0x1340: 0x7891, 0x1341: 0x7891, 0x1342: 0x78a9, 0x1343: 0x78a9, 0x1344: 0x78c1, 0x1345: 0x78c1, - 0x1346: 0x78d9, 0x1347: 0x78d9, 0x1348: 0x78f1, 0x1349: 0x78f1, 0x134a: 0x7909, 0x134b: 0x7909, - 0x134c: 0x7921, 0x134d: 0x7921, 0x134e: 0x7939, 0x134f: 0x7939, 0x1350: 0x7939, 0x1351: 0x7939, - 0x1352: 0x7951, 0x1353: 0x7951, 0x1354: 0x7951, 0x1355: 0x7951, 0x1356: 0x7969, 0x1357: 0x7969, - 0x1358: 0x7969, 0x1359: 0x7969, 0x135a: 0x7981, 0x135b: 0x7981, 0x135c: 0x7981, 0x135d: 0x7981, - 0x135e: 0x7999, 0x135f: 0x7999, 0x1360: 0x79b1, 0x1361: 0x79b1, 0x1362: 0x79b1, 0x1363: 0x79b1, - 0x1364: 0x79c9, 0x1365: 0x79c9, 0x1366: 0x79e1, 0x1367: 0x79e1, 0x1368: 0x79e1, 0x1369: 0x79e1, - 0x136a: 0x79f9, 0x136b: 0x79f9, 0x136c: 0x79f9, 0x136d: 0x79f9, 0x136e: 0x7a11, 0x136f: 0x7a11, - 0x1370: 0x7a29, 0x1371: 0x7a29, 0x1372: 0x0818, 0x1373: 0x0818, 0x1374: 0x0818, 0x1375: 0x0818, - 0x1376: 0x0818, 0x1377: 0x0818, 0x1378: 0x0818, 0x1379: 0x0818, 0x137a: 0x0818, 0x137b: 0x0818, - 0x137c: 0x0818, 0x137d: 0x0818, 0x137e: 0x0818, 0x137f: 0x0818, + 0x1340: 0x1949, 0x1341: 0x1951, 0x1342: 0x1959, 0x1343: 0x1961, 0x1344: 0x1969, 0x1345: 0x1971, + 0x1346: 0x1979, 0x1347: 0x1981, 0x1348: 0x1989, 0x1349: 0x1991, 0x134a: 0x1999, 0x134b: 0x19a1, + 0x134c: 0x19a9, 0x134d: 0x19b1, 0x134e: 0x19b9, 0x134f: 0x19c1, 0x1350: 0x19c9, 0x1351: 0x19d1, + 0x1352: 0x19d9, 0x1353: 0x19e1, 0x1354: 0x19e9, 0x1355: 0x19f1, 0x1356: 0x19f9, 0x1357: 0x1a01, + 0x1358: 0x1a09, 0x1359: 0x1a11, 0x135a: 0x1a19, 0x135b: 0x1a21, 0x135c: 0x1a29, 0x135d: 0x1a31, + 0x135e: 0x1a3a, 0x135f: 0x1a42, 0x1360: 0x1a4a, 0x1361: 0x1a52, 0x1362: 0x1a5a, 0x1363: 0x1a62, + 0x1364: 0x1a69, 0x1365: 0x1a71, 0x1366: 0x1761, 0x1367: 0x1a79, 0x1368: 0x1741, 0x1369: 0x1769, + 0x136a: 0x1a81, 0x136b: 0x1a89, 0x136c: 0x1789, 0x136d: 0x1a91, 0x136e: 0x1791, 0x136f: 0x1799, + 0x1370: 0x1a99, 0x1371: 0x1aa1, 0x1372: 0x17b9, 0x1373: 0x1aa9, 0x1374: 0x17c1, 0x1375: 0x17c9, + 0x1376: 0x1ab1, 0x1377: 0x1ab9, 0x1378: 0x17d9, 0x1379: 0x1ac1, 0x137a: 0x17e1, 0x137b: 0x17e9, + 0x137c: 0x18d1, 0x137d: 0x18d9, 0x137e: 0x18f1, 0x137f: 0x18f9, // Block 0x4e, offset 0x1380 - 0x1380: 0x0818, 0x1381: 0x0818, 0x1382: 0x0040, 0x1383: 0x0040, 0x1384: 0x0040, 0x1385: 0x0040, - 0x1386: 0x0040, 0x1387: 0x0040, 0x1388: 0x0040, 0x1389: 0x0040, 0x138a: 0x0040, 0x138b: 0x0040, - 0x138c: 0x0040, 0x138d: 0x0040, 0x138e: 0x0040, 0x138f: 0x0040, 0x1390: 0x0040, 0x1391: 0x0040, - 0x1392: 0x0040, 0x1393: 0x7a41, 0x1394: 0x7a41, 0x1395: 0x7a41, 0x1396: 0x7a41, 0x1397: 0x7a59, - 0x1398: 0x7a59, 0x1399: 0x7a71, 0x139a: 0x7a71, 0x139b: 0x7a89, 0x139c: 0x7a89, 0x139d: 0x0479, - 0x139e: 0x7aa1, 0x139f: 0x7aa1, 0x13a0: 0x7ab9, 0x13a1: 0x7ab9, 0x13a2: 0x7ad1, 0x13a3: 0x7ad1, - 0x13a4: 0x7ae9, 0x13a5: 0x7ae9, 0x13a6: 0x7ae9, 0x13a7: 0x7ae9, 0x13a8: 0x7b01, 0x13a9: 0x7b01, - 0x13aa: 0x7b19, 0x13ab: 0x7b19, 0x13ac: 0x7b41, 0x13ad: 0x7b41, 0x13ae: 0x7b69, 0x13af: 0x7b69, - 0x13b0: 0x7b91, 0x13b1: 0x7b91, 0x13b2: 0x7bb9, 0x13b3: 0x7bb9, 0x13b4: 0x7be1, 0x13b5: 0x7be1, - 0x13b6: 0x7c09, 0x13b7: 0x7c09, 0x13b8: 0x7c09, 0x13b9: 0x7c31, 0x13ba: 0x7c31, 0x13bb: 0x7c31, - 0x13bc: 0x7c59, 0x13bd: 0x7c59, 0x13be: 0x7c59, 0x13bf: 0x7c59, + 0x1380: 0x1901, 0x1381: 0x1921, 0x1382: 0x1929, 0x1383: 0x1931, 0x1384: 0x1939, 0x1385: 0x1959, + 0x1386: 0x1961, 0x1387: 0x1969, 0x1388: 0x1ac9, 0x1389: 0x1989, 0x138a: 0x1ad1, 0x138b: 0x1ad9, + 0x138c: 0x19b9, 0x138d: 0x1ae1, 0x138e: 0x19c1, 0x138f: 0x19c9, 0x1390: 0x1a31, 0x1391: 0x1ae9, + 0x1392: 0x1af1, 0x1393: 0x1a09, 0x1394: 0x1af9, 0x1395: 0x1a11, 0x1396: 0x1a19, 0x1397: 0x1751, + 0x1398: 0x1759, 0x1399: 0x1b01, 0x139a: 0x1761, 0x139b: 0x1b09, 0x139c: 0x1771, 0x139d: 0x1779, + 0x139e: 0x1781, 0x139f: 0x1789, 0x13a0: 0x1b11, 0x13a1: 0x17a1, 0x13a2: 0x17a9, 0x13a3: 0x17b1, + 0x13a4: 0x17b9, 0x13a5: 0x1b19, 0x13a6: 0x17d9, 0x13a7: 0x17f1, 0x13a8: 0x17f9, 0x13a9: 0x1801, + 0x13aa: 0x1809, 0x13ab: 0x1811, 0x13ac: 0x1821, 0x13ad: 0x1829, 0x13ae: 0x1831, 0x13af: 0x1839, + 0x13b0: 0x1841, 0x13b1: 0x1849, 0x13b2: 0x1b21, 0x13b3: 0x1851, 0x13b4: 0x1859, 0x13b5: 0x1861, + 0x13b6: 0x1869, 0x13b7: 0x1871, 0x13b8: 0x1879, 0x13b9: 0x1889, 0x13ba: 0x1891, 0x13bb: 0x1899, + 0x13bc: 0x18a1, 0x13bd: 0x18a9, 0x13be: 0x18b1, 0x13bf: 0x18b9, // Block 0x4f, offset 0x13c0 - 0x13c0: 0x8649, 0x13c1: 0x8671, 0x13c2: 0x8699, 0x13c3: 0x86c1, 0x13c4: 0x86e9, 0x13c5: 0x8711, - 0x13c6: 0x8739, 0x13c7: 0x8761, 0x13c8: 0x8789, 0x13c9: 0x87b1, 0x13ca: 0x87d9, 0x13cb: 0x8801, - 0x13cc: 0x8829, 0x13cd: 0x8851, 0x13ce: 0x8879, 0x13cf: 0x88a1, 0x13d0: 0x88c9, 0x13d1: 0x88f1, - 0x13d2: 0x8919, 0x13d3: 0x8941, 0x13d4: 0x8969, 0x13d5: 0x8991, 0x13d6: 0x89b9, 0x13d7: 0x89e1, - 0x13d8: 0x8a09, 0x13d9: 0x8a31, 0x13da: 0x8a59, 0x13db: 0x8a81, 0x13dc: 0x8aa9, 0x13dd: 0x8ad1, - 0x13de: 0x8afa, 0x13df: 0x8b2a, 0x13e0: 0x8b5a, 0x13e1: 0x8b8a, 0x13e2: 0x8bba, 0x13e3: 0x8bea, - 0x13e4: 0x8c19, 0x13e5: 0x8c41, 0x13e6: 0x7cc1, 0x13e7: 0x8c69, 0x13e8: 0x7c31, 0x13e9: 0x7ce9, - 0x13ea: 0x8c91, 0x13eb: 0x8cb9, 0x13ec: 0x7d89, 0x13ed: 0x8ce1, 0x13ee: 0x7db1, 0x13ef: 0x7dd9, - 0x13f0: 0x8d09, 0x13f1: 0x8d31, 0x13f2: 0x7e79, 0x13f3: 0x8d59, 0x13f4: 0x7ea1, 0x13f5: 0x7ec9, - 0x13f6: 0x8d81, 0x13f7: 0x8da9, 0x13f8: 0x7f19, 0x13f9: 0x8dd1, 0x13fa: 0x7f41, 0x13fb: 0x7f69, - 0x13fc: 0x83f1, 0x13fd: 0x8419, 0x13fe: 0x8491, 0x13ff: 0x84b9, + 0x13c0: 0x18c1, 0x13c1: 0x18c9, 0x13c2: 0x18e1, 0x13c3: 0x18e9, 0x13c4: 0x1909, 0x13c5: 0x1911, + 0x13c6: 0x1919, 0x13c7: 0x1921, 0x13c8: 0x1929, 0x13c9: 0x1941, 0x13ca: 0x1949, 0x13cb: 0x1951, + 0x13cc: 0x1959, 0x13cd: 0x1b29, 0x13ce: 0x1971, 0x13cf: 0x1979, 0x13d0: 0x1981, 0x13d1: 0x1989, + 0x13d2: 0x19a1, 0x13d3: 0x19a9, 0x13d4: 0x19b1, 0x13d5: 0x19b9, 0x13d6: 0x1b31, 0x13d7: 0x19d1, + 0x13d8: 0x19d9, 0x13d9: 0x1b39, 0x13da: 0x19f1, 0x13db: 0x19f9, 0x13dc: 0x1a01, 0x13dd: 0x1a09, + 0x13de: 0x1b41, 0x13df: 0x1761, 0x13e0: 0x1b09, 0x13e1: 0x1789, 0x13e2: 0x1b11, 0x13e3: 0x17b9, + 0x13e4: 0x1b19, 0x13e5: 0x17d9, 0x13e6: 0x1b49, 0x13e7: 0x1841, 0x13e8: 0x1b51, 0x13e9: 0x1b59, + 0x13ea: 0x1b61, 0x13eb: 0x1921, 0x13ec: 0x1929, 0x13ed: 0x1959, 0x13ee: 0x19b9, 0x13ef: 0x1b31, + 0x13f0: 0x1a09, 0x13f1: 0x1b41, 0x13f2: 0x1b69, 0x13f3: 0x1b71, 0x13f4: 0x1b79, 0x13f5: 0x1b81, + 0x13f6: 0x1b89, 0x13f7: 0x1b91, 0x13f8: 0x1b99, 0x13f9: 0x1ba1, 0x13fa: 0x1ba9, 0x13fb: 0x1bb1, + 0x13fc: 0x1bb9, 0x13fd: 0x1bc1, 0x13fe: 0x1bc9, 0x13ff: 0x1bd1, // Block 0x50, offset 0x1400 - 0x1400: 0x84e1, 0x1401: 0x8581, 0x1402: 0x85a9, 0x1403: 0x85d1, 0x1404: 0x85f9, 0x1405: 0x8699, - 0x1406: 0x86c1, 0x1407: 0x86e9, 0x1408: 0x8df9, 0x1409: 0x8789, 0x140a: 0x8e21, 0x140b: 0x8e49, - 0x140c: 0x8879, 0x140d: 0x8e71, 0x140e: 0x88a1, 0x140f: 0x88c9, 0x1410: 0x8ad1, 0x1411: 0x8e99, - 0x1412: 0x8ec1, 0x1413: 0x8a09, 0x1414: 0x8ee9, 0x1415: 0x8a31, 0x1416: 0x8a59, 0x1417: 0x7c71, - 0x1418: 0x7c99, 0x1419: 0x8f11, 0x141a: 0x7cc1, 0x141b: 0x8f39, 0x141c: 0x7d11, 0x141d: 0x7d39, - 0x141e: 0x7d61, 0x141f: 0x7d89, 0x1420: 0x8f61, 0x1421: 0x7e01, 0x1422: 0x7e29, 0x1423: 0x7e51, - 0x1424: 0x7e79, 0x1425: 0x8f89, 0x1426: 0x7f19, 0x1427: 0x7f91, 0x1428: 0x7fb9, 0x1429: 0x7fe1, - 0x142a: 0x8009, 0x142b: 0x8031, 0x142c: 0x8081, 0x142d: 0x80a9, 0x142e: 0x80d1, 0x142f: 0x80f9, - 0x1430: 0x8121, 0x1431: 0x8149, 0x1432: 0x8fb1, 0x1433: 0x8171, 0x1434: 0x8199, 0x1435: 0x81c1, - 0x1436: 0x81e9, 0x1437: 0x8211, 0x1438: 0x8239, 0x1439: 0x8289, 0x143a: 0x82b1, 0x143b: 0x82d9, - 0x143c: 0x8301, 0x143d: 0x8329, 0x143e: 0x8351, 0x143f: 0x8379, + 0x1400: 0x1bd9, 0x1401: 0x1be1, 0x1402: 0x1be9, 0x1403: 0x1bf1, 0x1404: 0x1bf9, 0x1405: 0x1c01, + 0x1406: 0x1c09, 0x1407: 0x1c11, 0x1408: 0x1c19, 0x1409: 0x1c21, 0x140a: 0x1c29, 0x140b: 0x1c31, + 0x140c: 0x1b59, 0x140d: 0x1c39, 0x140e: 0x1c41, 0x140f: 0x1c49, 0x1410: 0x1c51, 0x1411: 0x1b81, + 0x1412: 0x1b89, 0x1413: 0x1b91, 0x1414: 0x1b99, 0x1415: 0x1ba1, 0x1416: 0x1ba9, 0x1417: 0x1bb1, + 0x1418: 0x1bb9, 0x1419: 0x1bc1, 0x141a: 0x1bc9, 0x141b: 0x1bd1, 0x141c: 0x1bd9, 0x141d: 0x1be1, + 0x141e: 0x1be9, 0x141f: 0x1bf1, 0x1420: 0x1bf9, 0x1421: 0x1c01, 0x1422: 0x1c09, 0x1423: 0x1c11, + 0x1424: 0x1c19, 0x1425: 0x1c21, 0x1426: 0x1c29, 0x1427: 0x1c31, 0x1428: 0x1b59, 0x1429: 0x1c39, + 0x142a: 0x1c41, 0x142b: 0x1c49, 0x142c: 0x1c51, 0x142d: 0x1c21, 0x142e: 0x1c29, 0x142f: 0x1c31, + 0x1430: 0x1b59, 0x1431: 0x1b51, 0x1432: 0x1b61, 0x1433: 0x1881, 0x1434: 0x1829, 0x1435: 0x1831, + 0x1436: 0x1839, 0x1437: 0x1c21, 0x1438: 0x1c29, 0x1439: 0x1c31, 0x143a: 0x1881, 0x143b: 0x1889, + 0x143c: 0x1c59, 0x143d: 0x1c59, 0x143e: 0x0018, 0x143f: 0x0018, // Block 0x51, offset 0x1440 - 0x1440: 0x83a1, 0x1441: 0x83c9, 0x1442: 0x8441, 0x1443: 0x8469, 0x1444: 0x8509, 0x1445: 0x8531, - 0x1446: 0x8559, 0x1447: 0x8581, 0x1448: 0x85a9, 0x1449: 0x8621, 0x144a: 0x8649, 0x144b: 0x8671, - 0x144c: 0x8699, 0x144d: 0x8fd9, 0x144e: 0x8711, 0x144f: 0x8739, 0x1450: 0x8761, 0x1451: 0x8789, - 0x1452: 0x8801, 0x1453: 0x8829, 0x1454: 0x8851, 0x1455: 0x8879, 0x1456: 0x9001, 0x1457: 0x88f1, - 0x1458: 0x8919, 0x1459: 0x9029, 0x145a: 0x8991, 0x145b: 0x89b9, 0x145c: 0x89e1, 0x145d: 0x8a09, - 0x145e: 0x9051, 0x145f: 0x7cc1, 0x1460: 0x8f39, 0x1461: 0x7d89, 0x1462: 0x8f61, 0x1463: 0x7e79, - 0x1464: 0x8f89, 0x1465: 0x7f19, 0x1466: 0x9079, 0x1467: 0x8121, 0x1468: 0x90a1, 0x1469: 0x90c9, - 0x146a: 0x90f1, 0x146b: 0x8581, 0x146c: 0x85a9, 0x146d: 0x8699, 0x146e: 0x8879, 0x146f: 0x9001, - 0x1470: 0x8a09, 0x1471: 0x9051, 0x1472: 0x9119, 0x1473: 0x9151, 0x1474: 0x9189, 0x1475: 0x91c1, - 0x1476: 0x91e9, 0x1477: 0x9211, 0x1478: 0x9239, 0x1479: 0x9261, 0x147a: 0x9289, 0x147b: 0x92b1, - 0x147c: 0x92d9, 0x147d: 0x9301, 0x147e: 0x9329, 0x147f: 0x9351, + 0x1440: 0x0040, 0x1441: 0x0040, 0x1442: 0x0040, 0x1443: 0x0040, 0x1444: 0x0040, 0x1445: 0x0040, + 0x1446: 0x0040, 0x1447: 0x0040, 0x1448: 0x0040, 0x1449: 0x0040, 0x144a: 0x0040, 0x144b: 0x0040, + 0x144c: 0x0040, 0x144d: 0x0040, 0x144e: 0x0040, 0x144f: 0x0040, 0x1450: 0x1c61, 0x1451: 0x1c69, + 0x1452: 0x1c69, 0x1453: 0x1c71, 0x1454: 0x1c79, 0x1455: 0x1c81, 0x1456: 0x1c89, 0x1457: 0x1c91, + 0x1458: 0x1c99, 0x1459: 0x1c99, 0x145a: 0x1ca1, 0x145b: 0x1ca9, 0x145c: 0x1cb1, 0x145d: 0x1cb9, + 0x145e: 0x1cc1, 0x145f: 0x1cc9, 0x1460: 0x1cc9, 0x1461: 0x1cd1, 0x1462: 0x1cd9, 0x1463: 0x1cd9, + 0x1464: 0x1ce1, 0x1465: 0x1ce1, 0x1466: 0x1ce9, 0x1467: 0x1cf1, 0x1468: 0x1cf1, 0x1469: 0x1cf9, + 0x146a: 0x1d01, 0x146b: 0x1d01, 0x146c: 0x1d09, 0x146d: 0x1d09, 0x146e: 0x1d11, 0x146f: 0x1d19, + 0x1470: 0x1d19, 0x1471: 0x1d21, 0x1472: 0x1d21, 0x1473: 0x1d29, 0x1474: 0x1d31, 0x1475: 0x1d39, + 0x1476: 0x1d41, 0x1477: 0x1d41, 0x1478: 0x1d49, 0x1479: 0x1d51, 0x147a: 0x1d59, 0x147b: 0x1d61, + 0x147c: 0x1d69, 0x147d: 0x1d69, 0x147e: 0x1d71, 0x147f: 0x1d79, // Block 0x52, offset 0x1480 - 0x1480: 0x9379, 0x1481: 0x93a1, 0x1482: 0x93c9, 0x1483: 0x93f1, 0x1484: 0x9419, 0x1485: 0x9441, - 0x1486: 0x9469, 0x1487: 0x9491, 0x1488: 0x94b9, 0x1489: 0x94e1, 0x148a: 0x9509, 0x148b: 0x9531, - 0x148c: 0x90c9, 0x148d: 0x9559, 0x148e: 0x9581, 0x148f: 0x95a9, 0x1490: 0x95d1, 0x1491: 0x91c1, - 0x1492: 0x91e9, 0x1493: 0x9211, 0x1494: 0x9239, 0x1495: 0x9261, 0x1496: 0x9289, 0x1497: 0x92b1, - 0x1498: 0x92d9, 0x1499: 0x9301, 0x149a: 0x9329, 0x149b: 0x9351, 0x149c: 0x9379, 0x149d: 0x93a1, - 0x149e: 0x93c9, 0x149f: 0x93f1, 0x14a0: 0x9419, 0x14a1: 0x9441, 0x14a2: 0x9469, 0x14a3: 0x9491, - 0x14a4: 0x94b9, 0x14a5: 0x94e1, 0x14a6: 0x9509, 0x14a7: 0x9531, 0x14a8: 0x90c9, 0x14a9: 0x9559, - 0x14aa: 0x9581, 0x14ab: 0x95a9, 0x14ac: 0x95d1, 0x14ad: 0x94e1, 0x14ae: 0x9509, 0x14af: 0x9531, - 0x14b0: 0x90c9, 0x14b1: 0x90a1, 0x14b2: 0x90f1, 0x14b3: 0x8261, 0x14b4: 0x80a9, 0x14b5: 0x80d1, - 0x14b6: 0x80f9, 0x14b7: 0x94e1, 0x14b8: 0x9509, 0x14b9: 0x9531, 0x14ba: 0x8261, 0x14bb: 0x8289, - 0x14bc: 0x95f9, 0x14bd: 0x95f9, 0x14be: 0x0018, 0x14bf: 0x0018, + 0x1480: 0x1f29, 0x1481: 0x1f31, 0x1482: 0x1f39, 0x1483: 0x1f11, 0x1484: 0x1d39, 0x1485: 0x1ce9, + 0x1486: 0x1f41, 0x1487: 0x1f49, 0x1488: 0x0040, 0x1489: 0x0040, 0x148a: 0x0040, 0x148b: 0x0040, + 0x148c: 0x0040, 0x148d: 0x0040, 0x148e: 0x0040, 0x148f: 0x0040, 0x1490: 0x0040, 0x1491: 0x0040, + 0x1492: 0x0040, 0x1493: 0x0040, 0x1494: 0x0040, 0x1495: 0x0040, 0x1496: 0x0040, 0x1497: 0x0040, + 0x1498: 0x0040, 0x1499: 0x0040, 0x149a: 0x0040, 0x149b: 0x0040, 0x149c: 0x0040, 0x149d: 0x0040, + 0x149e: 0x0040, 0x149f: 0x0040, 0x14a0: 0x0040, 0x14a1: 0x0040, 0x14a2: 0x0040, 0x14a3: 0x0040, + 0x14a4: 0x0040, 0x14a5: 0x0040, 0x14a6: 0x0040, 0x14a7: 0x0040, 0x14a8: 0x0040, 0x14a9: 0x0040, + 0x14aa: 0x0040, 0x14ab: 0x0040, 0x14ac: 0x0040, 0x14ad: 0x0040, 0x14ae: 0x0040, 0x14af: 0x0040, + 0x14b0: 0x1f51, 0x14b1: 0x1f59, 0x14b2: 0x1f61, 0x14b3: 0x1f69, 0x14b4: 0x1f71, 0x14b5: 0x1f79, + 0x14b6: 0x1f81, 0x14b7: 0x1f89, 0x14b8: 0x1f91, 0x14b9: 0x1f99, 0x14ba: 0x1fa2, 0x14bb: 0x1faa, + 0x14bc: 0x1fb1, 0x14bd: 0x0018, 0x14be: 0x0040, 0x14bf: 0x0040, // Block 0x53, offset 0x14c0 - 0x14c0: 0x0040, 0x14c1: 0x0040, 0x14c2: 0x0040, 0x14c3: 0x0040, 0x14c4: 0x0040, 0x14c5: 0x0040, - 0x14c6: 0x0040, 0x14c7: 0x0040, 0x14c8: 0x0040, 0x14c9: 0x0040, 0x14ca: 0x0040, 0x14cb: 0x0040, - 0x14cc: 0x0040, 0x14cd: 0x0040, 0x14ce: 0x0040, 0x14cf: 0x0040, 0x14d0: 0x9621, 0x14d1: 0x9659, - 0x14d2: 0x9659, 0x14d3: 0x9691, 0x14d4: 0x96c9, 0x14d5: 0x9701, 0x14d6: 0x9739, 0x14d7: 0x9771, - 0x14d8: 0x97a9, 0x14d9: 0x97a9, 0x14da: 0x97e1, 0x14db: 0x9819, 0x14dc: 0x9851, 0x14dd: 0x9889, - 0x14de: 0x98c1, 0x14df: 0x98f9, 0x14e0: 0x98f9, 0x14e1: 0x9931, 0x14e2: 0x9969, 0x14e3: 0x9969, - 0x14e4: 0x99a1, 0x14e5: 0x99a1, 0x14e6: 0x99d9, 0x14e7: 0x9a11, 0x14e8: 0x9a11, 0x14e9: 0x9a49, - 0x14ea: 0x9a81, 0x14eb: 0x9a81, 0x14ec: 0x9ab9, 0x14ed: 0x9ab9, 0x14ee: 0x9af1, 0x14ef: 0x9b29, - 0x14f0: 0x9b29, 0x14f1: 0x9b61, 0x14f2: 0x9b61, 0x14f3: 0x9b99, 0x14f4: 0x9bd1, 0x14f5: 0x9c09, - 0x14f6: 0x9c41, 0x14f7: 0x9c41, 0x14f8: 0x9c79, 0x14f9: 0x9cb1, 0x14fa: 0x9ce9, 0x14fb: 0x9d21, - 0x14fc: 0x9d59, 0x14fd: 0x9d59, 0x14fe: 0x9d91, 0x14ff: 0x9dc9, + 0x14c0: 0x33c0, 0x14c1: 0x33c0, 0x14c2: 0x33c0, 0x14c3: 0x33c0, 0x14c4: 0x33c0, 0x14c5: 0x33c0, + 0x14c6: 0x33c0, 0x14c7: 0x33c0, 0x14c8: 0x33c0, 0x14c9: 0x33c0, 0x14ca: 0x33c0, 0x14cb: 0x33c0, + 0x14cc: 0x33c0, 0x14cd: 0x33c0, 0x14ce: 0x33c0, 0x14cf: 0x33c0, 0x14d0: 0x1fba, 0x14d1: 0x7d8d, + 0x14d2: 0x0040, 0x14d3: 0x1fc2, 0x14d4: 0x0122, 0x14d5: 0x1fca, 0x14d6: 0x1fd2, 0x14d7: 0x7dad, + 0x14d8: 0x7dcd, 0x14d9: 0x0040, 0x14da: 0x0040, 0x14db: 0x0040, 0x14dc: 0x0040, 0x14dd: 0x0040, + 0x14de: 0x0040, 0x14df: 0x0040, 0x14e0: 0x3308, 0x14e1: 0x3308, 0x14e2: 0x3308, 0x14e3: 0x3308, + 0x14e4: 0x3308, 0x14e5: 0x3308, 0x14e6: 0x3308, 0x14e7: 0x3308, 0x14e8: 0x3308, 0x14e9: 0x3308, + 0x14ea: 0x3308, 0x14eb: 0x3308, 0x14ec: 0x3308, 0x14ed: 0x3308, 0x14ee: 0x3308, 0x14ef: 0x3308, + 0x14f0: 0x0040, 0x14f1: 0x7ded, 0x14f2: 0x7e0d, 0x14f3: 0x1fda, 0x14f4: 0x1fda, 0x14f5: 0x072a, + 0x14f6: 0x0732, 0x14f7: 0x1fe2, 0x14f8: 0x1fea, 0x14f9: 0x7e2d, 0x14fa: 0x7e4d, 0x14fb: 0x7e6d, + 0x14fc: 0x7e2d, 0x14fd: 0x7e8d, 0x14fe: 0x7ead, 0x14ff: 0x7e8d, // Block 0x54, offset 0x1500 - 0x1500: 0xa999, 0x1501: 0xa9d1, 0x1502: 0xaa09, 0x1503: 0xa8f1, 0x1504: 0x9c09, 0x1505: 0x99d9, - 0x1506: 0xaa41, 0x1507: 0xaa79, 0x1508: 0x0040, 0x1509: 0x0040, 0x150a: 0x0040, 0x150b: 0x0040, - 0x150c: 0x0040, 0x150d: 0x0040, 0x150e: 0x0040, 0x150f: 0x0040, 0x1510: 0x0040, 0x1511: 0x0040, - 0x1512: 0x0040, 0x1513: 0x0040, 0x1514: 0x0040, 0x1515: 0x0040, 0x1516: 0x0040, 0x1517: 0x0040, - 0x1518: 0x0040, 0x1519: 0x0040, 0x151a: 0x0040, 0x151b: 0x0040, 0x151c: 0x0040, 0x151d: 0x0040, - 0x151e: 0x0040, 0x151f: 0x0040, 0x1520: 0x0040, 0x1521: 0x0040, 0x1522: 0x0040, 0x1523: 0x0040, - 0x1524: 0x0040, 0x1525: 0x0040, 0x1526: 0x0040, 0x1527: 0x0040, 0x1528: 0x0040, 0x1529: 0x0040, - 0x152a: 0x0040, 0x152b: 0x0040, 0x152c: 0x0040, 0x152d: 0x0040, 0x152e: 0x0040, 0x152f: 0x0040, - 0x1530: 0xaab1, 0x1531: 0xaae9, 0x1532: 0xab21, 0x1533: 0xab69, 0x1534: 0xabb1, 0x1535: 0xabf9, - 0x1536: 0xac41, 0x1537: 0xac89, 0x1538: 0xacd1, 0x1539: 0xad19, 0x153a: 0xad52, 0x153b: 0xae62, - 0x153c: 0xaee1, 0x153d: 0x0018, 0x153e: 0x0040, 0x153f: 0x0040, + 0x1500: 0x7ecd, 0x1501: 0x7eed, 0x1502: 0x7f0d, 0x1503: 0x7eed, 0x1504: 0x7f2d, 0x1505: 0x0018, + 0x1506: 0x0018, 0x1507: 0x1ff2, 0x1508: 0x1ffa, 0x1509: 0x7f4e, 0x150a: 0x7f6e, 0x150b: 0x7f8e, + 0x150c: 0x7fae, 0x150d: 0x1fda, 0x150e: 0x1fda, 0x150f: 0x1fda, 0x1510: 0x1fba, 0x1511: 0x7fcd, + 0x1512: 0x0040, 0x1513: 0x0040, 0x1514: 0x0122, 0x1515: 0x1fc2, 0x1516: 0x1fd2, 0x1517: 0x1fca, + 0x1518: 0x7fed, 0x1519: 0x072a, 0x151a: 0x0732, 0x151b: 0x1fe2, 0x151c: 0x1fea, 0x151d: 0x7ecd, + 0x151e: 0x7f2d, 0x151f: 0x2002, 0x1520: 0x200a, 0x1521: 0x2012, 0x1522: 0x071a, 0x1523: 0x2019, + 0x1524: 0x2022, 0x1525: 0x202a, 0x1526: 0x0722, 0x1527: 0x0040, 0x1528: 0x2032, 0x1529: 0x203a, + 0x152a: 0x2042, 0x152b: 0x204a, 0x152c: 0x0040, 0x152d: 0x0040, 0x152e: 0x0040, 0x152f: 0x0040, + 0x1530: 0x800e, 0x1531: 0x2051, 0x1532: 0x802e, 0x1533: 0x0808, 0x1534: 0x804e, 0x1535: 0x0040, + 0x1536: 0x806e, 0x1537: 0x2059, 0x1538: 0x808e, 0x1539: 0x2061, 0x153a: 0x80ae, 0x153b: 0x2069, + 0x153c: 0x80ce, 0x153d: 0x2071, 0x153e: 0x80ee, 0x153f: 0x2079, // Block 0x55, offset 0x1540 - 0x1540: 0x33c0, 0x1541: 0x33c0, 0x1542: 0x33c0, 0x1543: 0x33c0, 0x1544: 0x33c0, 0x1545: 0x33c0, - 0x1546: 0x33c0, 0x1547: 0x33c0, 0x1548: 0x33c0, 0x1549: 0x33c0, 0x154a: 0x33c0, 0x154b: 0x33c0, - 0x154c: 0x33c0, 0x154d: 0x33c0, 0x154e: 0x33c0, 0x154f: 0x33c0, 0x1550: 0xaf2a, 0x1551: 0x7d8d, - 0x1552: 0x0040, 0x1553: 0xaf3a, 0x1554: 0x03c2, 0x1555: 0xaf4a, 0x1556: 0xaf5a, 0x1557: 0x7dad, - 0x1558: 0x7dcd, 0x1559: 0x0040, 0x155a: 0x0040, 0x155b: 0x0040, 0x155c: 0x0040, 0x155d: 0x0040, - 0x155e: 0x0040, 0x155f: 0x0040, 0x1560: 0x3308, 0x1561: 0x3308, 0x1562: 0x3308, 0x1563: 0x3308, - 0x1564: 0x3308, 0x1565: 0x3308, 0x1566: 0x3308, 0x1567: 0x3308, 0x1568: 0x3308, 0x1569: 0x3308, - 0x156a: 0x3308, 0x156b: 0x3308, 0x156c: 0x3308, 0x156d: 0x3308, 0x156e: 0x3308, 0x156f: 0x3308, - 0x1570: 0x0040, 0x1571: 0x7ded, 0x1572: 0x7e0d, 0x1573: 0xaf6a, 0x1574: 0xaf6a, 0x1575: 0x1fd2, - 0x1576: 0x1fe2, 0x1577: 0xaf7a, 0x1578: 0xaf8a, 0x1579: 0x7e2d, 0x157a: 0x7e4d, 0x157b: 0x7e6d, - 0x157c: 0x7e2d, 0x157d: 0x7e8d, 0x157e: 0x7ead, 0x157f: 0x7e8d, + 0x1540: 0x2081, 0x1541: 0x2089, 0x1542: 0x2089, 0x1543: 0x2091, 0x1544: 0x2091, 0x1545: 0x2099, + 0x1546: 0x2099, 0x1547: 0x20a1, 0x1548: 0x20a1, 0x1549: 0x20a9, 0x154a: 0x20a9, 0x154b: 0x20a9, + 0x154c: 0x20a9, 0x154d: 0x20b1, 0x154e: 0x20b1, 0x154f: 0x20b9, 0x1550: 0x20b9, 0x1551: 0x20b9, + 0x1552: 0x20b9, 0x1553: 0x20c1, 0x1554: 0x20c1, 0x1555: 0x20c9, 0x1556: 0x20c9, 0x1557: 0x20c9, + 0x1558: 0x20c9, 0x1559: 0x20d1, 0x155a: 0x20d1, 0x155b: 0x20d1, 0x155c: 0x20d1, 0x155d: 0x20d9, + 0x155e: 0x20d9, 0x155f: 0x20d9, 0x1560: 0x20d9, 0x1561: 0x20e1, 0x1562: 0x20e1, 0x1563: 0x20e1, + 0x1564: 0x20e1, 0x1565: 0x20e9, 0x1566: 0x20e9, 0x1567: 0x20e9, 0x1568: 0x20e9, 0x1569: 0x20f1, + 0x156a: 0x20f1, 0x156b: 0x20f9, 0x156c: 0x20f9, 0x156d: 0x2101, 0x156e: 0x2101, 0x156f: 0x2109, + 0x1570: 0x2109, 0x1571: 0x2111, 0x1572: 0x2111, 0x1573: 0x2111, 0x1574: 0x2111, 0x1575: 0x2119, + 0x1576: 0x2119, 0x1577: 0x2119, 0x1578: 0x2119, 0x1579: 0x2121, 0x157a: 0x2121, 0x157b: 0x2121, + 0x157c: 0x2121, 0x157d: 0x2129, 0x157e: 0x2129, 0x157f: 0x2129, // Block 0x56, offset 0x1580 - 0x1580: 0x7ecd, 0x1581: 0x7eed, 0x1582: 0x7f0d, 0x1583: 0x7eed, 0x1584: 0x7f2d, 0x1585: 0x0018, - 0x1586: 0x0018, 0x1587: 0xaf9a, 0x1588: 0xafaa, 0x1589: 0x7f4e, 0x158a: 0x7f6e, 0x158b: 0x7f8e, - 0x158c: 0x7fae, 0x158d: 0xaf6a, 0x158e: 0xaf6a, 0x158f: 0xaf6a, 0x1590: 0xaf2a, 0x1591: 0x7fcd, - 0x1592: 0x0040, 0x1593: 0x0040, 0x1594: 0x03c2, 0x1595: 0xaf3a, 0x1596: 0xaf5a, 0x1597: 0xaf4a, - 0x1598: 0x7fed, 0x1599: 0x1fd2, 0x159a: 0x1fe2, 0x159b: 0xaf7a, 0x159c: 0xaf8a, 0x159d: 0x7ecd, - 0x159e: 0x7f2d, 0x159f: 0xafba, 0x15a0: 0xafca, 0x15a1: 0xafda, 0x15a2: 0x1fb2, 0x15a3: 0xafe9, - 0x15a4: 0xaffa, 0x15a5: 0xb00a, 0x15a6: 0x1fc2, 0x15a7: 0x0040, 0x15a8: 0xb01a, 0x15a9: 0xb02a, - 0x15aa: 0xb03a, 0x15ab: 0xb04a, 0x15ac: 0x0040, 0x15ad: 0x0040, 0x15ae: 0x0040, 0x15af: 0x0040, - 0x15b0: 0x800e, 0x15b1: 0xb059, 0x15b2: 0x802e, 0x15b3: 0x0808, 0x15b4: 0x804e, 0x15b5: 0x0040, - 0x15b6: 0x806e, 0x15b7: 0xb081, 0x15b8: 0x808e, 0x15b9: 0xb0a9, 0x15ba: 0x80ae, 0x15bb: 0xb0d1, - 0x15bc: 0x80ce, 0x15bd: 0xb0f9, 0x15be: 0x80ee, 0x15bf: 0xb121, + 0x1580: 0x2129, 0x1581: 0x2131, 0x1582: 0x2131, 0x1583: 0x2131, 0x1584: 0x2131, 0x1585: 0x2139, + 0x1586: 0x2139, 0x1587: 0x2139, 0x1588: 0x2139, 0x1589: 0x2141, 0x158a: 0x2141, 0x158b: 0x2141, + 0x158c: 0x2141, 0x158d: 0x2149, 0x158e: 0x2149, 0x158f: 0x2149, 0x1590: 0x2149, 0x1591: 0x2151, + 0x1592: 0x2151, 0x1593: 0x2151, 0x1594: 0x2151, 0x1595: 0x2159, 0x1596: 0x2159, 0x1597: 0x2159, + 0x1598: 0x2159, 0x1599: 0x2161, 0x159a: 0x2161, 0x159b: 0x2161, 0x159c: 0x2161, 0x159d: 0x2169, + 0x159e: 0x2169, 0x159f: 0x2169, 0x15a0: 0x2169, 0x15a1: 0x2171, 0x15a2: 0x2171, 0x15a3: 0x2171, + 0x15a4: 0x2171, 0x15a5: 0x2179, 0x15a6: 0x2179, 0x15a7: 0x2179, 0x15a8: 0x2179, 0x15a9: 0x2181, + 0x15aa: 0x2181, 0x15ab: 0x2181, 0x15ac: 0x2181, 0x15ad: 0x2189, 0x15ae: 0x2189, 0x15af: 0x1701, + 0x15b0: 0x1701, 0x15b1: 0x2191, 0x15b2: 0x2191, 0x15b3: 0x2191, 0x15b4: 0x2191, 0x15b5: 0x2199, + 0x15b6: 0x2199, 0x15b7: 0x21a1, 0x15b8: 0x21a1, 0x15b9: 0x21a9, 0x15ba: 0x21a9, 0x15bb: 0x21b1, + 0x15bc: 0x21b1, 0x15bd: 0x0040, 0x15be: 0x0040, 0x15bf: 0x03c0, // Block 0x57, offset 0x15c0 - 0x15c0: 0xb149, 0x15c1: 0xb161, 0x15c2: 0xb161, 0x15c3: 0xb179, 0x15c4: 0xb179, 0x15c5: 0xb191, - 0x15c6: 0xb191, 0x15c7: 0xb1a9, 0x15c8: 0xb1a9, 0x15c9: 0xb1c1, 0x15ca: 0xb1c1, 0x15cb: 0xb1c1, - 0x15cc: 0xb1c1, 0x15cd: 0xb1d9, 0x15ce: 0xb1d9, 0x15cf: 0xb1f1, 0x15d0: 0xb1f1, 0x15d1: 0xb1f1, - 0x15d2: 0xb1f1, 0x15d3: 0xb209, 0x15d4: 0xb209, 0x15d5: 0xb221, 0x15d6: 0xb221, 0x15d7: 0xb221, - 0x15d8: 0xb221, 0x15d9: 0xb239, 0x15da: 0xb239, 0x15db: 0xb239, 0x15dc: 0xb239, 0x15dd: 0xb251, - 0x15de: 0xb251, 0x15df: 0xb251, 0x15e0: 0xb251, 0x15e1: 0xb269, 0x15e2: 0xb269, 0x15e3: 0xb269, - 0x15e4: 0xb269, 0x15e5: 0xb281, 0x15e6: 0xb281, 0x15e7: 0xb281, 0x15e8: 0xb281, 0x15e9: 0xb299, - 0x15ea: 0xb299, 0x15eb: 0xb2b1, 0x15ec: 0xb2b1, 0x15ed: 0xb2c9, 0x15ee: 0xb2c9, 0x15ef: 0xb2e1, - 0x15f0: 0xb2e1, 0x15f1: 0xb2f9, 0x15f2: 0xb2f9, 0x15f3: 0xb2f9, 0x15f4: 0xb2f9, 0x15f5: 0xb311, - 0x15f6: 0xb311, 0x15f7: 0xb311, 0x15f8: 0xb311, 0x15f9: 0xb329, 0x15fa: 0xb329, 0x15fb: 0xb329, - 0x15fc: 0xb329, 0x15fd: 0xb341, 0x15fe: 0xb341, 0x15ff: 0xb341, + 0x15c0: 0x0040, 0x15c1: 0x1fca, 0x15c2: 0x21ba, 0x15c3: 0x2002, 0x15c4: 0x203a, 0x15c5: 0x2042, + 0x15c6: 0x200a, 0x15c7: 0x21c2, 0x15c8: 0x072a, 0x15c9: 0x0732, 0x15ca: 0x2012, 0x15cb: 0x071a, + 0x15cc: 0x1fba, 0x15cd: 0x2019, 0x15ce: 0x0961, 0x15cf: 0x21ca, 0x15d0: 0x06e1, 0x15d1: 0x0049, + 0x15d2: 0x0029, 0x15d3: 0x0031, 0x15d4: 0x06e9, 0x15d5: 0x06f1, 0x15d6: 0x06f9, 0x15d7: 0x0701, + 0x15d8: 0x0709, 0x15d9: 0x0711, 0x15da: 0x1fc2, 0x15db: 0x0122, 0x15dc: 0x2022, 0x15dd: 0x0722, + 0x15de: 0x202a, 0x15df: 0x1fd2, 0x15e0: 0x204a, 0x15e1: 0x0019, 0x15e2: 0x02e9, 0x15e3: 0x03d9, + 0x15e4: 0x02f1, 0x15e5: 0x02f9, 0x15e6: 0x03f1, 0x15e7: 0x0309, 0x15e8: 0x00a9, 0x15e9: 0x0311, + 0x15ea: 0x00b1, 0x15eb: 0x0319, 0x15ec: 0x0101, 0x15ed: 0x0321, 0x15ee: 0x0329, 0x15ef: 0x0051, + 0x15f0: 0x0339, 0x15f1: 0x0751, 0x15f2: 0x00b9, 0x15f3: 0x0089, 0x15f4: 0x0341, 0x15f5: 0x0349, + 0x15f6: 0x0391, 0x15f7: 0x00c1, 0x15f8: 0x0109, 0x15f9: 0x00c9, 0x15fa: 0x04b1, 0x15fb: 0x1ff2, + 0x15fc: 0x2032, 0x15fd: 0x1ffa, 0x15fe: 0x21d2, 0x15ff: 0x1fda, // Block 0x58, offset 0x1600 - 0x1600: 0xb341, 0x1601: 0xb359, 0x1602: 0xb359, 0x1603: 0xb359, 0x1604: 0xb359, 0x1605: 0xb371, - 0x1606: 0xb371, 0x1607: 0xb371, 0x1608: 0xb371, 0x1609: 0xb389, 0x160a: 0xb389, 0x160b: 0xb389, - 0x160c: 0xb389, 0x160d: 0xb3a1, 0x160e: 0xb3a1, 0x160f: 0xb3a1, 0x1610: 0xb3a1, 0x1611: 0xb3b9, - 0x1612: 0xb3b9, 0x1613: 0xb3b9, 0x1614: 0xb3b9, 0x1615: 0xb3d1, 0x1616: 0xb3d1, 0x1617: 0xb3d1, - 0x1618: 0xb3d1, 0x1619: 0xb3e9, 0x161a: 0xb3e9, 0x161b: 0xb3e9, 0x161c: 0xb3e9, 0x161d: 0xb401, - 0x161e: 0xb401, 0x161f: 0xb401, 0x1620: 0xb401, 0x1621: 0xb419, 0x1622: 0xb419, 0x1623: 0xb419, - 0x1624: 0xb419, 0x1625: 0xb431, 0x1626: 0xb431, 0x1627: 0xb431, 0x1628: 0xb431, 0x1629: 0xb449, - 0x162a: 0xb449, 0x162b: 0xb449, 0x162c: 0xb449, 0x162d: 0xb461, 0x162e: 0xb461, 0x162f: 0x7b01, - 0x1630: 0x7b01, 0x1631: 0xb479, 0x1632: 0xb479, 0x1633: 0xb479, 0x1634: 0xb479, 0x1635: 0xb491, - 0x1636: 0xb491, 0x1637: 0xb4b9, 0x1638: 0xb4b9, 0x1639: 0xb4e1, 0x163a: 0xb4e1, 0x163b: 0xb509, - 0x163c: 0xb509, 0x163d: 0x0040, 0x163e: 0x0040, 0x163f: 0x03c0, + 0x1600: 0x0672, 0x1601: 0x0019, 0x1602: 0x02e9, 0x1603: 0x03d9, 0x1604: 0x02f1, 0x1605: 0x02f9, + 0x1606: 0x03f1, 0x1607: 0x0309, 0x1608: 0x00a9, 0x1609: 0x0311, 0x160a: 0x00b1, 0x160b: 0x0319, + 0x160c: 0x0101, 0x160d: 0x0321, 0x160e: 0x0329, 0x160f: 0x0051, 0x1610: 0x0339, 0x1611: 0x0751, + 0x1612: 0x00b9, 0x1613: 0x0089, 0x1614: 0x0341, 0x1615: 0x0349, 0x1616: 0x0391, 0x1617: 0x00c1, + 0x1618: 0x0109, 0x1619: 0x00c9, 0x161a: 0x04b1, 0x161b: 0x1fe2, 0x161c: 0x21da, 0x161d: 0x1fea, + 0x161e: 0x21e2, 0x161f: 0x810d, 0x1620: 0x812d, 0x1621: 0x0961, 0x1622: 0x814d, 0x1623: 0x814d, + 0x1624: 0x816d, 0x1625: 0x818d, 0x1626: 0x81ad, 0x1627: 0x81cd, 0x1628: 0x81ed, 0x1629: 0x820d, + 0x162a: 0x822d, 0x162b: 0x824d, 0x162c: 0x826d, 0x162d: 0x828d, 0x162e: 0x82ad, 0x162f: 0x82cd, + 0x1630: 0x82ed, 0x1631: 0x830d, 0x1632: 0x832d, 0x1633: 0x834d, 0x1634: 0x836d, 0x1635: 0x838d, + 0x1636: 0x83ad, 0x1637: 0x83cd, 0x1638: 0x83ed, 0x1639: 0x840d, 0x163a: 0x842d, 0x163b: 0x844d, + 0x163c: 0x81ed, 0x163d: 0x846d, 0x163e: 0x848d, 0x163f: 0x824d, // Block 0x59, offset 0x1640 - 0x1640: 0x0040, 0x1641: 0xaf4a, 0x1642: 0xb532, 0x1643: 0xafba, 0x1644: 0xb02a, 0x1645: 0xb03a, - 0x1646: 0xafca, 0x1647: 0xb542, 0x1648: 0x1fd2, 0x1649: 0x1fe2, 0x164a: 0xafda, 0x164b: 0x1fb2, - 0x164c: 0xaf2a, 0x164d: 0xafe9, 0x164e: 0x29d1, 0x164f: 0xb552, 0x1650: 0x1f41, 0x1651: 0x00c9, - 0x1652: 0x0069, 0x1653: 0x0079, 0x1654: 0x1f51, 0x1655: 0x1f61, 0x1656: 0x1f71, 0x1657: 0x1f81, - 0x1658: 0x1f91, 0x1659: 0x1fa1, 0x165a: 0xaf3a, 0x165b: 0x03c2, 0x165c: 0xaffa, 0x165d: 0x1fc2, - 0x165e: 0xb00a, 0x165f: 0xaf5a, 0x1660: 0xb04a, 0x1661: 0x0039, 0x1662: 0x0ee9, 0x1663: 0x1159, - 0x1664: 0x0ef9, 0x1665: 0x0f09, 0x1666: 0x1199, 0x1667: 0x0f31, 0x1668: 0x0249, 0x1669: 0x0f41, - 0x166a: 0x0259, 0x166b: 0x0f51, 0x166c: 0x0359, 0x166d: 0x0f61, 0x166e: 0x0f71, 0x166f: 0x00d9, - 0x1670: 0x0f99, 0x1671: 0x2039, 0x1672: 0x0269, 0x1673: 0x01d9, 0x1674: 0x0fa9, 0x1675: 0x0fb9, - 0x1676: 0x1089, 0x1677: 0x0279, 0x1678: 0x0369, 0x1679: 0x0289, 0x167a: 0x13d1, 0x167b: 0xaf9a, - 0x167c: 0xb01a, 0x167d: 0xafaa, 0x167e: 0xb562, 0x167f: 0xaf6a, + 0x1640: 0x84ad, 0x1641: 0x84cd, 0x1642: 0x84ed, 0x1643: 0x850d, 0x1644: 0x852d, 0x1645: 0x854d, + 0x1646: 0x856d, 0x1647: 0x858d, 0x1648: 0x850d, 0x1649: 0x85ad, 0x164a: 0x850d, 0x164b: 0x85cd, + 0x164c: 0x85cd, 0x164d: 0x85ed, 0x164e: 0x85ed, 0x164f: 0x860d, 0x1650: 0x854d, 0x1651: 0x862d, + 0x1652: 0x864d, 0x1653: 0x862d, 0x1654: 0x866d, 0x1655: 0x864d, 0x1656: 0x868d, 0x1657: 0x868d, + 0x1658: 0x86ad, 0x1659: 0x86ad, 0x165a: 0x86cd, 0x165b: 0x86cd, 0x165c: 0x864d, 0x165d: 0x814d, + 0x165e: 0x86ed, 0x165f: 0x870d, 0x1660: 0x0040, 0x1661: 0x872d, 0x1662: 0x874d, 0x1663: 0x876d, + 0x1664: 0x878d, 0x1665: 0x876d, 0x1666: 0x87ad, 0x1667: 0x87cd, 0x1668: 0x87ed, 0x1669: 0x87ed, + 0x166a: 0x880d, 0x166b: 0x880d, 0x166c: 0x882d, 0x166d: 0x882d, 0x166e: 0x880d, 0x166f: 0x880d, + 0x1670: 0x884d, 0x1671: 0x886d, 0x1672: 0x888d, 0x1673: 0x88ad, 0x1674: 0x88cd, 0x1675: 0x88ed, + 0x1676: 0x88ed, 0x1677: 0x88ed, 0x1678: 0x890d, 0x1679: 0x890d, 0x167a: 0x890d, 0x167b: 0x890d, + 0x167c: 0x87ed, 0x167d: 0x87ed, 0x167e: 0x87ed, 0x167f: 0x0040, // Block 0x5a, offset 0x1680 - 0x1680: 0x1caa, 0x1681: 0x0039, 0x1682: 0x0ee9, 0x1683: 0x1159, 0x1684: 0x0ef9, 0x1685: 0x0f09, - 0x1686: 0x1199, 0x1687: 0x0f31, 0x1688: 0x0249, 0x1689: 0x0f41, 0x168a: 0x0259, 0x168b: 0x0f51, - 0x168c: 0x0359, 0x168d: 0x0f61, 0x168e: 0x0f71, 0x168f: 0x00d9, 0x1690: 0x0f99, 0x1691: 0x2039, - 0x1692: 0x0269, 0x1693: 0x01d9, 0x1694: 0x0fa9, 0x1695: 0x0fb9, 0x1696: 0x1089, 0x1697: 0x0279, - 0x1698: 0x0369, 0x1699: 0x0289, 0x169a: 0x13d1, 0x169b: 0xaf7a, 0x169c: 0xb572, 0x169d: 0xaf8a, - 0x169e: 0xb582, 0x169f: 0x810d, 0x16a0: 0x812d, 0x16a1: 0x29d1, 0x16a2: 0x814d, 0x16a3: 0x814d, - 0x16a4: 0x816d, 0x16a5: 0x818d, 0x16a6: 0x81ad, 0x16a7: 0x81cd, 0x16a8: 0x81ed, 0x16a9: 0x820d, - 0x16aa: 0x822d, 0x16ab: 0x824d, 0x16ac: 0x826d, 0x16ad: 0x828d, 0x16ae: 0x82ad, 0x16af: 0x82cd, - 0x16b0: 0x82ed, 0x16b1: 0x830d, 0x16b2: 0x832d, 0x16b3: 0x834d, 0x16b4: 0x836d, 0x16b5: 0x838d, - 0x16b6: 0x83ad, 0x16b7: 0x83cd, 0x16b8: 0x83ed, 0x16b9: 0x840d, 0x16ba: 0x842d, 0x16bb: 0x844d, - 0x16bc: 0x81ed, 0x16bd: 0x846d, 0x16be: 0x848d, 0x16bf: 0x824d, + 0x1680: 0x0040, 0x1681: 0x0040, 0x1682: 0x874d, 0x1683: 0x872d, 0x1684: 0x892d, 0x1685: 0x872d, + 0x1686: 0x874d, 0x1687: 0x872d, 0x1688: 0x0040, 0x1689: 0x0040, 0x168a: 0x894d, 0x168b: 0x874d, + 0x168c: 0x896d, 0x168d: 0x892d, 0x168e: 0x896d, 0x168f: 0x874d, 0x1690: 0x0040, 0x1691: 0x0040, + 0x1692: 0x898d, 0x1693: 0x89ad, 0x1694: 0x88ad, 0x1695: 0x896d, 0x1696: 0x892d, 0x1697: 0x896d, + 0x1698: 0x0040, 0x1699: 0x0040, 0x169a: 0x89cd, 0x169b: 0x89ed, 0x169c: 0x89cd, 0x169d: 0x0040, + 0x169e: 0x0040, 0x169f: 0x0040, 0x16a0: 0x21e9, 0x16a1: 0x21f1, 0x16a2: 0x21f9, 0x16a3: 0x8a0e, + 0x16a4: 0x2201, 0x16a5: 0x2209, 0x16a6: 0x8a2d, 0x16a7: 0x0040, 0x16a8: 0x8a4d, 0x16a9: 0x8a6d, + 0x16aa: 0x8a8d, 0x16ab: 0x8a6d, 0x16ac: 0x8aad, 0x16ad: 0x8acd, 0x16ae: 0x8aed, 0x16af: 0x0040, + 0x16b0: 0x0040, 0x16b1: 0x0040, 0x16b2: 0x0040, 0x16b3: 0x0040, 0x16b4: 0x0040, 0x16b5: 0x0040, + 0x16b6: 0x0040, 0x16b7: 0x0040, 0x16b8: 0x0040, 0x16b9: 0x0340, 0x16ba: 0x0340, 0x16bb: 0x0340, + 0x16bc: 0x0040, 0x16bd: 0x0040, 0x16be: 0x0040, 0x16bf: 0x0040, // Block 0x5b, offset 0x16c0 - 0x16c0: 0x84ad, 0x16c1: 0x84cd, 0x16c2: 0x84ed, 0x16c3: 0x850d, 0x16c4: 0x852d, 0x16c5: 0x854d, - 0x16c6: 0x856d, 0x16c7: 0x858d, 0x16c8: 0x850d, 0x16c9: 0x85ad, 0x16ca: 0x850d, 0x16cb: 0x85cd, - 0x16cc: 0x85cd, 0x16cd: 0x85ed, 0x16ce: 0x85ed, 0x16cf: 0x860d, 0x16d0: 0x854d, 0x16d1: 0x862d, - 0x16d2: 0x864d, 0x16d3: 0x862d, 0x16d4: 0x866d, 0x16d5: 0x864d, 0x16d6: 0x868d, 0x16d7: 0x868d, - 0x16d8: 0x86ad, 0x16d9: 0x86ad, 0x16da: 0x86cd, 0x16db: 0x86cd, 0x16dc: 0x864d, 0x16dd: 0x814d, - 0x16de: 0x86ed, 0x16df: 0x870d, 0x16e0: 0x0040, 0x16e1: 0x872d, 0x16e2: 0x874d, 0x16e3: 0x876d, - 0x16e4: 0x878d, 0x16e5: 0x876d, 0x16e6: 0x87ad, 0x16e7: 0x87cd, 0x16e8: 0x87ed, 0x16e9: 0x87ed, - 0x16ea: 0x880d, 0x16eb: 0x880d, 0x16ec: 0x882d, 0x16ed: 0x882d, 0x16ee: 0x880d, 0x16ef: 0x880d, - 0x16f0: 0x884d, 0x16f1: 0x886d, 0x16f2: 0x888d, 0x16f3: 0x88ad, 0x16f4: 0x88cd, 0x16f5: 0x88ed, - 0x16f6: 0x88ed, 0x16f7: 0x88ed, 0x16f8: 0x890d, 0x16f9: 0x890d, 0x16fa: 0x890d, 0x16fb: 0x890d, - 0x16fc: 0x87ed, 0x16fd: 0x87ed, 0x16fe: 0x87ed, 0x16ff: 0x0040, + 0x16c0: 0x0a08, 0x16c1: 0x0a08, 0x16c2: 0x0a08, 0x16c3: 0x0a08, 0x16c4: 0x0a08, 0x16c5: 0x0c08, + 0x16c6: 0x0808, 0x16c7: 0x0c08, 0x16c8: 0x0818, 0x16c9: 0x0c08, 0x16ca: 0x0c08, 0x16cb: 0x0808, + 0x16cc: 0x0808, 0x16cd: 0x0908, 0x16ce: 0x0c08, 0x16cf: 0x0c08, 0x16d0: 0x0c08, 0x16d1: 0x0c08, + 0x16d2: 0x0c08, 0x16d3: 0x0a08, 0x16d4: 0x0a08, 0x16d5: 0x0a08, 0x16d6: 0x0a08, 0x16d7: 0x0908, + 0x16d8: 0x0a08, 0x16d9: 0x0a08, 0x16da: 0x0a08, 0x16db: 0x0a08, 0x16dc: 0x0a08, 0x16dd: 0x0c08, + 0x16de: 0x0a08, 0x16df: 0x0a08, 0x16e0: 0x0a08, 0x16e1: 0x0c08, 0x16e2: 0x0808, 0x16e3: 0x0808, + 0x16e4: 0x0c08, 0x16e5: 0x3308, 0x16e6: 0x3308, 0x16e7: 0x0040, 0x16e8: 0x0040, 0x16e9: 0x0040, + 0x16ea: 0x0040, 0x16eb: 0x0a18, 0x16ec: 0x0a18, 0x16ed: 0x0a18, 0x16ee: 0x0a18, 0x16ef: 0x0c18, + 0x16f0: 0x0818, 0x16f1: 0x0818, 0x16f2: 0x0818, 0x16f3: 0x0818, 0x16f4: 0x0818, 0x16f5: 0x0818, + 0x16f6: 0x0818, 0x16f7: 0x0040, 0x16f8: 0x0040, 0x16f9: 0x0040, 0x16fa: 0x0040, 0x16fb: 0x0040, + 0x16fc: 0x0040, 0x16fd: 0x0040, 0x16fe: 0x0040, 0x16ff: 0x0040, // Block 0x5c, offset 0x1700 - 0x1700: 0x0040, 0x1701: 0x0040, 0x1702: 0x874d, 0x1703: 0x872d, 0x1704: 0x892d, 0x1705: 0x872d, - 0x1706: 0x874d, 0x1707: 0x872d, 0x1708: 0x0040, 0x1709: 0x0040, 0x170a: 0x894d, 0x170b: 0x874d, - 0x170c: 0x896d, 0x170d: 0x892d, 0x170e: 0x896d, 0x170f: 0x874d, 0x1710: 0x0040, 0x1711: 0x0040, - 0x1712: 0x898d, 0x1713: 0x89ad, 0x1714: 0x88ad, 0x1715: 0x896d, 0x1716: 0x892d, 0x1717: 0x896d, - 0x1718: 0x0040, 0x1719: 0x0040, 0x171a: 0x89cd, 0x171b: 0x89ed, 0x171c: 0x89cd, 0x171d: 0x0040, - 0x171e: 0x0040, 0x171f: 0x0040, 0x1720: 0xb591, 0x1721: 0xb5a9, 0x1722: 0xb5c1, 0x1723: 0x8a0e, - 0x1724: 0xb5d9, 0x1725: 0xb5f1, 0x1726: 0x8a2d, 0x1727: 0x0040, 0x1728: 0x8a4d, 0x1729: 0x8a6d, - 0x172a: 0x8a8d, 0x172b: 0x8a6d, 0x172c: 0x8aad, 0x172d: 0x8acd, 0x172e: 0x8aed, 0x172f: 0x0040, + 0x1700: 0x0a08, 0x1701: 0x0c08, 0x1702: 0x0a08, 0x1703: 0x0c08, 0x1704: 0x0c08, 0x1705: 0x0c08, + 0x1706: 0x0a08, 0x1707: 0x0a08, 0x1708: 0x0a08, 0x1709: 0x0c08, 0x170a: 0x0a08, 0x170b: 0x0a08, + 0x170c: 0x0c08, 0x170d: 0x0a08, 0x170e: 0x0c08, 0x170f: 0x0c08, 0x1710: 0x0a08, 0x1711: 0x0c08, + 0x1712: 0x0040, 0x1713: 0x0040, 0x1714: 0x0040, 0x1715: 0x0040, 0x1716: 0x0040, 0x1717: 0x0040, + 0x1718: 0x0040, 0x1719: 0x0818, 0x171a: 0x0818, 0x171b: 0x0818, 0x171c: 0x0818, 0x171d: 0x0040, + 0x171e: 0x0040, 0x171f: 0x0040, 0x1720: 0x0040, 0x1721: 0x0040, 0x1722: 0x0040, 0x1723: 0x0040, + 0x1724: 0x0040, 0x1725: 0x0040, 0x1726: 0x0040, 0x1727: 0x0040, 0x1728: 0x0040, 0x1729: 0x0c18, + 0x172a: 0x0c18, 0x172b: 0x0c18, 0x172c: 0x0c18, 0x172d: 0x0a18, 0x172e: 0x0a18, 0x172f: 0x0818, 0x1730: 0x0040, 0x1731: 0x0040, 0x1732: 0x0040, 0x1733: 0x0040, 0x1734: 0x0040, 0x1735: 0x0040, - 0x1736: 0x0040, 0x1737: 0x0040, 0x1738: 0x0040, 0x1739: 0x0340, 0x173a: 0x0340, 0x173b: 0x0340, + 0x1736: 0x0040, 0x1737: 0x0040, 0x1738: 0x0040, 0x1739: 0x0040, 0x173a: 0x0040, 0x173b: 0x0040, 0x173c: 0x0040, 0x173d: 0x0040, 0x173e: 0x0040, 0x173f: 0x0040, // Block 0x5d, offset 0x1740 - 0x1740: 0x0a08, 0x1741: 0x0a08, 0x1742: 0x0a08, 0x1743: 0x0a08, 0x1744: 0x0a08, 0x1745: 0x0c08, - 0x1746: 0x0808, 0x1747: 0x0c08, 0x1748: 0x0818, 0x1749: 0x0c08, 0x174a: 0x0c08, 0x174b: 0x0808, - 0x174c: 0x0808, 0x174d: 0x0908, 0x174e: 0x0c08, 0x174f: 0x0c08, 0x1750: 0x0c08, 0x1751: 0x0c08, - 0x1752: 0x0c08, 0x1753: 0x0a08, 0x1754: 0x0a08, 0x1755: 0x0a08, 0x1756: 0x0a08, 0x1757: 0x0908, - 0x1758: 0x0a08, 0x1759: 0x0a08, 0x175a: 0x0a08, 0x175b: 0x0a08, 0x175c: 0x0a08, 0x175d: 0x0c08, - 0x175e: 0x0a08, 0x175f: 0x0a08, 0x1760: 0x0a08, 0x1761: 0x0c08, 0x1762: 0x0808, 0x1763: 0x0808, - 0x1764: 0x0c08, 0x1765: 0x3308, 0x1766: 0x3308, 0x1767: 0x0040, 0x1768: 0x0040, 0x1769: 0x0040, - 0x176a: 0x0040, 0x176b: 0x0a18, 0x176c: 0x0a18, 0x176d: 0x0a18, 0x176e: 0x0a18, 0x176f: 0x0c18, - 0x1770: 0x0818, 0x1771: 0x0818, 0x1772: 0x0818, 0x1773: 0x0818, 0x1774: 0x0818, 0x1775: 0x0818, - 0x1776: 0x0818, 0x1777: 0x0040, 0x1778: 0x0040, 0x1779: 0x0040, 0x177a: 0x0040, 0x177b: 0x0040, - 0x177c: 0x0040, 0x177d: 0x0040, 0x177e: 0x0040, 0x177f: 0x0040, + 0x1740: 0x3308, 0x1741: 0x3308, 0x1742: 0x3008, 0x1743: 0x3008, 0x1744: 0x0040, 0x1745: 0x0008, + 0x1746: 0x0008, 0x1747: 0x0008, 0x1748: 0x0008, 0x1749: 0x0008, 0x174a: 0x0008, 0x174b: 0x0008, + 0x174c: 0x0008, 0x174d: 0x0040, 0x174e: 0x0040, 0x174f: 0x0008, 0x1750: 0x0008, 0x1751: 0x0040, + 0x1752: 0x0040, 0x1753: 0x0008, 0x1754: 0x0008, 0x1755: 0x0008, 0x1756: 0x0008, 0x1757: 0x0008, + 0x1758: 0x0008, 0x1759: 0x0008, 0x175a: 0x0008, 0x175b: 0x0008, 0x175c: 0x0008, 0x175d: 0x0008, + 0x175e: 0x0008, 0x175f: 0x0008, 0x1760: 0x0008, 0x1761: 0x0008, 0x1762: 0x0008, 0x1763: 0x0008, + 0x1764: 0x0008, 0x1765: 0x0008, 0x1766: 0x0008, 0x1767: 0x0008, 0x1768: 0x0008, 0x1769: 0x0040, + 0x176a: 0x0008, 0x176b: 0x0008, 0x176c: 0x0008, 0x176d: 0x0008, 0x176e: 0x0008, 0x176f: 0x0008, + 0x1770: 0x0008, 0x1771: 0x0040, 0x1772: 0x0008, 0x1773: 0x0008, 0x1774: 0x0040, 0x1775: 0x0008, + 0x1776: 0x0008, 0x1777: 0x0008, 0x1778: 0x0008, 0x1779: 0x0008, 0x177a: 0x0040, 0x177b: 0x3308, + 0x177c: 0x3308, 0x177d: 0x0008, 0x177e: 0x3008, 0x177f: 0x3008, // Block 0x5e, offset 0x1780 - 0x1780: 0x0a08, 0x1781: 0x0c08, 0x1782: 0x0a08, 0x1783: 0x0c08, 0x1784: 0x0c08, 0x1785: 0x0c08, - 0x1786: 0x0a08, 0x1787: 0x0a08, 0x1788: 0x0a08, 0x1789: 0x0c08, 0x178a: 0x0a08, 0x178b: 0x0a08, - 0x178c: 0x0c08, 0x178d: 0x0a08, 0x178e: 0x0c08, 0x178f: 0x0c08, 0x1790: 0x0a08, 0x1791: 0x0c08, - 0x1792: 0x0040, 0x1793: 0x0040, 0x1794: 0x0040, 0x1795: 0x0040, 0x1796: 0x0040, 0x1797: 0x0040, - 0x1798: 0x0040, 0x1799: 0x0818, 0x179a: 0x0818, 0x179b: 0x0818, 0x179c: 0x0818, 0x179d: 0x0040, - 0x179e: 0x0040, 0x179f: 0x0040, 0x17a0: 0x0040, 0x17a1: 0x0040, 0x17a2: 0x0040, 0x17a3: 0x0040, - 0x17a4: 0x0040, 0x17a5: 0x0040, 0x17a6: 0x0040, 0x17a7: 0x0040, 0x17a8: 0x0040, 0x17a9: 0x0c18, - 0x17aa: 0x0c18, 0x17ab: 0x0c18, 0x17ac: 0x0c18, 0x17ad: 0x0a18, 0x17ae: 0x0a18, 0x17af: 0x0818, - 0x17b0: 0x0040, 0x17b1: 0x0040, 0x17b2: 0x0040, 0x17b3: 0x0040, 0x17b4: 0x0040, 0x17b5: 0x0040, + 0x1780: 0x3308, 0x1781: 0x3008, 0x1782: 0x3008, 0x1783: 0x3008, 0x1784: 0x3008, 0x1785: 0x0040, + 0x1786: 0x0040, 0x1787: 0x3008, 0x1788: 0x3008, 0x1789: 0x0040, 0x178a: 0x0040, 0x178b: 0x3008, + 0x178c: 0x3008, 0x178d: 0x3808, 0x178e: 0x0040, 0x178f: 0x0040, 0x1790: 0x0008, 0x1791: 0x0040, + 0x1792: 0x0040, 0x1793: 0x0040, 0x1794: 0x0040, 0x1795: 0x0040, 0x1796: 0x0040, 0x1797: 0x3008, + 0x1798: 0x0040, 0x1799: 0x0040, 0x179a: 0x0040, 0x179b: 0x0040, 0x179c: 0x0040, 0x179d: 0x0008, + 0x179e: 0x0008, 0x179f: 0x0008, 0x17a0: 0x0008, 0x17a1: 0x0008, 0x17a2: 0x3008, 0x17a3: 0x3008, + 0x17a4: 0x0040, 0x17a5: 0x0040, 0x17a6: 0x3308, 0x17a7: 0x3308, 0x17a8: 0x3308, 0x17a9: 0x3308, + 0x17aa: 0x3308, 0x17ab: 0x3308, 0x17ac: 0x3308, 0x17ad: 0x0040, 0x17ae: 0x0040, 0x17af: 0x0040, + 0x17b0: 0x3308, 0x17b1: 0x3308, 0x17b2: 0x3308, 0x17b3: 0x3308, 0x17b4: 0x3308, 0x17b5: 0x0040, 0x17b6: 0x0040, 0x17b7: 0x0040, 0x17b8: 0x0040, 0x17b9: 0x0040, 0x17ba: 0x0040, 0x17bb: 0x0040, 0x17bc: 0x0040, 0x17bd: 0x0040, 0x17be: 0x0040, 0x17bf: 0x0040, // Block 0x5f, offset 0x17c0 - 0x17c0: 0x3308, 0x17c1: 0x3308, 0x17c2: 0x3008, 0x17c3: 0x3008, 0x17c4: 0x0040, 0x17c5: 0x0008, - 0x17c6: 0x0008, 0x17c7: 0x0008, 0x17c8: 0x0008, 0x17c9: 0x0008, 0x17ca: 0x0008, 0x17cb: 0x0008, - 0x17cc: 0x0008, 0x17cd: 0x0040, 0x17ce: 0x0040, 0x17cf: 0x0008, 0x17d0: 0x0008, 0x17d1: 0x0040, - 0x17d2: 0x0040, 0x17d3: 0x0008, 0x17d4: 0x0008, 0x17d5: 0x0008, 0x17d6: 0x0008, 0x17d7: 0x0008, + 0x17c0: 0x0008, 0x17c1: 0x0008, 0x17c2: 0x0008, 0x17c3: 0x0008, 0x17c4: 0x0008, 0x17c5: 0x0008, + 0x17c6: 0x0008, 0x17c7: 0x0040, 0x17c8: 0x0040, 0x17c9: 0x0008, 0x17ca: 0x0040, 0x17cb: 0x0040, + 0x17cc: 0x0008, 0x17cd: 0x0008, 0x17ce: 0x0008, 0x17cf: 0x0008, 0x17d0: 0x0008, 0x17d1: 0x0008, + 0x17d2: 0x0008, 0x17d3: 0x0008, 0x17d4: 0x0040, 0x17d5: 0x0008, 0x17d6: 0x0008, 0x17d7: 0x0040, 0x17d8: 0x0008, 0x17d9: 0x0008, 0x17da: 0x0008, 0x17db: 0x0008, 0x17dc: 0x0008, 0x17dd: 0x0008, 0x17de: 0x0008, 0x17df: 0x0008, 0x17e0: 0x0008, 0x17e1: 0x0008, 0x17e2: 0x0008, 0x17e3: 0x0008, - 0x17e4: 0x0008, 0x17e5: 0x0008, 0x17e6: 0x0008, 0x17e7: 0x0008, 0x17e8: 0x0008, 0x17e9: 0x0040, + 0x17e4: 0x0008, 0x17e5: 0x0008, 0x17e6: 0x0008, 0x17e7: 0x0008, 0x17e8: 0x0008, 0x17e9: 0x0008, 0x17ea: 0x0008, 0x17eb: 0x0008, 0x17ec: 0x0008, 0x17ed: 0x0008, 0x17ee: 0x0008, 0x17ef: 0x0008, - 0x17f0: 0x0008, 0x17f1: 0x0040, 0x17f2: 0x0008, 0x17f3: 0x0008, 0x17f4: 0x0040, 0x17f5: 0x0008, - 0x17f6: 0x0008, 0x17f7: 0x0008, 0x17f8: 0x0008, 0x17f9: 0x0008, 0x17fa: 0x0040, 0x17fb: 0x3308, - 0x17fc: 0x3308, 0x17fd: 0x0008, 0x17fe: 0x3008, 0x17ff: 0x3008, + 0x17f0: 0x3008, 0x17f1: 0x3008, 0x17f2: 0x3008, 0x17f3: 0x3008, 0x17f4: 0x3008, 0x17f5: 0x3008, + 0x17f6: 0x0040, 0x17f7: 0x3008, 0x17f8: 0x3008, 0x17f9: 0x0040, 0x17fa: 0x0040, 0x17fb: 0x3308, + 0x17fc: 0x3308, 0x17fd: 0x3808, 0x17fe: 0x3b08, 0x17ff: 0x0008, // Block 0x60, offset 0x1800 - 0x1800: 0x3308, 0x1801: 0x3008, 0x1802: 0x3008, 0x1803: 0x3008, 0x1804: 0x3008, 0x1805: 0x0040, - 0x1806: 0x0040, 0x1807: 0x3008, 0x1808: 0x3008, 0x1809: 0x0040, 0x180a: 0x0040, 0x180b: 0x3008, - 0x180c: 0x3008, 0x180d: 0x3808, 0x180e: 0x0040, 0x180f: 0x0040, 0x1810: 0x0008, 0x1811: 0x0040, - 0x1812: 0x0040, 0x1813: 0x0040, 0x1814: 0x0040, 0x1815: 0x0040, 0x1816: 0x0040, 0x1817: 0x3008, - 0x1818: 0x0040, 0x1819: 0x0040, 0x181a: 0x0040, 0x181b: 0x0040, 0x181c: 0x0040, 0x181d: 0x0008, - 0x181e: 0x0008, 0x181f: 0x0008, 0x1820: 0x0008, 0x1821: 0x0008, 0x1822: 0x3008, 0x1823: 0x3008, - 0x1824: 0x0040, 0x1825: 0x0040, 0x1826: 0x3308, 0x1827: 0x3308, 0x1828: 0x3308, 0x1829: 0x3308, - 0x182a: 0x3308, 0x182b: 0x3308, 0x182c: 0x3308, 0x182d: 0x0040, 0x182e: 0x0040, 0x182f: 0x0040, - 0x1830: 0x3308, 0x1831: 0x3308, 0x1832: 0x3308, 0x1833: 0x3308, 0x1834: 0x3308, 0x1835: 0x0040, - 0x1836: 0x0040, 0x1837: 0x0040, 0x1838: 0x0040, 0x1839: 0x0040, 0x183a: 0x0040, 0x183b: 0x0040, - 0x183c: 0x0040, 0x183d: 0x0040, 0x183e: 0x0040, 0x183f: 0x0040, + 0x1800: 0x0019, 0x1801: 0x02e9, 0x1802: 0x03d9, 0x1803: 0x02f1, 0x1804: 0x02f9, 0x1805: 0x03f1, + 0x1806: 0x0309, 0x1807: 0x00a9, 0x1808: 0x0311, 0x1809: 0x00b1, 0x180a: 0x0319, 0x180b: 0x0101, + 0x180c: 0x0321, 0x180d: 0x0329, 0x180e: 0x0051, 0x180f: 0x0339, 0x1810: 0x0751, 0x1811: 0x00b9, + 0x1812: 0x0089, 0x1813: 0x0341, 0x1814: 0x0349, 0x1815: 0x0391, 0x1816: 0x00c1, 0x1817: 0x0109, + 0x1818: 0x00c9, 0x1819: 0x04b1, 0x181a: 0x0019, 0x181b: 0x02e9, 0x181c: 0x03d9, 0x181d: 0x02f1, + 0x181e: 0x02f9, 0x181f: 0x03f1, 0x1820: 0x0309, 0x1821: 0x00a9, 0x1822: 0x0311, 0x1823: 0x00b1, + 0x1824: 0x0319, 0x1825: 0x0101, 0x1826: 0x0321, 0x1827: 0x0329, 0x1828: 0x0051, 0x1829: 0x0339, + 0x182a: 0x0751, 0x182b: 0x00b9, 0x182c: 0x0089, 0x182d: 0x0341, 0x182e: 0x0349, 0x182f: 0x0391, + 0x1830: 0x00c1, 0x1831: 0x0109, 0x1832: 0x00c9, 0x1833: 0x04b1, 0x1834: 0x0019, 0x1835: 0x02e9, + 0x1836: 0x03d9, 0x1837: 0x02f1, 0x1838: 0x02f9, 0x1839: 0x03f1, 0x183a: 0x0309, 0x183b: 0x00a9, + 0x183c: 0x0311, 0x183d: 0x00b1, 0x183e: 0x0319, 0x183f: 0x0101, // Block 0x61, offset 0x1840 - 0x1840: 0x0008, 0x1841: 0x0008, 0x1842: 0x0008, 0x1843: 0x0008, 0x1844: 0x0008, 0x1845: 0x0008, - 0x1846: 0x0008, 0x1847: 0x0040, 0x1848: 0x0040, 0x1849: 0x0008, 0x184a: 0x0040, 0x184b: 0x0040, - 0x184c: 0x0008, 0x184d: 0x0008, 0x184e: 0x0008, 0x184f: 0x0008, 0x1850: 0x0008, 0x1851: 0x0008, - 0x1852: 0x0008, 0x1853: 0x0008, 0x1854: 0x0040, 0x1855: 0x0008, 0x1856: 0x0008, 0x1857: 0x0040, - 0x1858: 0x0008, 0x1859: 0x0008, 0x185a: 0x0008, 0x185b: 0x0008, 0x185c: 0x0008, 0x185d: 0x0008, - 0x185e: 0x0008, 0x185f: 0x0008, 0x1860: 0x0008, 0x1861: 0x0008, 0x1862: 0x0008, 0x1863: 0x0008, - 0x1864: 0x0008, 0x1865: 0x0008, 0x1866: 0x0008, 0x1867: 0x0008, 0x1868: 0x0008, 0x1869: 0x0008, - 0x186a: 0x0008, 0x186b: 0x0008, 0x186c: 0x0008, 0x186d: 0x0008, 0x186e: 0x0008, 0x186f: 0x0008, - 0x1870: 0x3008, 0x1871: 0x3008, 0x1872: 0x3008, 0x1873: 0x3008, 0x1874: 0x3008, 0x1875: 0x3008, - 0x1876: 0x0040, 0x1877: 0x3008, 0x1878: 0x3008, 0x1879: 0x0040, 0x187a: 0x0040, 0x187b: 0x3308, - 0x187c: 0x3308, 0x187d: 0x3808, 0x187e: 0x3b08, 0x187f: 0x0008, + 0x1840: 0x0321, 0x1841: 0x0329, 0x1842: 0x0051, 0x1843: 0x0339, 0x1844: 0x0751, 0x1845: 0x00b9, + 0x1846: 0x0089, 0x1847: 0x0341, 0x1848: 0x0349, 0x1849: 0x0391, 0x184a: 0x00c1, 0x184b: 0x0109, + 0x184c: 0x00c9, 0x184d: 0x04b1, 0x184e: 0x0019, 0x184f: 0x02e9, 0x1850: 0x03d9, 0x1851: 0x02f1, + 0x1852: 0x02f9, 0x1853: 0x03f1, 0x1854: 0x0309, 0x1855: 0x0040, 0x1856: 0x0311, 0x1857: 0x00b1, + 0x1858: 0x0319, 0x1859: 0x0101, 0x185a: 0x0321, 0x185b: 0x0329, 0x185c: 0x0051, 0x185d: 0x0339, + 0x185e: 0x0751, 0x185f: 0x00b9, 0x1860: 0x0089, 0x1861: 0x0341, 0x1862: 0x0349, 0x1863: 0x0391, + 0x1864: 0x00c1, 0x1865: 0x0109, 0x1866: 0x00c9, 0x1867: 0x04b1, 0x1868: 0x0019, 0x1869: 0x02e9, + 0x186a: 0x03d9, 0x186b: 0x02f1, 0x186c: 0x02f9, 0x186d: 0x03f1, 0x186e: 0x0309, 0x186f: 0x00a9, + 0x1870: 0x0311, 0x1871: 0x00b1, 0x1872: 0x0319, 0x1873: 0x0101, 0x1874: 0x0321, 0x1875: 0x0329, + 0x1876: 0x0051, 0x1877: 0x0339, 0x1878: 0x0751, 0x1879: 0x00b9, 0x187a: 0x0089, 0x187b: 0x0341, + 0x187c: 0x0349, 0x187d: 0x0391, 0x187e: 0x00c1, 0x187f: 0x0109, // Block 0x62, offset 0x1880 - 0x1880: 0x0039, 0x1881: 0x0ee9, 0x1882: 0x1159, 0x1883: 0x0ef9, 0x1884: 0x0f09, 0x1885: 0x1199, - 0x1886: 0x0f31, 0x1887: 0x0249, 0x1888: 0x0f41, 0x1889: 0x0259, 0x188a: 0x0f51, 0x188b: 0x0359, - 0x188c: 0x0f61, 0x188d: 0x0f71, 0x188e: 0x00d9, 0x188f: 0x0f99, 0x1890: 0x2039, 0x1891: 0x0269, - 0x1892: 0x01d9, 0x1893: 0x0fa9, 0x1894: 0x0fb9, 0x1895: 0x1089, 0x1896: 0x0279, 0x1897: 0x0369, - 0x1898: 0x0289, 0x1899: 0x13d1, 0x189a: 0x0039, 0x189b: 0x0ee9, 0x189c: 0x1159, 0x189d: 0x0ef9, - 0x189e: 0x0f09, 0x189f: 0x1199, 0x18a0: 0x0f31, 0x18a1: 0x0249, 0x18a2: 0x0f41, 0x18a3: 0x0259, - 0x18a4: 0x0f51, 0x18a5: 0x0359, 0x18a6: 0x0f61, 0x18a7: 0x0f71, 0x18a8: 0x00d9, 0x18a9: 0x0f99, - 0x18aa: 0x2039, 0x18ab: 0x0269, 0x18ac: 0x01d9, 0x18ad: 0x0fa9, 0x18ae: 0x0fb9, 0x18af: 0x1089, - 0x18b0: 0x0279, 0x18b1: 0x0369, 0x18b2: 0x0289, 0x18b3: 0x13d1, 0x18b4: 0x0039, 0x18b5: 0x0ee9, - 0x18b6: 0x1159, 0x18b7: 0x0ef9, 0x18b8: 0x0f09, 0x18b9: 0x1199, 0x18ba: 0x0f31, 0x18bb: 0x0249, - 0x18bc: 0x0f41, 0x18bd: 0x0259, 0x18be: 0x0f51, 0x18bf: 0x0359, + 0x1880: 0x00c9, 0x1881: 0x04b1, 0x1882: 0x0019, 0x1883: 0x02e9, 0x1884: 0x03d9, 0x1885: 0x02f1, + 0x1886: 0x02f9, 0x1887: 0x03f1, 0x1888: 0x0309, 0x1889: 0x00a9, 0x188a: 0x0311, 0x188b: 0x00b1, + 0x188c: 0x0319, 0x188d: 0x0101, 0x188e: 0x0321, 0x188f: 0x0329, 0x1890: 0x0051, 0x1891: 0x0339, + 0x1892: 0x0751, 0x1893: 0x00b9, 0x1894: 0x0089, 0x1895: 0x0341, 0x1896: 0x0349, 0x1897: 0x0391, + 0x1898: 0x00c1, 0x1899: 0x0109, 0x189a: 0x00c9, 0x189b: 0x04b1, 0x189c: 0x0019, 0x189d: 0x0040, + 0x189e: 0x03d9, 0x189f: 0x02f1, 0x18a0: 0x0040, 0x18a1: 0x0040, 0x18a2: 0x0309, 0x18a3: 0x0040, + 0x18a4: 0x0040, 0x18a5: 0x00b1, 0x18a6: 0x0319, 0x18a7: 0x0040, 0x18a8: 0x0040, 0x18a9: 0x0329, + 0x18aa: 0x0051, 0x18ab: 0x0339, 0x18ac: 0x0751, 0x18ad: 0x0040, 0x18ae: 0x0089, 0x18af: 0x0341, + 0x18b0: 0x0349, 0x18b1: 0x0391, 0x18b2: 0x00c1, 0x18b3: 0x0109, 0x18b4: 0x00c9, 0x18b5: 0x04b1, + 0x18b6: 0x0019, 0x18b7: 0x02e9, 0x18b8: 0x03d9, 0x18b9: 0x02f1, 0x18ba: 0x0040, 0x18bb: 0x03f1, + 0x18bc: 0x0040, 0x18bd: 0x00a9, 0x18be: 0x0311, 0x18bf: 0x00b1, // Block 0x63, offset 0x18c0 - 0x18c0: 0x0f61, 0x18c1: 0x0f71, 0x18c2: 0x00d9, 0x18c3: 0x0f99, 0x18c4: 0x2039, 0x18c5: 0x0269, - 0x18c6: 0x01d9, 0x18c7: 0x0fa9, 0x18c8: 0x0fb9, 0x18c9: 0x1089, 0x18ca: 0x0279, 0x18cb: 0x0369, - 0x18cc: 0x0289, 0x18cd: 0x13d1, 0x18ce: 0x0039, 0x18cf: 0x0ee9, 0x18d0: 0x1159, 0x18d1: 0x0ef9, - 0x18d2: 0x0f09, 0x18d3: 0x1199, 0x18d4: 0x0f31, 0x18d5: 0x0040, 0x18d6: 0x0f41, 0x18d7: 0x0259, - 0x18d8: 0x0f51, 0x18d9: 0x0359, 0x18da: 0x0f61, 0x18db: 0x0f71, 0x18dc: 0x00d9, 0x18dd: 0x0f99, - 0x18de: 0x2039, 0x18df: 0x0269, 0x18e0: 0x01d9, 0x18e1: 0x0fa9, 0x18e2: 0x0fb9, 0x18e3: 0x1089, - 0x18e4: 0x0279, 0x18e5: 0x0369, 0x18e6: 0x0289, 0x18e7: 0x13d1, 0x18e8: 0x0039, 0x18e9: 0x0ee9, - 0x18ea: 0x1159, 0x18eb: 0x0ef9, 0x18ec: 0x0f09, 0x18ed: 0x1199, 0x18ee: 0x0f31, 0x18ef: 0x0249, - 0x18f0: 0x0f41, 0x18f1: 0x0259, 0x18f2: 0x0f51, 0x18f3: 0x0359, 0x18f4: 0x0f61, 0x18f5: 0x0f71, - 0x18f6: 0x00d9, 0x18f7: 0x0f99, 0x18f8: 0x2039, 0x18f9: 0x0269, 0x18fa: 0x01d9, 0x18fb: 0x0fa9, - 0x18fc: 0x0fb9, 0x18fd: 0x1089, 0x18fe: 0x0279, 0x18ff: 0x0369, + 0x18c0: 0x0319, 0x18c1: 0x0101, 0x18c2: 0x0321, 0x18c3: 0x0329, 0x18c4: 0x0040, 0x18c5: 0x0339, + 0x18c6: 0x0751, 0x18c7: 0x00b9, 0x18c8: 0x0089, 0x18c9: 0x0341, 0x18ca: 0x0349, 0x18cb: 0x0391, + 0x18cc: 0x00c1, 0x18cd: 0x0109, 0x18ce: 0x00c9, 0x18cf: 0x04b1, 0x18d0: 0x0019, 0x18d1: 0x02e9, + 0x18d2: 0x03d9, 0x18d3: 0x02f1, 0x18d4: 0x02f9, 0x18d5: 0x03f1, 0x18d6: 0x0309, 0x18d7: 0x00a9, + 0x18d8: 0x0311, 0x18d9: 0x00b1, 0x18da: 0x0319, 0x18db: 0x0101, 0x18dc: 0x0321, 0x18dd: 0x0329, + 0x18de: 0x0051, 0x18df: 0x0339, 0x18e0: 0x0751, 0x18e1: 0x00b9, 0x18e2: 0x0089, 0x18e3: 0x0341, + 0x18e4: 0x0349, 0x18e5: 0x0391, 0x18e6: 0x00c1, 0x18e7: 0x0109, 0x18e8: 0x00c9, 0x18e9: 0x04b1, + 0x18ea: 0x0019, 0x18eb: 0x02e9, 0x18ec: 0x03d9, 0x18ed: 0x02f1, 0x18ee: 0x02f9, 0x18ef: 0x03f1, + 0x18f0: 0x0309, 0x18f1: 0x00a9, 0x18f2: 0x0311, 0x18f3: 0x00b1, 0x18f4: 0x0319, 0x18f5: 0x0101, + 0x18f6: 0x0321, 0x18f7: 0x0329, 0x18f8: 0x0051, 0x18f9: 0x0339, 0x18fa: 0x0751, 0x18fb: 0x00b9, + 0x18fc: 0x0089, 0x18fd: 0x0341, 0x18fe: 0x0349, 0x18ff: 0x0391, // Block 0x64, offset 0x1900 - 0x1900: 0x0289, 0x1901: 0x13d1, 0x1902: 0x0039, 0x1903: 0x0ee9, 0x1904: 0x1159, 0x1905: 0x0ef9, - 0x1906: 0x0f09, 0x1907: 0x1199, 0x1908: 0x0f31, 0x1909: 0x0249, 0x190a: 0x0f41, 0x190b: 0x0259, - 0x190c: 0x0f51, 0x190d: 0x0359, 0x190e: 0x0f61, 0x190f: 0x0f71, 0x1910: 0x00d9, 0x1911: 0x0f99, - 0x1912: 0x2039, 0x1913: 0x0269, 0x1914: 0x01d9, 0x1915: 0x0fa9, 0x1916: 0x0fb9, 0x1917: 0x1089, - 0x1918: 0x0279, 0x1919: 0x0369, 0x191a: 0x0289, 0x191b: 0x13d1, 0x191c: 0x0039, 0x191d: 0x0040, - 0x191e: 0x1159, 0x191f: 0x0ef9, 0x1920: 0x0040, 0x1921: 0x0040, 0x1922: 0x0f31, 0x1923: 0x0040, - 0x1924: 0x0040, 0x1925: 0x0259, 0x1926: 0x0f51, 0x1927: 0x0040, 0x1928: 0x0040, 0x1929: 0x0f71, - 0x192a: 0x00d9, 0x192b: 0x0f99, 0x192c: 0x2039, 0x192d: 0x0040, 0x192e: 0x01d9, 0x192f: 0x0fa9, - 0x1930: 0x0fb9, 0x1931: 0x1089, 0x1932: 0x0279, 0x1933: 0x0369, 0x1934: 0x0289, 0x1935: 0x13d1, - 0x1936: 0x0039, 0x1937: 0x0ee9, 0x1938: 0x1159, 0x1939: 0x0ef9, 0x193a: 0x0040, 0x193b: 0x1199, - 0x193c: 0x0040, 0x193d: 0x0249, 0x193e: 0x0f41, 0x193f: 0x0259, + 0x1900: 0x00c1, 0x1901: 0x0109, 0x1902: 0x00c9, 0x1903: 0x04b1, 0x1904: 0x0019, 0x1905: 0x02e9, + 0x1906: 0x0040, 0x1907: 0x02f1, 0x1908: 0x02f9, 0x1909: 0x03f1, 0x190a: 0x0309, 0x190b: 0x0040, + 0x190c: 0x0040, 0x190d: 0x00b1, 0x190e: 0x0319, 0x190f: 0x0101, 0x1910: 0x0321, 0x1911: 0x0329, + 0x1912: 0x0051, 0x1913: 0x0339, 0x1914: 0x0751, 0x1915: 0x0040, 0x1916: 0x0089, 0x1917: 0x0341, + 0x1918: 0x0349, 0x1919: 0x0391, 0x191a: 0x00c1, 0x191b: 0x0109, 0x191c: 0x00c9, 0x191d: 0x0040, + 0x191e: 0x0019, 0x191f: 0x02e9, 0x1920: 0x03d9, 0x1921: 0x02f1, 0x1922: 0x02f9, 0x1923: 0x03f1, + 0x1924: 0x0309, 0x1925: 0x00a9, 0x1926: 0x0311, 0x1927: 0x00b1, 0x1928: 0x0319, 0x1929: 0x0101, + 0x192a: 0x0321, 0x192b: 0x0329, 0x192c: 0x0051, 0x192d: 0x0339, 0x192e: 0x0751, 0x192f: 0x00b9, + 0x1930: 0x0089, 0x1931: 0x0341, 0x1932: 0x0349, 0x1933: 0x0391, 0x1934: 0x00c1, 0x1935: 0x0109, + 0x1936: 0x00c9, 0x1937: 0x04b1, 0x1938: 0x0019, 0x1939: 0x02e9, 0x193a: 0x0040, 0x193b: 0x02f1, + 0x193c: 0x02f9, 0x193d: 0x03f1, 0x193e: 0x0309, 0x193f: 0x0040, // Block 0x65, offset 0x1940 - 0x1940: 0x0f51, 0x1941: 0x0359, 0x1942: 0x0f61, 0x1943: 0x0f71, 0x1944: 0x0040, 0x1945: 0x0f99, - 0x1946: 0x2039, 0x1947: 0x0269, 0x1948: 0x01d9, 0x1949: 0x0fa9, 0x194a: 0x0fb9, 0x194b: 0x1089, - 0x194c: 0x0279, 0x194d: 0x0369, 0x194e: 0x0289, 0x194f: 0x13d1, 0x1950: 0x0039, 0x1951: 0x0ee9, - 0x1952: 0x1159, 0x1953: 0x0ef9, 0x1954: 0x0f09, 0x1955: 0x1199, 0x1956: 0x0f31, 0x1957: 0x0249, - 0x1958: 0x0f41, 0x1959: 0x0259, 0x195a: 0x0f51, 0x195b: 0x0359, 0x195c: 0x0f61, 0x195d: 0x0f71, - 0x195e: 0x00d9, 0x195f: 0x0f99, 0x1960: 0x2039, 0x1961: 0x0269, 0x1962: 0x01d9, 0x1963: 0x0fa9, - 0x1964: 0x0fb9, 0x1965: 0x1089, 0x1966: 0x0279, 0x1967: 0x0369, 0x1968: 0x0289, 0x1969: 0x13d1, - 0x196a: 0x0039, 0x196b: 0x0ee9, 0x196c: 0x1159, 0x196d: 0x0ef9, 0x196e: 0x0f09, 0x196f: 0x1199, - 0x1970: 0x0f31, 0x1971: 0x0249, 0x1972: 0x0f41, 0x1973: 0x0259, 0x1974: 0x0f51, 0x1975: 0x0359, - 0x1976: 0x0f61, 0x1977: 0x0f71, 0x1978: 0x00d9, 0x1979: 0x0f99, 0x197a: 0x2039, 0x197b: 0x0269, - 0x197c: 0x01d9, 0x197d: 0x0fa9, 0x197e: 0x0fb9, 0x197f: 0x1089, + 0x1940: 0x0311, 0x1941: 0x00b1, 0x1942: 0x0319, 0x1943: 0x0101, 0x1944: 0x0321, 0x1945: 0x0040, + 0x1946: 0x0051, 0x1947: 0x0040, 0x1948: 0x0040, 0x1949: 0x0040, 0x194a: 0x0089, 0x194b: 0x0341, + 0x194c: 0x0349, 0x194d: 0x0391, 0x194e: 0x00c1, 0x194f: 0x0109, 0x1950: 0x00c9, 0x1951: 0x0040, + 0x1952: 0x0019, 0x1953: 0x02e9, 0x1954: 0x03d9, 0x1955: 0x02f1, 0x1956: 0x02f9, 0x1957: 0x03f1, + 0x1958: 0x0309, 0x1959: 0x00a9, 0x195a: 0x0311, 0x195b: 0x00b1, 0x195c: 0x0319, 0x195d: 0x0101, + 0x195e: 0x0321, 0x195f: 0x0329, 0x1960: 0x0051, 0x1961: 0x0339, 0x1962: 0x0751, 0x1963: 0x00b9, + 0x1964: 0x0089, 0x1965: 0x0341, 0x1966: 0x0349, 0x1967: 0x0391, 0x1968: 0x00c1, 0x1969: 0x0109, + 0x196a: 0x00c9, 0x196b: 0x04b1, 0x196c: 0x0019, 0x196d: 0x02e9, 0x196e: 0x03d9, 0x196f: 0x02f1, + 0x1970: 0x02f9, 0x1971: 0x03f1, 0x1972: 0x0309, 0x1973: 0x00a9, 0x1974: 0x0311, 0x1975: 0x00b1, + 0x1976: 0x0319, 0x1977: 0x0101, 0x1978: 0x0321, 0x1979: 0x0329, 0x197a: 0x0051, 0x197b: 0x0339, + 0x197c: 0x0751, 0x197d: 0x00b9, 0x197e: 0x0089, 0x197f: 0x0341, // Block 0x66, offset 0x1980 - 0x1980: 0x0279, 0x1981: 0x0369, 0x1982: 0x0289, 0x1983: 0x13d1, 0x1984: 0x0039, 0x1985: 0x0ee9, - 0x1986: 0x0040, 0x1987: 0x0ef9, 0x1988: 0x0f09, 0x1989: 0x1199, 0x198a: 0x0f31, 0x198b: 0x0040, - 0x198c: 0x0040, 0x198d: 0x0259, 0x198e: 0x0f51, 0x198f: 0x0359, 0x1990: 0x0f61, 0x1991: 0x0f71, - 0x1992: 0x00d9, 0x1993: 0x0f99, 0x1994: 0x2039, 0x1995: 0x0040, 0x1996: 0x01d9, 0x1997: 0x0fa9, - 0x1998: 0x0fb9, 0x1999: 0x1089, 0x199a: 0x0279, 0x199b: 0x0369, 0x199c: 0x0289, 0x199d: 0x0040, - 0x199e: 0x0039, 0x199f: 0x0ee9, 0x19a0: 0x1159, 0x19a1: 0x0ef9, 0x19a2: 0x0f09, 0x19a3: 0x1199, - 0x19a4: 0x0f31, 0x19a5: 0x0249, 0x19a6: 0x0f41, 0x19a7: 0x0259, 0x19a8: 0x0f51, 0x19a9: 0x0359, - 0x19aa: 0x0f61, 0x19ab: 0x0f71, 0x19ac: 0x00d9, 0x19ad: 0x0f99, 0x19ae: 0x2039, 0x19af: 0x0269, - 0x19b0: 0x01d9, 0x19b1: 0x0fa9, 0x19b2: 0x0fb9, 0x19b3: 0x1089, 0x19b4: 0x0279, 0x19b5: 0x0369, - 0x19b6: 0x0289, 0x19b7: 0x13d1, 0x19b8: 0x0039, 0x19b9: 0x0ee9, 0x19ba: 0x0040, 0x19bb: 0x0ef9, - 0x19bc: 0x0f09, 0x19bd: 0x1199, 0x19be: 0x0f31, 0x19bf: 0x0040, + 0x1980: 0x0349, 0x1981: 0x0391, 0x1982: 0x00c1, 0x1983: 0x0109, 0x1984: 0x00c9, 0x1985: 0x04b1, + 0x1986: 0x0019, 0x1987: 0x02e9, 0x1988: 0x03d9, 0x1989: 0x02f1, 0x198a: 0x02f9, 0x198b: 0x03f1, + 0x198c: 0x0309, 0x198d: 0x00a9, 0x198e: 0x0311, 0x198f: 0x00b1, 0x1990: 0x0319, 0x1991: 0x0101, + 0x1992: 0x0321, 0x1993: 0x0329, 0x1994: 0x0051, 0x1995: 0x0339, 0x1996: 0x0751, 0x1997: 0x00b9, + 0x1998: 0x0089, 0x1999: 0x0341, 0x199a: 0x0349, 0x199b: 0x0391, 0x199c: 0x00c1, 0x199d: 0x0109, + 0x199e: 0x00c9, 0x199f: 0x04b1, 0x19a0: 0x0019, 0x19a1: 0x02e9, 0x19a2: 0x03d9, 0x19a3: 0x02f1, + 0x19a4: 0x02f9, 0x19a5: 0x03f1, 0x19a6: 0x0309, 0x19a7: 0x00a9, 0x19a8: 0x0311, 0x19a9: 0x00b1, + 0x19aa: 0x0319, 0x19ab: 0x0101, 0x19ac: 0x0321, 0x19ad: 0x0329, 0x19ae: 0x0051, 0x19af: 0x0339, + 0x19b0: 0x0751, 0x19b1: 0x00b9, 0x19b2: 0x0089, 0x19b3: 0x0341, 0x19b4: 0x0349, 0x19b5: 0x0391, + 0x19b6: 0x00c1, 0x19b7: 0x0109, 0x19b8: 0x00c9, 0x19b9: 0x04b1, 0x19ba: 0x0019, 0x19bb: 0x02e9, + 0x19bc: 0x03d9, 0x19bd: 0x02f1, 0x19be: 0x02f9, 0x19bf: 0x03f1, // Block 0x67, offset 0x19c0 - 0x19c0: 0x0f41, 0x19c1: 0x0259, 0x19c2: 0x0f51, 0x19c3: 0x0359, 0x19c4: 0x0f61, 0x19c5: 0x0040, - 0x19c6: 0x00d9, 0x19c7: 0x0040, 0x19c8: 0x0040, 0x19c9: 0x0040, 0x19ca: 0x01d9, 0x19cb: 0x0fa9, - 0x19cc: 0x0fb9, 0x19cd: 0x1089, 0x19ce: 0x0279, 0x19cf: 0x0369, 0x19d0: 0x0289, 0x19d1: 0x0040, - 0x19d2: 0x0039, 0x19d3: 0x0ee9, 0x19d4: 0x1159, 0x19d5: 0x0ef9, 0x19d6: 0x0f09, 0x19d7: 0x1199, - 0x19d8: 0x0f31, 0x19d9: 0x0249, 0x19da: 0x0f41, 0x19db: 0x0259, 0x19dc: 0x0f51, 0x19dd: 0x0359, - 0x19de: 0x0f61, 0x19df: 0x0f71, 0x19e0: 0x00d9, 0x19e1: 0x0f99, 0x19e2: 0x2039, 0x19e3: 0x0269, - 0x19e4: 0x01d9, 0x19e5: 0x0fa9, 0x19e6: 0x0fb9, 0x19e7: 0x1089, 0x19e8: 0x0279, 0x19e9: 0x0369, - 0x19ea: 0x0289, 0x19eb: 0x13d1, 0x19ec: 0x0039, 0x19ed: 0x0ee9, 0x19ee: 0x1159, 0x19ef: 0x0ef9, - 0x19f0: 0x0f09, 0x19f1: 0x1199, 0x19f2: 0x0f31, 0x19f3: 0x0249, 0x19f4: 0x0f41, 0x19f5: 0x0259, - 0x19f6: 0x0f51, 0x19f7: 0x0359, 0x19f8: 0x0f61, 0x19f9: 0x0f71, 0x19fa: 0x00d9, 0x19fb: 0x0f99, - 0x19fc: 0x2039, 0x19fd: 0x0269, 0x19fe: 0x01d9, 0x19ff: 0x0fa9, + 0x19c0: 0x0309, 0x19c1: 0x00a9, 0x19c2: 0x0311, 0x19c3: 0x00b1, 0x19c4: 0x0319, 0x19c5: 0x0101, + 0x19c6: 0x0321, 0x19c7: 0x0329, 0x19c8: 0x0051, 0x19c9: 0x0339, 0x19ca: 0x0751, 0x19cb: 0x00b9, + 0x19cc: 0x0089, 0x19cd: 0x0341, 0x19ce: 0x0349, 0x19cf: 0x0391, 0x19d0: 0x00c1, 0x19d1: 0x0109, + 0x19d2: 0x00c9, 0x19d3: 0x04b1, 0x19d4: 0x0019, 0x19d5: 0x02e9, 0x19d6: 0x03d9, 0x19d7: 0x02f1, + 0x19d8: 0x02f9, 0x19d9: 0x03f1, 0x19da: 0x0309, 0x19db: 0x00a9, 0x19dc: 0x0311, 0x19dd: 0x00b1, + 0x19de: 0x0319, 0x19df: 0x0101, 0x19e0: 0x0321, 0x19e1: 0x0329, 0x19e2: 0x0051, 0x19e3: 0x0339, + 0x19e4: 0x0751, 0x19e5: 0x00b9, 0x19e6: 0x0089, 0x19e7: 0x0341, 0x19e8: 0x0349, 0x19e9: 0x0391, + 0x19ea: 0x00c1, 0x19eb: 0x0109, 0x19ec: 0x00c9, 0x19ed: 0x04b1, 0x19ee: 0x0019, 0x19ef: 0x02e9, + 0x19f0: 0x03d9, 0x19f1: 0x02f1, 0x19f2: 0x02f9, 0x19f3: 0x03f1, 0x19f4: 0x0309, 0x19f5: 0x00a9, + 0x19f6: 0x0311, 0x19f7: 0x00b1, 0x19f8: 0x0319, 0x19f9: 0x0101, 0x19fa: 0x0321, 0x19fb: 0x0329, + 0x19fc: 0x0051, 0x19fd: 0x0339, 0x19fe: 0x0751, 0x19ff: 0x00b9, // Block 0x68, offset 0x1a00 - 0x1a00: 0x0fb9, 0x1a01: 0x1089, 0x1a02: 0x0279, 0x1a03: 0x0369, 0x1a04: 0x0289, 0x1a05: 0x13d1, - 0x1a06: 0x0039, 0x1a07: 0x0ee9, 0x1a08: 0x1159, 0x1a09: 0x0ef9, 0x1a0a: 0x0f09, 0x1a0b: 0x1199, - 0x1a0c: 0x0f31, 0x1a0d: 0x0249, 0x1a0e: 0x0f41, 0x1a0f: 0x0259, 0x1a10: 0x0f51, 0x1a11: 0x0359, - 0x1a12: 0x0f61, 0x1a13: 0x0f71, 0x1a14: 0x00d9, 0x1a15: 0x0f99, 0x1a16: 0x2039, 0x1a17: 0x0269, - 0x1a18: 0x01d9, 0x1a19: 0x0fa9, 0x1a1a: 0x0fb9, 0x1a1b: 0x1089, 0x1a1c: 0x0279, 0x1a1d: 0x0369, - 0x1a1e: 0x0289, 0x1a1f: 0x13d1, 0x1a20: 0x0039, 0x1a21: 0x0ee9, 0x1a22: 0x1159, 0x1a23: 0x0ef9, - 0x1a24: 0x0f09, 0x1a25: 0x1199, 0x1a26: 0x0f31, 0x1a27: 0x0249, 0x1a28: 0x0f41, 0x1a29: 0x0259, - 0x1a2a: 0x0f51, 0x1a2b: 0x0359, 0x1a2c: 0x0f61, 0x1a2d: 0x0f71, 0x1a2e: 0x00d9, 0x1a2f: 0x0f99, - 0x1a30: 0x2039, 0x1a31: 0x0269, 0x1a32: 0x01d9, 0x1a33: 0x0fa9, 0x1a34: 0x0fb9, 0x1a35: 0x1089, - 0x1a36: 0x0279, 0x1a37: 0x0369, 0x1a38: 0x0289, 0x1a39: 0x13d1, 0x1a3a: 0x0039, 0x1a3b: 0x0ee9, - 0x1a3c: 0x1159, 0x1a3d: 0x0ef9, 0x1a3e: 0x0f09, 0x1a3f: 0x1199, + 0x1a00: 0x0089, 0x1a01: 0x0341, 0x1a02: 0x0349, 0x1a03: 0x0391, 0x1a04: 0x00c1, 0x1a05: 0x0109, + 0x1a06: 0x00c9, 0x1a07: 0x04b1, 0x1a08: 0x0019, 0x1a09: 0x02e9, 0x1a0a: 0x03d9, 0x1a0b: 0x02f1, + 0x1a0c: 0x02f9, 0x1a0d: 0x03f1, 0x1a0e: 0x0309, 0x1a0f: 0x00a9, 0x1a10: 0x0311, 0x1a11: 0x00b1, + 0x1a12: 0x0319, 0x1a13: 0x0101, 0x1a14: 0x0321, 0x1a15: 0x0329, 0x1a16: 0x0051, 0x1a17: 0x0339, + 0x1a18: 0x0751, 0x1a19: 0x00b9, 0x1a1a: 0x0089, 0x1a1b: 0x0341, 0x1a1c: 0x0349, 0x1a1d: 0x0391, + 0x1a1e: 0x00c1, 0x1a1f: 0x0109, 0x1a20: 0x00c9, 0x1a21: 0x04b1, 0x1a22: 0x0019, 0x1a23: 0x02e9, + 0x1a24: 0x03d9, 0x1a25: 0x02f1, 0x1a26: 0x02f9, 0x1a27: 0x03f1, 0x1a28: 0x0309, 0x1a29: 0x00a9, + 0x1a2a: 0x0311, 0x1a2b: 0x00b1, 0x1a2c: 0x0319, 0x1a2d: 0x0101, 0x1a2e: 0x0321, 0x1a2f: 0x0329, + 0x1a30: 0x0051, 0x1a31: 0x0339, 0x1a32: 0x0751, 0x1a33: 0x00b9, 0x1a34: 0x0089, 0x1a35: 0x0341, + 0x1a36: 0x0349, 0x1a37: 0x0391, 0x1a38: 0x00c1, 0x1a39: 0x0109, 0x1a3a: 0x00c9, 0x1a3b: 0x04b1, + 0x1a3c: 0x0019, 0x1a3d: 0x02e9, 0x1a3e: 0x03d9, 0x1a3f: 0x02f1, // Block 0x69, offset 0x1a40 - 0x1a40: 0x0f31, 0x1a41: 0x0249, 0x1a42: 0x0f41, 0x1a43: 0x0259, 0x1a44: 0x0f51, 0x1a45: 0x0359, - 0x1a46: 0x0f61, 0x1a47: 0x0f71, 0x1a48: 0x00d9, 0x1a49: 0x0f99, 0x1a4a: 0x2039, 0x1a4b: 0x0269, - 0x1a4c: 0x01d9, 0x1a4d: 0x0fa9, 0x1a4e: 0x0fb9, 0x1a4f: 0x1089, 0x1a50: 0x0279, 0x1a51: 0x0369, - 0x1a52: 0x0289, 0x1a53: 0x13d1, 0x1a54: 0x0039, 0x1a55: 0x0ee9, 0x1a56: 0x1159, 0x1a57: 0x0ef9, - 0x1a58: 0x0f09, 0x1a59: 0x1199, 0x1a5a: 0x0f31, 0x1a5b: 0x0249, 0x1a5c: 0x0f41, 0x1a5d: 0x0259, - 0x1a5e: 0x0f51, 0x1a5f: 0x0359, 0x1a60: 0x0f61, 0x1a61: 0x0f71, 0x1a62: 0x00d9, 0x1a63: 0x0f99, - 0x1a64: 0x2039, 0x1a65: 0x0269, 0x1a66: 0x01d9, 0x1a67: 0x0fa9, 0x1a68: 0x0fb9, 0x1a69: 0x1089, - 0x1a6a: 0x0279, 0x1a6b: 0x0369, 0x1a6c: 0x0289, 0x1a6d: 0x13d1, 0x1a6e: 0x0039, 0x1a6f: 0x0ee9, - 0x1a70: 0x1159, 0x1a71: 0x0ef9, 0x1a72: 0x0f09, 0x1a73: 0x1199, 0x1a74: 0x0f31, 0x1a75: 0x0249, - 0x1a76: 0x0f41, 0x1a77: 0x0259, 0x1a78: 0x0f51, 0x1a79: 0x0359, 0x1a7a: 0x0f61, 0x1a7b: 0x0f71, - 0x1a7c: 0x00d9, 0x1a7d: 0x0f99, 0x1a7e: 0x2039, 0x1a7f: 0x0269, + 0x1a40: 0x02f9, 0x1a41: 0x03f1, 0x1a42: 0x0309, 0x1a43: 0x00a9, 0x1a44: 0x0311, 0x1a45: 0x00b1, + 0x1a46: 0x0319, 0x1a47: 0x0101, 0x1a48: 0x0321, 0x1a49: 0x0329, 0x1a4a: 0x0051, 0x1a4b: 0x0339, + 0x1a4c: 0x0751, 0x1a4d: 0x00b9, 0x1a4e: 0x0089, 0x1a4f: 0x0341, 0x1a50: 0x0349, 0x1a51: 0x0391, + 0x1a52: 0x00c1, 0x1a53: 0x0109, 0x1a54: 0x00c9, 0x1a55: 0x04b1, 0x1a56: 0x0019, 0x1a57: 0x02e9, + 0x1a58: 0x03d9, 0x1a59: 0x02f1, 0x1a5a: 0x02f9, 0x1a5b: 0x03f1, 0x1a5c: 0x0309, 0x1a5d: 0x00a9, + 0x1a5e: 0x0311, 0x1a5f: 0x00b1, 0x1a60: 0x0319, 0x1a61: 0x0101, 0x1a62: 0x0321, 0x1a63: 0x0329, + 0x1a64: 0x0051, 0x1a65: 0x0339, 0x1a66: 0x0751, 0x1a67: 0x00b9, 0x1a68: 0x0089, 0x1a69: 0x0341, + 0x1a6a: 0x0349, 0x1a6b: 0x0391, 0x1a6c: 0x00c1, 0x1a6d: 0x0109, 0x1a6e: 0x00c9, 0x1a6f: 0x04b1, + 0x1a70: 0x0019, 0x1a71: 0x02e9, 0x1a72: 0x03d9, 0x1a73: 0x02f1, 0x1a74: 0x02f9, 0x1a75: 0x03f1, + 0x1a76: 0x0309, 0x1a77: 0x00a9, 0x1a78: 0x0311, 0x1a79: 0x00b1, 0x1a7a: 0x0319, 0x1a7b: 0x0101, + 0x1a7c: 0x0321, 0x1a7d: 0x0329, 0x1a7e: 0x0051, 0x1a7f: 0x0339, // Block 0x6a, offset 0x1a80 - 0x1a80: 0x01d9, 0x1a81: 0x0fa9, 0x1a82: 0x0fb9, 0x1a83: 0x1089, 0x1a84: 0x0279, 0x1a85: 0x0369, - 0x1a86: 0x0289, 0x1a87: 0x13d1, 0x1a88: 0x0039, 0x1a89: 0x0ee9, 0x1a8a: 0x1159, 0x1a8b: 0x0ef9, - 0x1a8c: 0x0f09, 0x1a8d: 0x1199, 0x1a8e: 0x0f31, 0x1a8f: 0x0249, 0x1a90: 0x0f41, 0x1a91: 0x0259, - 0x1a92: 0x0f51, 0x1a93: 0x0359, 0x1a94: 0x0f61, 0x1a95: 0x0f71, 0x1a96: 0x00d9, 0x1a97: 0x0f99, - 0x1a98: 0x2039, 0x1a99: 0x0269, 0x1a9a: 0x01d9, 0x1a9b: 0x0fa9, 0x1a9c: 0x0fb9, 0x1a9d: 0x1089, - 0x1a9e: 0x0279, 0x1a9f: 0x0369, 0x1aa0: 0x0289, 0x1aa1: 0x13d1, 0x1aa2: 0x0039, 0x1aa3: 0x0ee9, - 0x1aa4: 0x1159, 0x1aa5: 0x0ef9, 0x1aa6: 0x0f09, 0x1aa7: 0x1199, 0x1aa8: 0x0f31, 0x1aa9: 0x0249, - 0x1aaa: 0x0f41, 0x1aab: 0x0259, 0x1aac: 0x0f51, 0x1aad: 0x0359, 0x1aae: 0x0f61, 0x1aaf: 0x0f71, - 0x1ab0: 0x00d9, 0x1ab1: 0x0f99, 0x1ab2: 0x2039, 0x1ab3: 0x0269, 0x1ab4: 0x01d9, 0x1ab5: 0x0fa9, - 0x1ab6: 0x0fb9, 0x1ab7: 0x1089, 0x1ab8: 0x0279, 0x1ab9: 0x0369, 0x1aba: 0x0289, 0x1abb: 0x13d1, - 0x1abc: 0x0039, 0x1abd: 0x0ee9, 0x1abe: 0x1159, 0x1abf: 0x0ef9, + 0x1a80: 0x0751, 0x1a81: 0x00b9, 0x1a82: 0x0089, 0x1a83: 0x0341, 0x1a84: 0x0349, 0x1a85: 0x0391, + 0x1a86: 0x00c1, 0x1a87: 0x0109, 0x1a88: 0x00c9, 0x1a89: 0x04b1, 0x1a8a: 0x0019, 0x1a8b: 0x02e9, + 0x1a8c: 0x03d9, 0x1a8d: 0x02f1, 0x1a8e: 0x02f9, 0x1a8f: 0x03f1, 0x1a90: 0x0309, 0x1a91: 0x00a9, + 0x1a92: 0x0311, 0x1a93: 0x00b1, 0x1a94: 0x0319, 0x1a95: 0x0101, 0x1a96: 0x0321, 0x1a97: 0x0329, + 0x1a98: 0x0051, 0x1a99: 0x0339, 0x1a9a: 0x0751, 0x1a9b: 0x00b9, 0x1a9c: 0x0089, 0x1a9d: 0x0341, + 0x1a9e: 0x0349, 0x1a9f: 0x0391, 0x1aa0: 0x00c1, 0x1aa1: 0x0109, 0x1aa2: 0x00c9, 0x1aa3: 0x04b1, + 0x1aa4: 0x2279, 0x1aa5: 0x2281, 0x1aa6: 0x0040, 0x1aa7: 0x0040, 0x1aa8: 0x2289, 0x1aa9: 0x0399, + 0x1aaa: 0x03a1, 0x1aab: 0x03a9, 0x1aac: 0x2291, 0x1aad: 0x2299, 0x1aae: 0x22a1, 0x1aaf: 0x04d1, + 0x1ab0: 0x05f9, 0x1ab1: 0x22a9, 0x1ab2: 0x22b1, 0x1ab3: 0x22b9, 0x1ab4: 0x22c1, 0x1ab5: 0x22c9, + 0x1ab6: 0x22d1, 0x1ab7: 0x0799, 0x1ab8: 0x03c1, 0x1ab9: 0x04d1, 0x1aba: 0x22d9, 0x1abb: 0x22e1, + 0x1abc: 0x22e9, 0x1abd: 0x03b1, 0x1abe: 0x03b9, 0x1abf: 0x22f1, // Block 0x6b, offset 0x1ac0 - 0x1ac0: 0x0f09, 0x1ac1: 0x1199, 0x1ac2: 0x0f31, 0x1ac3: 0x0249, 0x1ac4: 0x0f41, 0x1ac5: 0x0259, - 0x1ac6: 0x0f51, 0x1ac7: 0x0359, 0x1ac8: 0x0f61, 0x1ac9: 0x0f71, 0x1aca: 0x00d9, 0x1acb: 0x0f99, - 0x1acc: 0x2039, 0x1acd: 0x0269, 0x1ace: 0x01d9, 0x1acf: 0x0fa9, 0x1ad0: 0x0fb9, 0x1ad1: 0x1089, - 0x1ad2: 0x0279, 0x1ad3: 0x0369, 0x1ad4: 0x0289, 0x1ad5: 0x13d1, 0x1ad6: 0x0039, 0x1ad7: 0x0ee9, - 0x1ad8: 0x1159, 0x1ad9: 0x0ef9, 0x1ada: 0x0f09, 0x1adb: 0x1199, 0x1adc: 0x0f31, 0x1add: 0x0249, - 0x1ade: 0x0f41, 0x1adf: 0x0259, 0x1ae0: 0x0f51, 0x1ae1: 0x0359, 0x1ae2: 0x0f61, 0x1ae3: 0x0f71, - 0x1ae4: 0x00d9, 0x1ae5: 0x0f99, 0x1ae6: 0x2039, 0x1ae7: 0x0269, 0x1ae8: 0x01d9, 0x1ae9: 0x0fa9, - 0x1aea: 0x0fb9, 0x1aeb: 0x1089, 0x1aec: 0x0279, 0x1aed: 0x0369, 0x1aee: 0x0289, 0x1aef: 0x13d1, - 0x1af0: 0x0039, 0x1af1: 0x0ee9, 0x1af2: 0x1159, 0x1af3: 0x0ef9, 0x1af4: 0x0f09, 0x1af5: 0x1199, - 0x1af6: 0x0f31, 0x1af7: 0x0249, 0x1af8: 0x0f41, 0x1af9: 0x0259, 0x1afa: 0x0f51, 0x1afb: 0x0359, - 0x1afc: 0x0f61, 0x1afd: 0x0f71, 0x1afe: 0x00d9, 0x1aff: 0x0f99, + 0x1ac0: 0x0769, 0x1ac1: 0x22f9, 0x1ac2: 0x2289, 0x1ac3: 0x0399, 0x1ac4: 0x03a1, 0x1ac5: 0x03a9, + 0x1ac6: 0x2291, 0x1ac7: 0x2299, 0x1ac8: 0x22a1, 0x1ac9: 0x04d1, 0x1aca: 0x05f9, 0x1acb: 0x22a9, + 0x1acc: 0x22b1, 0x1acd: 0x22b9, 0x1ace: 0x22c1, 0x1acf: 0x22c9, 0x1ad0: 0x22d1, 0x1ad1: 0x0799, + 0x1ad2: 0x03c1, 0x1ad3: 0x22d9, 0x1ad4: 0x22d9, 0x1ad5: 0x22e1, 0x1ad6: 0x22e9, 0x1ad7: 0x03b1, + 0x1ad8: 0x03b9, 0x1ad9: 0x22f1, 0x1ada: 0x0769, 0x1adb: 0x2301, 0x1adc: 0x2291, 0x1add: 0x04d1, + 0x1ade: 0x22a9, 0x1adf: 0x03b1, 0x1ae0: 0x03c1, 0x1ae1: 0x0799, 0x1ae2: 0x2289, 0x1ae3: 0x0399, + 0x1ae4: 0x03a1, 0x1ae5: 0x03a9, 0x1ae6: 0x2291, 0x1ae7: 0x2299, 0x1ae8: 0x22a1, 0x1ae9: 0x04d1, + 0x1aea: 0x05f9, 0x1aeb: 0x22a9, 0x1aec: 0x22b1, 0x1aed: 0x22b9, 0x1aee: 0x22c1, 0x1aef: 0x22c9, + 0x1af0: 0x22d1, 0x1af1: 0x0799, 0x1af2: 0x03c1, 0x1af3: 0x04d1, 0x1af4: 0x22d9, 0x1af5: 0x22e1, + 0x1af6: 0x22e9, 0x1af7: 0x03b1, 0x1af8: 0x03b9, 0x1af9: 0x22f1, 0x1afa: 0x0769, 0x1afb: 0x22f9, + 0x1afc: 0x2289, 0x1afd: 0x0399, 0x1afe: 0x03a1, 0x1aff: 0x03a9, // Block 0x6c, offset 0x1b00 - 0x1b00: 0x2039, 0x1b01: 0x0269, 0x1b02: 0x01d9, 0x1b03: 0x0fa9, 0x1b04: 0x0fb9, 0x1b05: 0x1089, - 0x1b06: 0x0279, 0x1b07: 0x0369, 0x1b08: 0x0289, 0x1b09: 0x13d1, 0x1b0a: 0x0039, 0x1b0b: 0x0ee9, - 0x1b0c: 0x1159, 0x1b0d: 0x0ef9, 0x1b0e: 0x0f09, 0x1b0f: 0x1199, 0x1b10: 0x0f31, 0x1b11: 0x0249, - 0x1b12: 0x0f41, 0x1b13: 0x0259, 0x1b14: 0x0f51, 0x1b15: 0x0359, 0x1b16: 0x0f61, 0x1b17: 0x0f71, - 0x1b18: 0x00d9, 0x1b19: 0x0f99, 0x1b1a: 0x2039, 0x1b1b: 0x0269, 0x1b1c: 0x01d9, 0x1b1d: 0x0fa9, - 0x1b1e: 0x0fb9, 0x1b1f: 0x1089, 0x1b20: 0x0279, 0x1b21: 0x0369, 0x1b22: 0x0289, 0x1b23: 0x13d1, - 0x1b24: 0xbad1, 0x1b25: 0xbae9, 0x1b26: 0x0040, 0x1b27: 0x0040, 0x1b28: 0xbb01, 0x1b29: 0x1099, - 0x1b2a: 0x10b1, 0x1b2b: 0x10c9, 0x1b2c: 0xbb19, 0x1b2d: 0xbb31, 0x1b2e: 0xbb49, 0x1b2f: 0x1429, - 0x1b30: 0x1a31, 0x1b31: 0xbb61, 0x1b32: 0xbb79, 0x1b33: 0xbb91, 0x1b34: 0xbba9, 0x1b35: 0xbbc1, - 0x1b36: 0xbbd9, 0x1b37: 0x2109, 0x1b38: 0x1111, 0x1b39: 0x1429, 0x1b3a: 0xbbf1, 0x1b3b: 0xbc09, - 0x1b3c: 0xbc21, 0x1b3d: 0x10e1, 0x1b3e: 0x10f9, 0x1b3f: 0xbc39, + 0x1b00: 0x2291, 0x1b01: 0x2299, 0x1b02: 0x22a1, 0x1b03: 0x04d1, 0x1b04: 0x05f9, 0x1b05: 0x22a9, + 0x1b06: 0x22b1, 0x1b07: 0x22b9, 0x1b08: 0x22c1, 0x1b09: 0x22c9, 0x1b0a: 0x22d1, 0x1b0b: 0x0799, + 0x1b0c: 0x03c1, 0x1b0d: 0x22d9, 0x1b0e: 0x22d9, 0x1b0f: 0x22e1, 0x1b10: 0x22e9, 0x1b11: 0x03b1, + 0x1b12: 0x03b9, 0x1b13: 0x22f1, 0x1b14: 0x0769, 0x1b15: 0x2301, 0x1b16: 0x2291, 0x1b17: 0x04d1, + 0x1b18: 0x22a9, 0x1b19: 0x03b1, 0x1b1a: 0x03c1, 0x1b1b: 0x0799, 0x1b1c: 0x2289, 0x1b1d: 0x0399, + 0x1b1e: 0x03a1, 0x1b1f: 0x03a9, 0x1b20: 0x2291, 0x1b21: 0x2299, 0x1b22: 0x22a1, 0x1b23: 0x04d1, + 0x1b24: 0x05f9, 0x1b25: 0x22a9, 0x1b26: 0x22b1, 0x1b27: 0x22b9, 0x1b28: 0x22c1, 0x1b29: 0x22c9, + 0x1b2a: 0x22d1, 0x1b2b: 0x0799, 0x1b2c: 0x03c1, 0x1b2d: 0x04d1, 0x1b2e: 0x22d9, 0x1b2f: 0x22e1, + 0x1b30: 0x22e9, 0x1b31: 0x03b1, 0x1b32: 0x03b9, 0x1b33: 0x22f1, 0x1b34: 0x0769, 0x1b35: 0x22f9, + 0x1b36: 0x2289, 0x1b37: 0x0399, 0x1b38: 0x03a1, 0x1b39: 0x03a9, 0x1b3a: 0x2291, 0x1b3b: 0x2299, + 0x1b3c: 0x22a1, 0x1b3d: 0x04d1, 0x1b3e: 0x05f9, 0x1b3f: 0x22a9, // Block 0x6d, offset 0x1b40 - 0x1b40: 0x2079, 0x1b41: 0xbc51, 0x1b42: 0xbb01, 0x1b43: 0x1099, 0x1b44: 0x10b1, 0x1b45: 0x10c9, - 0x1b46: 0xbb19, 0x1b47: 0xbb31, 0x1b48: 0xbb49, 0x1b49: 0x1429, 0x1b4a: 0x1a31, 0x1b4b: 0xbb61, - 0x1b4c: 0xbb79, 0x1b4d: 0xbb91, 0x1b4e: 0xbba9, 0x1b4f: 0xbbc1, 0x1b50: 0xbbd9, 0x1b51: 0x2109, - 0x1b52: 0x1111, 0x1b53: 0xbbf1, 0x1b54: 0xbbf1, 0x1b55: 0xbc09, 0x1b56: 0xbc21, 0x1b57: 0x10e1, - 0x1b58: 0x10f9, 0x1b59: 0xbc39, 0x1b5a: 0x2079, 0x1b5b: 0xbc71, 0x1b5c: 0xbb19, 0x1b5d: 0x1429, - 0x1b5e: 0xbb61, 0x1b5f: 0x10e1, 0x1b60: 0x1111, 0x1b61: 0x2109, 0x1b62: 0xbb01, 0x1b63: 0x1099, - 0x1b64: 0x10b1, 0x1b65: 0x10c9, 0x1b66: 0xbb19, 0x1b67: 0xbb31, 0x1b68: 0xbb49, 0x1b69: 0x1429, - 0x1b6a: 0x1a31, 0x1b6b: 0xbb61, 0x1b6c: 0xbb79, 0x1b6d: 0xbb91, 0x1b6e: 0xbba9, 0x1b6f: 0xbbc1, - 0x1b70: 0xbbd9, 0x1b71: 0x2109, 0x1b72: 0x1111, 0x1b73: 0x1429, 0x1b74: 0xbbf1, 0x1b75: 0xbc09, - 0x1b76: 0xbc21, 0x1b77: 0x10e1, 0x1b78: 0x10f9, 0x1b79: 0xbc39, 0x1b7a: 0x2079, 0x1b7b: 0xbc51, - 0x1b7c: 0xbb01, 0x1b7d: 0x1099, 0x1b7e: 0x10b1, 0x1b7f: 0x10c9, + 0x1b40: 0x22b1, 0x1b41: 0x22b9, 0x1b42: 0x22c1, 0x1b43: 0x22c9, 0x1b44: 0x22d1, 0x1b45: 0x0799, + 0x1b46: 0x03c1, 0x1b47: 0x22d9, 0x1b48: 0x22d9, 0x1b49: 0x22e1, 0x1b4a: 0x22e9, 0x1b4b: 0x03b1, + 0x1b4c: 0x03b9, 0x1b4d: 0x22f1, 0x1b4e: 0x0769, 0x1b4f: 0x2301, 0x1b50: 0x2291, 0x1b51: 0x04d1, + 0x1b52: 0x22a9, 0x1b53: 0x03b1, 0x1b54: 0x03c1, 0x1b55: 0x0799, 0x1b56: 0x2289, 0x1b57: 0x0399, + 0x1b58: 0x03a1, 0x1b59: 0x03a9, 0x1b5a: 0x2291, 0x1b5b: 0x2299, 0x1b5c: 0x22a1, 0x1b5d: 0x04d1, + 0x1b5e: 0x05f9, 0x1b5f: 0x22a9, 0x1b60: 0x22b1, 0x1b61: 0x22b9, 0x1b62: 0x22c1, 0x1b63: 0x22c9, + 0x1b64: 0x22d1, 0x1b65: 0x0799, 0x1b66: 0x03c1, 0x1b67: 0x04d1, 0x1b68: 0x22d9, 0x1b69: 0x22e1, + 0x1b6a: 0x22e9, 0x1b6b: 0x03b1, 0x1b6c: 0x03b9, 0x1b6d: 0x22f1, 0x1b6e: 0x0769, 0x1b6f: 0x22f9, + 0x1b70: 0x2289, 0x1b71: 0x0399, 0x1b72: 0x03a1, 0x1b73: 0x03a9, 0x1b74: 0x2291, 0x1b75: 0x2299, + 0x1b76: 0x22a1, 0x1b77: 0x04d1, 0x1b78: 0x05f9, 0x1b79: 0x22a9, 0x1b7a: 0x22b1, 0x1b7b: 0x22b9, + 0x1b7c: 0x22c1, 0x1b7d: 0x22c9, 0x1b7e: 0x22d1, 0x1b7f: 0x0799, // Block 0x6e, offset 0x1b80 - 0x1b80: 0xbb19, 0x1b81: 0xbb31, 0x1b82: 0xbb49, 0x1b83: 0x1429, 0x1b84: 0x1a31, 0x1b85: 0xbb61, - 0x1b86: 0xbb79, 0x1b87: 0xbb91, 0x1b88: 0xbba9, 0x1b89: 0xbbc1, 0x1b8a: 0xbbd9, 0x1b8b: 0x2109, - 0x1b8c: 0x1111, 0x1b8d: 0xbbf1, 0x1b8e: 0xbbf1, 0x1b8f: 0xbc09, 0x1b90: 0xbc21, 0x1b91: 0x10e1, - 0x1b92: 0x10f9, 0x1b93: 0xbc39, 0x1b94: 0x2079, 0x1b95: 0xbc71, 0x1b96: 0xbb19, 0x1b97: 0x1429, - 0x1b98: 0xbb61, 0x1b99: 0x10e1, 0x1b9a: 0x1111, 0x1b9b: 0x2109, 0x1b9c: 0xbb01, 0x1b9d: 0x1099, - 0x1b9e: 0x10b1, 0x1b9f: 0x10c9, 0x1ba0: 0xbb19, 0x1ba1: 0xbb31, 0x1ba2: 0xbb49, 0x1ba3: 0x1429, - 0x1ba4: 0x1a31, 0x1ba5: 0xbb61, 0x1ba6: 0xbb79, 0x1ba7: 0xbb91, 0x1ba8: 0xbba9, 0x1ba9: 0xbbc1, - 0x1baa: 0xbbd9, 0x1bab: 0x2109, 0x1bac: 0x1111, 0x1bad: 0x1429, 0x1bae: 0xbbf1, 0x1baf: 0xbc09, - 0x1bb0: 0xbc21, 0x1bb1: 0x10e1, 0x1bb2: 0x10f9, 0x1bb3: 0xbc39, 0x1bb4: 0x2079, 0x1bb5: 0xbc51, - 0x1bb6: 0xbb01, 0x1bb7: 0x1099, 0x1bb8: 0x10b1, 0x1bb9: 0x10c9, 0x1bba: 0xbb19, 0x1bbb: 0xbb31, - 0x1bbc: 0xbb49, 0x1bbd: 0x1429, 0x1bbe: 0x1a31, 0x1bbf: 0xbb61, + 0x1b80: 0x03c1, 0x1b81: 0x22d9, 0x1b82: 0x22d9, 0x1b83: 0x22e1, 0x1b84: 0x22e9, 0x1b85: 0x03b1, + 0x1b86: 0x03b9, 0x1b87: 0x22f1, 0x1b88: 0x0769, 0x1b89: 0x2301, 0x1b8a: 0x2291, 0x1b8b: 0x04d1, + 0x1b8c: 0x22a9, 0x1b8d: 0x03b1, 0x1b8e: 0x03c1, 0x1b8f: 0x0799, 0x1b90: 0x2289, 0x1b91: 0x0399, + 0x1b92: 0x03a1, 0x1b93: 0x03a9, 0x1b94: 0x2291, 0x1b95: 0x2299, 0x1b96: 0x22a1, 0x1b97: 0x04d1, + 0x1b98: 0x05f9, 0x1b99: 0x22a9, 0x1b9a: 0x22b1, 0x1b9b: 0x22b9, 0x1b9c: 0x22c1, 0x1b9d: 0x22c9, + 0x1b9e: 0x22d1, 0x1b9f: 0x0799, 0x1ba0: 0x03c1, 0x1ba1: 0x04d1, 0x1ba2: 0x22d9, 0x1ba3: 0x22e1, + 0x1ba4: 0x22e9, 0x1ba5: 0x03b1, 0x1ba6: 0x03b9, 0x1ba7: 0x22f1, 0x1ba8: 0x0769, 0x1ba9: 0x22f9, + 0x1baa: 0x2289, 0x1bab: 0x0399, 0x1bac: 0x03a1, 0x1bad: 0x03a9, 0x1bae: 0x2291, 0x1baf: 0x2299, + 0x1bb0: 0x22a1, 0x1bb1: 0x04d1, 0x1bb2: 0x05f9, 0x1bb3: 0x22a9, 0x1bb4: 0x22b1, 0x1bb5: 0x22b9, + 0x1bb6: 0x22c1, 0x1bb7: 0x22c9, 0x1bb8: 0x22d1, 0x1bb9: 0x0799, 0x1bba: 0x03c1, 0x1bbb: 0x22d9, + 0x1bbc: 0x22d9, 0x1bbd: 0x22e1, 0x1bbe: 0x22e9, 0x1bbf: 0x03b1, // Block 0x6f, offset 0x1bc0 - 0x1bc0: 0xbb79, 0x1bc1: 0xbb91, 0x1bc2: 0xbba9, 0x1bc3: 0xbbc1, 0x1bc4: 0xbbd9, 0x1bc5: 0x2109, - 0x1bc6: 0x1111, 0x1bc7: 0xbbf1, 0x1bc8: 0xbbf1, 0x1bc9: 0xbc09, 0x1bca: 0xbc21, 0x1bcb: 0x10e1, - 0x1bcc: 0x10f9, 0x1bcd: 0xbc39, 0x1bce: 0x2079, 0x1bcf: 0xbc71, 0x1bd0: 0xbb19, 0x1bd1: 0x1429, - 0x1bd2: 0xbb61, 0x1bd3: 0x10e1, 0x1bd4: 0x1111, 0x1bd5: 0x2109, 0x1bd6: 0xbb01, 0x1bd7: 0x1099, - 0x1bd8: 0x10b1, 0x1bd9: 0x10c9, 0x1bda: 0xbb19, 0x1bdb: 0xbb31, 0x1bdc: 0xbb49, 0x1bdd: 0x1429, - 0x1bde: 0x1a31, 0x1bdf: 0xbb61, 0x1be0: 0xbb79, 0x1be1: 0xbb91, 0x1be2: 0xbba9, 0x1be3: 0xbbc1, - 0x1be4: 0xbbd9, 0x1be5: 0x2109, 0x1be6: 0x1111, 0x1be7: 0x1429, 0x1be8: 0xbbf1, 0x1be9: 0xbc09, - 0x1bea: 0xbc21, 0x1beb: 0x10e1, 0x1bec: 0x10f9, 0x1bed: 0xbc39, 0x1bee: 0x2079, 0x1bef: 0xbc51, - 0x1bf0: 0xbb01, 0x1bf1: 0x1099, 0x1bf2: 0x10b1, 0x1bf3: 0x10c9, 0x1bf4: 0xbb19, 0x1bf5: 0xbb31, - 0x1bf6: 0xbb49, 0x1bf7: 0x1429, 0x1bf8: 0x1a31, 0x1bf9: 0xbb61, 0x1bfa: 0xbb79, 0x1bfb: 0xbb91, - 0x1bfc: 0xbba9, 0x1bfd: 0xbbc1, 0x1bfe: 0xbbd9, 0x1bff: 0x2109, + 0x1bc0: 0x03b9, 0x1bc1: 0x22f1, 0x1bc2: 0x0769, 0x1bc3: 0x2301, 0x1bc4: 0x2291, 0x1bc5: 0x04d1, + 0x1bc6: 0x22a9, 0x1bc7: 0x03b1, 0x1bc8: 0x03c1, 0x1bc9: 0x0799, 0x1bca: 0x2309, 0x1bcb: 0x2309, + 0x1bcc: 0x0040, 0x1bcd: 0x0040, 0x1bce: 0x06e1, 0x1bcf: 0x0049, 0x1bd0: 0x0029, 0x1bd1: 0x0031, + 0x1bd2: 0x06e9, 0x1bd3: 0x06f1, 0x1bd4: 0x06f9, 0x1bd5: 0x0701, 0x1bd6: 0x0709, 0x1bd7: 0x0711, + 0x1bd8: 0x06e1, 0x1bd9: 0x0049, 0x1bda: 0x0029, 0x1bdb: 0x0031, 0x1bdc: 0x06e9, 0x1bdd: 0x06f1, + 0x1bde: 0x06f9, 0x1bdf: 0x0701, 0x1be0: 0x0709, 0x1be1: 0x0711, 0x1be2: 0x06e1, 0x1be3: 0x0049, + 0x1be4: 0x0029, 0x1be5: 0x0031, 0x1be6: 0x06e9, 0x1be7: 0x06f1, 0x1be8: 0x06f9, 0x1be9: 0x0701, + 0x1bea: 0x0709, 0x1beb: 0x0711, 0x1bec: 0x06e1, 0x1bed: 0x0049, 0x1bee: 0x0029, 0x1bef: 0x0031, + 0x1bf0: 0x06e9, 0x1bf1: 0x06f1, 0x1bf2: 0x06f9, 0x1bf3: 0x0701, 0x1bf4: 0x0709, 0x1bf5: 0x0711, + 0x1bf6: 0x06e1, 0x1bf7: 0x0049, 0x1bf8: 0x0029, 0x1bf9: 0x0031, 0x1bfa: 0x06e9, 0x1bfb: 0x06f1, + 0x1bfc: 0x06f9, 0x1bfd: 0x0701, 0x1bfe: 0x0709, 0x1bff: 0x0711, // Block 0x70, offset 0x1c00 - 0x1c00: 0x1111, 0x1c01: 0xbbf1, 0x1c02: 0xbbf1, 0x1c03: 0xbc09, 0x1c04: 0xbc21, 0x1c05: 0x10e1, - 0x1c06: 0x10f9, 0x1c07: 0xbc39, 0x1c08: 0x2079, 0x1c09: 0xbc71, 0x1c0a: 0xbb19, 0x1c0b: 0x1429, - 0x1c0c: 0xbb61, 0x1c0d: 0x10e1, 0x1c0e: 0x1111, 0x1c0f: 0x2109, 0x1c10: 0xbb01, 0x1c11: 0x1099, - 0x1c12: 0x10b1, 0x1c13: 0x10c9, 0x1c14: 0xbb19, 0x1c15: 0xbb31, 0x1c16: 0xbb49, 0x1c17: 0x1429, - 0x1c18: 0x1a31, 0x1c19: 0xbb61, 0x1c1a: 0xbb79, 0x1c1b: 0xbb91, 0x1c1c: 0xbba9, 0x1c1d: 0xbbc1, - 0x1c1e: 0xbbd9, 0x1c1f: 0x2109, 0x1c20: 0x1111, 0x1c21: 0x1429, 0x1c22: 0xbbf1, 0x1c23: 0xbc09, - 0x1c24: 0xbc21, 0x1c25: 0x10e1, 0x1c26: 0x10f9, 0x1c27: 0xbc39, 0x1c28: 0x2079, 0x1c29: 0xbc51, - 0x1c2a: 0xbb01, 0x1c2b: 0x1099, 0x1c2c: 0x10b1, 0x1c2d: 0x10c9, 0x1c2e: 0xbb19, 0x1c2f: 0xbb31, - 0x1c30: 0xbb49, 0x1c31: 0x1429, 0x1c32: 0x1a31, 0x1c33: 0xbb61, 0x1c34: 0xbb79, 0x1c35: 0xbb91, - 0x1c36: 0xbba9, 0x1c37: 0xbbc1, 0x1c38: 0xbbd9, 0x1c39: 0x2109, 0x1c3a: 0x1111, 0x1c3b: 0xbbf1, - 0x1c3c: 0xbbf1, 0x1c3d: 0xbc09, 0x1c3e: 0xbc21, 0x1c3f: 0x10e1, + 0x1c00: 0xe115, 0x1c01: 0xe115, 0x1c02: 0xe135, 0x1c03: 0xe135, 0x1c04: 0xe115, 0x1c05: 0xe115, + 0x1c06: 0xe175, 0x1c07: 0xe175, 0x1c08: 0xe115, 0x1c09: 0xe115, 0x1c0a: 0xe135, 0x1c0b: 0xe135, + 0x1c0c: 0xe115, 0x1c0d: 0xe115, 0x1c0e: 0xe1f5, 0x1c0f: 0xe1f5, 0x1c10: 0xe115, 0x1c11: 0xe115, + 0x1c12: 0xe135, 0x1c13: 0xe135, 0x1c14: 0xe115, 0x1c15: 0xe115, 0x1c16: 0xe175, 0x1c17: 0xe175, + 0x1c18: 0xe115, 0x1c19: 0xe115, 0x1c1a: 0xe135, 0x1c1b: 0xe135, 0x1c1c: 0xe115, 0x1c1d: 0xe115, + 0x1c1e: 0x8b3d, 0x1c1f: 0x8b3d, 0x1c20: 0x04b5, 0x1c21: 0x04b5, 0x1c22: 0x0a08, 0x1c23: 0x0a08, + 0x1c24: 0x0a08, 0x1c25: 0x0a08, 0x1c26: 0x0a08, 0x1c27: 0x0a08, 0x1c28: 0x0a08, 0x1c29: 0x0a08, + 0x1c2a: 0x0a08, 0x1c2b: 0x0a08, 0x1c2c: 0x0a08, 0x1c2d: 0x0a08, 0x1c2e: 0x0a08, 0x1c2f: 0x0a08, + 0x1c30: 0x0a08, 0x1c31: 0x0a08, 0x1c32: 0x0a08, 0x1c33: 0x0a08, 0x1c34: 0x0a08, 0x1c35: 0x0a08, + 0x1c36: 0x0a08, 0x1c37: 0x0a08, 0x1c38: 0x0a08, 0x1c39: 0x0a08, 0x1c3a: 0x0a08, 0x1c3b: 0x0a08, + 0x1c3c: 0x0a08, 0x1c3d: 0x0a08, 0x1c3e: 0x0a08, 0x1c3f: 0x0a08, // Block 0x71, offset 0x1c40 - 0x1c40: 0x10f9, 0x1c41: 0xbc39, 0x1c42: 0x2079, 0x1c43: 0xbc71, 0x1c44: 0xbb19, 0x1c45: 0x1429, - 0x1c46: 0xbb61, 0x1c47: 0x10e1, 0x1c48: 0x1111, 0x1c49: 0x2109, 0x1c4a: 0xbc91, 0x1c4b: 0xbc91, - 0x1c4c: 0x0040, 0x1c4d: 0x0040, 0x1c4e: 0x1f41, 0x1c4f: 0x00c9, 0x1c50: 0x0069, 0x1c51: 0x0079, - 0x1c52: 0x1f51, 0x1c53: 0x1f61, 0x1c54: 0x1f71, 0x1c55: 0x1f81, 0x1c56: 0x1f91, 0x1c57: 0x1fa1, - 0x1c58: 0x1f41, 0x1c59: 0x00c9, 0x1c5a: 0x0069, 0x1c5b: 0x0079, 0x1c5c: 0x1f51, 0x1c5d: 0x1f61, - 0x1c5e: 0x1f71, 0x1c5f: 0x1f81, 0x1c60: 0x1f91, 0x1c61: 0x1fa1, 0x1c62: 0x1f41, 0x1c63: 0x00c9, - 0x1c64: 0x0069, 0x1c65: 0x0079, 0x1c66: 0x1f51, 0x1c67: 0x1f61, 0x1c68: 0x1f71, 0x1c69: 0x1f81, - 0x1c6a: 0x1f91, 0x1c6b: 0x1fa1, 0x1c6c: 0x1f41, 0x1c6d: 0x00c9, 0x1c6e: 0x0069, 0x1c6f: 0x0079, - 0x1c70: 0x1f51, 0x1c71: 0x1f61, 0x1c72: 0x1f71, 0x1c73: 0x1f81, 0x1c74: 0x1f91, 0x1c75: 0x1fa1, - 0x1c76: 0x1f41, 0x1c77: 0x00c9, 0x1c78: 0x0069, 0x1c79: 0x0079, 0x1c7a: 0x1f51, 0x1c7b: 0x1f61, - 0x1c7c: 0x1f71, 0x1c7d: 0x1f81, 0x1c7e: 0x1f91, 0x1c7f: 0x1fa1, + 0x1c40: 0x20b1, 0x1c41: 0x20b9, 0x1c42: 0x20d9, 0x1c43: 0x20f1, 0x1c44: 0x0040, 0x1c45: 0x2189, + 0x1c46: 0x2109, 0x1c47: 0x20e1, 0x1c48: 0x2131, 0x1c49: 0x2191, 0x1c4a: 0x2161, 0x1c4b: 0x2169, + 0x1c4c: 0x2171, 0x1c4d: 0x2179, 0x1c4e: 0x2111, 0x1c4f: 0x2141, 0x1c50: 0x2151, 0x1c51: 0x2121, + 0x1c52: 0x2159, 0x1c53: 0x2101, 0x1c54: 0x2119, 0x1c55: 0x20c9, 0x1c56: 0x20d1, 0x1c57: 0x20e9, + 0x1c58: 0x20f9, 0x1c59: 0x2129, 0x1c5a: 0x2139, 0x1c5b: 0x2149, 0x1c5c: 0x2311, 0x1c5d: 0x1689, + 0x1c5e: 0x2319, 0x1c5f: 0x2321, 0x1c60: 0x0040, 0x1c61: 0x20b9, 0x1c62: 0x20d9, 0x1c63: 0x0040, + 0x1c64: 0x2181, 0x1c65: 0x0040, 0x1c66: 0x0040, 0x1c67: 0x20e1, 0x1c68: 0x0040, 0x1c69: 0x2191, + 0x1c6a: 0x2161, 0x1c6b: 0x2169, 0x1c6c: 0x2171, 0x1c6d: 0x2179, 0x1c6e: 0x2111, 0x1c6f: 0x2141, + 0x1c70: 0x2151, 0x1c71: 0x2121, 0x1c72: 0x2159, 0x1c73: 0x0040, 0x1c74: 0x2119, 0x1c75: 0x20c9, + 0x1c76: 0x20d1, 0x1c77: 0x20e9, 0x1c78: 0x0040, 0x1c79: 0x2129, 0x1c7a: 0x0040, 0x1c7b: 0x2149, + 0x1c7c: 0x0040, 0x1c7d: 0x0040, 0x1c7e: 0x0040, 0x1c7f: 0x0040, // Block 0x72, offset 0x1c80 - 0x1c80: 0xe115, 0x1c81: 0xe115, 0x1c82: 0xe135, 0x1c83: 0xe135, 0x1c84: 0xe115, 0x1c85: 0xe115, - 0x1c86: 0xe175, 0x1c87: 0xe175, 0x1c88: 0xe115, 0x1c89: 0xe115, 0x1c8a: 0xe135, 0x1c8b: 0xe135, - 0x1c8c: 0xe115, 0x1c8d: 0xe115, 0x1c8e: 0xe1f5, 0x1c8f: 0xe1f5, 0x1c90: 0xe115, 0x1c91: 0xe115, - 0x1c92: 0xe135, 0x1c93: 0xe135, 0x1c94: 0xe115, 0x1c95: 0xe115, 0x1c96: 0xe175, 0x1c97: 0xe175, - 0x1c98: 0xe115, 0x1c99: 0xe115, 0x1c9a: 0xe135, 0x1c9b: 0xe135, 0x1c9c: 0xe115, 0x1c9d: 0xe115, - 0x1c9e: 0x8b3d, 0x1c9f: 0x8b3d, 0x1ca0: 0x04b5, 0x1ca1: 0x04b5, 0x1ca2: 0x0a08, 0x1ca3: 0x0a08, - 0x1ca4: 0x0a08, 0x1ca5: 0x0a08, 0x1ca6: 0x0a08, 0x1ca7: 0x0a08, 0x1ca8: 0x0a08, 0x1ca9: 0x0a08, - 0x1caa: 0x0a08, 0x1cab: 0x0a08, 0x1cac: 0x0a08, 0x1cad: 0x0a08, 0x1cae: 0x0a08, 0x1caf: 0x0a08, - 0x1cb0: 0x0a08, 0x1cb1: 0x0a08, 0x1cb2: 0x0a08, 0x1cb3: 0x0a08, 0x1cb4: 0x0a08, 0x1cb5: 0x0a08, - 0x1cb6: 0x0a08, 0x1cb7: 0x0a08, 0x1cb8: 0x0a08, 0x1cb9: 0x0a08, 0x1cba: 0x0a08, 0x1cbb: 0x0a08, - 0x1cbc: 0x0a08, 0x1cbd: 0x0a08, 0x1cbe: 0x0a08, 0x1cbf: 0x0a08, + 0x1c80: 0x0040, 0x1c81: 0x0040, 0x1c82: 0x20d9, 0x1c83: 0x0040, 0x1c84: 0x0040, 0x1c85: 0x0040, + 0x1c86: 0x0040, 0x1c87: 0x20e1, 0x1c88: 0x0040, 0x1c89: 0x2191, 0x1c8a: 0x0040, 0x1c8b: 0x2169, + 0x1c8c: 0x0040, 0x1c8d: 0x2179, 0x1c8e: 0x2111, 0x1c8f: 0x2141, 0x1c90: 0x0040, 0x1c91: 0x2121, + 0x1c92: 0x2159, 0x1c93: 0x0040, 0x1c94: 0x2119, 0x1c95: 0x0040, 0x1c96: 0x0040, 0x1c97: 0x20e9, + 0x1c98: 0x0040, 0x1c99: 0x2129, 0x1c9a: 0x0040, 0x1c9b: 0x2149, 0x1c9c: 0x0040, 0x1c9d: 0x1689, + 0x1c9e: 0x0040, 0x1c9f: 0x2321, 0x1ca0: 0x0040, 0x1ca1: 0x20b9, 0x1ca2: 0x20d9, 0x1ca3: 0x0040, + 0x1ca4: 0x2181, 0x1ca5: 0x0040, 0x1ca6: 0x0040, 0x1ca7: 0x20e1, 0x1ca8: 0x2131, 0x1ca9: 0x2191, + 0x1caa: 0x2161, 0x1cab: 0x0040, 0x1cac: 0x2171, 0x1cad: 0x2179, 0x1cae: 0x2111, 0x1caf: 0x2141, + 0x1cb0: 0x2151, 0x1cb1: 0x2121, 0x1cb2: 0x2159, 0x1cb3: 0x0040, 0x1cb4: 0x2119, 0x1cb5: 0x20c9, + 0x1cb6: 0x20d1, 0x1cb7: 0x20e9, 0x1cb8: 0x0040, 0x1cb9: 0x2129, 0x1cba: 0x2139, 0x1cbb: 0x2149, + 0x1cbc: 0x2311, 0x1cbd: 0x0040, 0x1cbe: 0x2319, 0x1cbf: 0x0040, // Block 0x73, offset 0x1cc0 - 0x1cc0: 0xb1d9, 0x1cc1: 0xb1f1, 0x1cc2: 0xb251, 0x1cc3: 0xb299, 0x1cc4: 0x0040, 0x1cc5: 0xb461, - 0x1cc6: 0xb2e1, 0x1cc7: 0xb269, 0x1cc8: 0xb359, 0x1cc9: 0xb479, 0x1cca: 0xb3e9, 0x1ccb: 0xb401, - 0x1ccc: 0xb419, 0x1ccd: 0xb431, 0x1cce: 0xb2f9, 0x1ccf: 0xb389, 0x1cd0: 0xb3b9, 0x1cd1: 0xb329, - 0x1cd2: 0xb3d1, 0x1cd3: 0xb2c9, 0x1cd4: 0xb311, 0x1cd5: 0xb221, 0x1cd6: 0xb239, 0x1cd7: 0xb281, - 0x1cd8: 0xb2b1, 0x1cd9: 0xb341, 0x1cda: 0xb371, 0x1cdb: 0xb3a1, 0x1cdc: 0xbca9, 0x1cdd: 0x7999, - 0x1cde: 0xbcc1, 0x1cdf: 0xbcd9, 0x1ce0: 0x0040, 0x1ce1: 0xb1f1, 0x1ce2: 0xb251, 0x1ce3: 0x0040, - 0x1ce4: 0xb449, 0x1ce5: 0x0040, 0x1ce6: 0x0040, 0x1ce7: 0xb269, 0x1ce8: 0x0040, 0x1ce9: 0xb479, - 0x1cea: 0xb3e9, 0x1ceb: 0xb401, 0x1cec: 0xb419, 0x1ced: 0xb431, 0x1cee: 0xb2f9, 0x1cef: 0xb389, - 0x1cf0: 0xb3b9, 0x1cf1: 0xb329, 0x1cf2: 0xb3d1, 0x1cf3: 0x0040, 0x1cf4: 0xb311, 0x1cf5: 0xb221, - 0x1cf6: 0xb239, 0x1cf7: 0xb281, 0x1cf8: 0x0040, 0x1cf9: 0xb341, 0x1cfa: 0x0040, 0x1cfb: 0xb3a1, + 0x1cc0: 0x20b1, 0x1cc1: 0x20b9, 0x1cc2: 0x20d9, 0x1cc3: 0x20f1, 0x1cc4: 0x2181, 0x1cc5: 0x2189, + 0x1cc6: 0x2109, 0x1cc7: 0x20e1, 0x1cc8: 0x2131, 0x1cc9: 0x2191, 0x1cca: 0x0040, 0x1ccb: 0x2169, + 0x1ccc: 0x2171, 0x1ccd: 0x2179, 0x1cce: 0x2111, 0x1ccf: 0x2141, 0x1cd0: 0x2151, 0x1cd1: 0x2121, + 0x1cd2: 0x2159, 0x1cd3: 0x2101, 0x1cd4: 0x2119, 0x1cd5: 0x20c9, 0x1cd6: 0x20d1, 0x1cd7: 0x20e9, + 0x1cd8: 0x20f9, 0x1cd9: 0x2129, 0x1cda: 0x2139, 0x1cdb: 0x2149, 0x1cdc: 0x0040, 0x1cdd: 0x0040, + 0x1cde: 0x0040, 0x1cdf: 0x0040, 0x1ce0: 0x0040, 0x1ce1: 0x20b9, 0x1ce2: 0x20d9, 0x1ce3: 0x20f1, + 0x1ce4: 0x0040, 0x1ce5: 0x2189, 0x1ce6: 0x2109, 0x1ce7: 0x20e1, 0x1ce8: 0x2131, 0x1ce9: 0x2191, + 0x1cea: 0x0040, 0x1ceb: 0x2169, 0x1cec: 0x2171, 0x1ced: 0x2179, 0x1cee: 0x2111, 0x1cef: 0x2141, + 0x1cf0: 0x2151, 0x1cf1: 0x2121, 0x1cf2: 0x2159, 0x1cf3: 0x2101, 0x1cf4: 0x2119, 0x1cf5: 0x20c9, + 0x1cf6: 0x20d1, 0x1cf7: 0x20e9, 0x1cf8: 0x20f9, 0x1cf9: 0x2129, 0x1cfa: 0x2139, 0x1cfb: 0x2149, 0x1cfc: 0x0040, 0x1cfd: 0x0040, 0x1cfe: 0x0040, 0x1cff: 0x0040, // Block 0x74, offset 0x1d00 - 0x1d00: 0x0040, 0x1d01: 0x0040, 0x1d02: 0xb251, 0x1d03: 0x0040, 0x1d04: 0x0040, 0x1d05: 0x0040, - 0x1d06: 0x0040, 0x1d07: 0xb269, 0x1d08: 0x0040, 0x1d09: 0xb479, 0x1d0a: 0x0040, 0x1d0b: 0xb401, - 0x1d0c: 0x0040, 0x1d0d: 0xb431, 0x1d0e: 0xb2f9, 0x1d0f: 0xb389, 0x1d10: 0x0040, 0x1d11: 0xb329, - 0x1d12: 0xb3d1, 0x1d13: 0x0040, 0x1d14: 0xb311, 0x1d15: 0x0040, 0x1d16: 0x0040, 0x1d17: 0xb281, - 0x1d18: 0x0040, 0x1d19: 0xb341, 0x1d1a: 0x0040, 0x1d1b: 0xb3a1, 0x1d1c: 0x0040, 0x1d1d: 0x7999, - 0x1d1e: 0x0040, 0x1d1f: 0xbcd9, 0x1d20: 0x0040, 0x1d21: 0xb1f1, 0x1d22: 0xb251, 0x1d23: 0x0040, - 0x1d24: 0xb449, 0x1d25: 0x0040, 0x1d26: 0x0040, 0x1d27: 0xb269, 0x1d28: 0xb359, 0x1d29: 0xb479, - 0x1d2a: 0xb3e9, 0x1d2b: 0x0040, 0x1d2c: 0xb419, 0x1d2d: 0xb431, 0x1d2e: 0xb2f9, 0x1d2f: 0xb389, - 0x1d30: 0xb3b9, 0x1d31: 0xb329, 0x1d32: 0xb3d1, 0x1d33: 0x0040, 0x1d34: 0xb311, 0x1d35: 0xb221, - 0x1d36: 0xb239, 0x1d37: 0xb281, 0x1d38: 0x0040, 0x1d39: 0xb341, 0x1d3a: 0xb371, 0x1d3b: 0xb3a1, - 0x1d3c: 0xbca9, 0x1d3d: 0x0040, 0x1d3e: 0xbcc1, 0x1d3f: 0x0040, + 0x1d00: 0x0040, 0x1d01: 0x232a, 0x1d02: 0x2332, 0x1d03: 0x233a, 0x1d04: 0x2342, 0x1d05: 0x234a, + 0x1d06: 0x2352, 0x1d07: 0x235a, 0x1d08: 0x2362, 0x1d09: 0x236a, 0x1d0a: 0x2372, 0x1d0b: 0x0018, + 0x1d0c: 0x0018, 0x1d0d: 0x0018, 0x1d0e: 0x0018, 0x1d0f: 0x0018, 0x1d10: 0x237a, 0x1d11: 0x2382, + 0x1d12: 0x238a, 0x1d13: 0x2392, 0x1d14: 0x239a, 0x1d15: 0x23a2, 0x1d16: 0x23aa, 0x1d17: 0x23b2, + 0x1d18: 0x23ba, 0x1d19: 0x23c2, 0x1d1a: 0x23ca, 0x1d1b: 0x23d2, 0x1d1c: 0x23da, 0x1d1d: 0x23e2, + 0x1d1e: 0x23ea, 0x1d1f: 0x23f2, 0x1d20: 0x23fa, 0x1d21: 0x2402, 0x1d22: 0x240a, 0x1d23: 0x2412, + 0x1d24: 0x241a, 0x1d25: 0x2422, 0x1d26: 0x242a, 0x1d27: 0x2432, 0x1d28: 0x243a, 0x1d29: 0x2442, + 0x1d2a: 0x2449, 0x1d2b: 0x03d9, 0x1d2c: 0x00b9, 0x1d2d: 0x1239, 0x1d2e: 0x2451, 0x1d2f: 0x0018, + 0x1d30: 0x0019, 0x1d31: 0x02e9, 0x1d32: 0x03d9, 0x1d33: 0x02f1, 0x1d34: 0x02f9, 0x1d35: 0x03f1, + 0x1d36: 0x0309, 0x1d37: 0x00a9, 0x1d38: 0x0311, 0x1d39: 0x00b1, 0x1d3a: 0x0319, 0x1d3b: 0x0101, + 0x1d3c: 0x0321, 0x1d3d: 0x0329, 0x1d3e: 0x0051, 0x1d3f: 0x0339, // Block 0x75, offset 0x1d40 - 0x1d40: 0xb1d9, 0x1d41: 0xb1f1, 0x1d42: 0xb251, 0x1d43: 0xb299, 0x1d44: 0xb449, 0x1d45: 0xb461, - 0x1d46: 0xb2e1, 0x1d47: 0xb269, 0x1d48: 0xb359, 0x1d49: 0xb479, 0x1d4a: 0x0040, 0x1d4b: 0xb401, - 0x1d4c: 0xb419, 0x1d4d: 0xb431, 0x1d4e: 0xb2f9, 0x1d4f: 0xb389, 0x1d50: 0xb3b9, 0x1d51: 0xb329, - 0x1d52: 0xb3d1, 0x1d53: 0xb2c9, 0x1d54: 0xb311, 0x1d55: 0xb221, 0x1d56: 0xb239, 0x1d57: 0xb281, - 0x1d58: 0xb2b1, 0x1d59: 0xb341, 0x1d5a: 0xb371, 0x1d5b: 0xb3a1, 0x1d5c: 0x0040, 0x1d5d: 0x0040, - 0x1d5e: 0x0040, 0x1d5f: 0x0040, 0x1d60: 0x0040, 0x1d61: 0xb1f1, 0x1d62: 0xb251, 0x1d63: 0xb299, - 0x1d64: 0x0040, 0x1d65: 0xb461, 0x1d66: 0xb2e1, 0x1d67: 0xb269, 0x1d68: 0xb359, 0x1d69: 0xb479, - 0x1d6a: 0x0040, 0x1d6b: 0xb401, 0x1d6c: 0xb419, 0x1d6d: 0xb431, 0x1d6e: 0xb2f9, 0x1d6f: 0xb389, - 0x1d70: 0xb3b9, 0x1d71: 0xb329, 0x1d72: 0xb3d1, 0x1d73: 0xb2c9, 0x1d74: 0xb311, 0x1d75: 0xb221, - 0x1d76: 0xb239, 0x1d77: 0xb281, 0x1d78: 0xb2b1, 0x1d79: 0xb341, 0x1d7a: 0xb371, 0x1d7b: 0xb3a1, - 0x1d7c: 0x0040, 0x1d7d: 0x0040, 0x1d7e: 0x0040, 0x1d7f: 0x0040, + 0x1d40: 0x0751, 0x1d41: 0x00b9, 0x1d42: 0x0089, 0x1d43: 0x0341, 0x1d44: 0x0349, 0x1d45: 0x0391, + 0x1d46: 0x00c1, 0x1d47: 0x0109, 0x1d48: 0x00c9, 0x1d49: 0x04b1, 0x1d4a: 0x2459, 0x1d4b: 0x11f9, + 0x1d4c: 0x2461, 0x1d4d: 0x04d9, 0x1d4e: 0x2469, 0x1d4f: 0x2471, 0x1d50: 0x0018, 0x1d51: 0x0018, + 0x1d52: 0x0018, 0x1d53: 0x0018, 0x1d54: 0x0018, 0x1d55: 0x0018, 0x1d56: 0x0018, 0x1d57: 0x0018, + 0x1d58: 0x0018, 0x1d59: 0x0018, 0x1d5a: 0x0018, 0x1d5b: 0x0018, 0x1d5c: 0x0018, 0x1d5d: 0x0018, + 0x1d5e: 0x0018, 0x1d5f: 0x0018, 0x1d60: 0x0018, 0x1d61: 0x0018, 0x1d62: 0x0018, 0x1d63: 0x0018, + 0x1d64: 0x0018, 0x1d65: 0x0018, 0x1d66: 0x0018, 0x1d67: 0x0018, 0x1d68: 0x0018, 0x1d69: 0x0018, + 0x1d6a: 0x2479, 0x1d6b: 0x2481, 0x1d6c: 0x2489, 0x1d6d: 0x0018, 0x1d6e: 0x0018, 0x1d6f: 0x0018, + 0x1d70: 0x0018, 0x1d71: 0x0018, 0x1d72: 0x0018, 0x1d73: 0x0018, 0x1d74: 0x0018, 0x1d75: 0x0018, + 0x1d76: 0x0018, 0x1d77: 0x0018, 0x1d78: 0x0018, 0x1d79: 0x0018, 0x1d7a: 0x0018, 0x1d7b: 0x0018, + 0x1d7c: 0x0018, 0x1d7d: 0x0018, 0x1d7e: 0x0018, 0x1d7f: 0x0018, // Block 0x76, offset 0x1d80 - 0x1d80: 0x0040, 0x1d81: 0xbcf2, 0x1d82: 0xbd0a, 0x1d83: 0xbd22, 0x1d84: 0xbd3a, 0x1d85: 0xbd52, - 0x1d86: 0xbd6a, 0x1d87: 0xbd82, 0x1d88: 0xbd9a, 0x1d89: 0xbdb2, 0x1d8a: 0xbdca, 0x1d8b: 0x0018, - 0x1d8c: 0x0018, 0x1d8d: 0x0018, 0x1d8e: 0x0018, 0x1d8f: 0x0018, 0x1d90: 0xbde2, 0x1d91: 0xbe02, - 0x1d92: 0xbe22, 0x1d93: 0xbe42, 0x1d94: 0xbe62, 0x1d95: 0xbe82, 0x1d96: 0xbea2, 0x1d97: 0xbec2, - 0x1d98: 0xbee2, 0x1d99: 0xbf02, 0x1d9a: 0xbf22, 0x1d9b: 0xbf42, 0x1d9c: 0xbf62, 0x1d9d: 0xbf82, - 0x1d9e: 0xbfa2, 0x1d9f: 0xbfc2, 0x1da0: 0xbfe2, 0x1da1: 0xc002, 0x1da2: 0xc022, 0x1da3: 0xc042, - 0x1da4: 0xc062, 0x1da5: 0xc082, 0x1da6: 0xc0a2, 0x1da7: 0xc0c2, 0x1da8: 0xc0e2, 0x1da9: 0xc102, - 0x1daa: 0xc121, 0x1dab: 0x1159, 0x1dac: 0x0269, 0x1dad: 0x66a9, 0x1dae: 0xc161, 0x1daf: 0x0018, - 0x1db0: 0x0039, 0x1db1: 0x0ee9, 0x1db2: 0x1159, 0x1db3: 0x0ef9, 0x1db4: 0x0f09, 0x1db5: 0x1199, - 0x1db6: 0x0f31, 0x1db7: 0x0249, 0x1db8: 0x0f41, 0x1db9: 0x0259, 0x1dba: 0x0f51, 0x1dbb: 0x0359, - 0x1dbc: 0x0f61, 0x1dbd: 0x0f71, 0x1dbe: 0x00d9, 0x1dbf: 0x0f99, + 0x1d80: 0x2499, 0x1d81: 0x24a1, 0x1d82: 0x24a9, 0x1d83: 0x0040, 0x1d84: 0x0040, 0x1d85: 0x0040, + 0x1d86: 0x0040, 0x1d87: 0x0040, 0x1d88: 0x0040, 0x1d89: 0x0040, 0x1d8a: 0x0040, 0x1d8b: 0x0040, + 0x1d8c: 0x0040, 0x1d8d: 0x0040, 0x1d8e: 0x0040, 0x1d8f: 0x0040, 0x1d90: 0x24b1, 0x1d91: 0x24b9, + 0x1d92: 0x24c1, 0x1d93: 0x24c9, 0x1d94: 0x24d1, 0x1d95: 0x24d9, 0x1d96: 0x24e1, 0x1d97: 0x24e9, + 0x1d98: 0x24f1, 0x1d99: 0x24f9, 0x1d9a: 0x2501, 0x1d9b: 0x2509, 0x1d9c: 0x2511, 0x1d9d: 0x2519, + 0x1d9e: 0x2521, 0x1d9f: 0x2529, 0x1da0: 0x2531, 0x1da1: 0x2539, 0x1da2: 0x2541, 0x1da3: 0x2549, + 0x1da4: 0x2551, 0x1da5: 0x2559, 0x1da6: 0x2561, 0x1da7: 0x2569, 0x1da8: 0x2571, 0x1da9: 0x2579, + 0x1daa: 0x2581, 0x1dab: 0x2589, 0x1dac: 0x2591, 0x1dad: 0x2599, 0x1dae: 0x25a1, 0x1daf: 0x25a9, + 0x1db0: 0x25b1, 0x1db1: 0x25b9, 0x1db2: 0x25c1, 0x1db3: 0x25c9, 0x1db4: 0x25d1, 0x1db5: 0x25d9, + 0x1db6: 0x25e1, 0x1db7: 0x25e9, 0x1db8: 0x25f1, 0x1db9: 0x25f9, 0x1dba: 0x2601, 0x1dbb: 0x2609, + 0x1dbc: 0x0040, 0x1dbd: 0x0040, 0x1dbe: 0x0040, 0x1dbf: 0x0040, // Block 0x77, offset 0x1dc0 - 0x1dc0: 0x2039, 0x1dc1: 0x0269, 0x1dc2: 0x01d9, 0x1dc3: 0x0fa9, 0x1dc4: 0x0fb9, 0x1dc5: 0x1089, - 0x1dc6: 0x0279, 0x1dc7: 0x0369, 0x1dc8: 0x0289, 0x1dc9: 0x13d1, 0x1dca: 0xc179, 0x1dcb: 0x65e9, - 0x1dcc: 0xc191, 0x1dcd: 0x1441, 0x1dce: 0xc1a9, 0x1dcf: 0xc1c9, 0x1dd0: 0x0018, 0x1dd1: 0x0018, - 0x1dd2: 0x0018, 0x1dd3: 0x0018, 0x1dd4: 0x0018, 0x1dd5: 0x0018, 0x1dd6: 0x0018, 0x1dd7: 0x0018, - 0x1dd8: 0x0018, 0x1dd9: 0x0018, 0x1dda: 0x0018, 0x1ddb: 0x0018, 0x1ddc: 0x0018, 0x1ddd: 0x0018, - 0x1dde: 0x0018, 0x1ddf: 0x0018, 0x1de0: 0x0018, 0x1de1: 0x0018, 0x1de2: 0x0018, 0x1de3: 0x0018, - 0x1de4: 0x0018, 0x1de5: 0x0018, 0x1de6: 0x0018, 0x1de7: 0x0018, 0x1de8: 0x0018, 0x1de9: 0x0018, - 0x1dea: 0xc1e1, 0x1deb: 0xc1f9, 0x1dec: 0xc211, 0x1ded: 0x0018, 0x1dee: 0x0018, 0x1def: 0x0018, - 0x1df0: 0x0018, 0x1df1: 0x0018, 0x1df2: 0x0018, 0x1df3: 0x0018, 0x1df4: 0x0018, 0x1df5: 0x0018, - 0x1df6: 0x0018, 0x1df7: 0x0018, 0x1df8: 0x0018, 0x1df9: 0x0018, 0x1dfa: 0x0018, 0x1dfb: 0x0018, - 0x1dfc: 0x0018, 0x1dfd: 0x0018, 0x1dfe: 0x0018, 0x1dff: 0x0018, + 0x1dc0: 0x2669, 0x1dc1: 0x2671, 0x1dc2: 0x2679, 0x1dc3: 0x8b55, 0x1dc4: 0x2681, 0x1dc5: 0x2689, + 0x1dc6: 0x2691, 0x1dc7: 0x2699, 0x1dc8: 0x26a1, 0x1dc9: 0x26a9, 0x1dca: 0x26b1, 0x1dcb: 0x26b9, + 0x1dcc: 0x26c1, 0x1dcd: 0x8b75, 0x1dce: 0x26c9, 0x1dcf: 0x26d1, 0x1dd0: 0x26d9, 0x1dd1: 0x26e1, + 0x1dd2: 0x8b95, 0x1dd3: 0x26e9, 0x1dd4: 0x26f1, 0x1dd5: 0x2521, 0x1dd6: 0x8bb5, 0x1dd7: 0x26f9, + 0x1dd8: 0x2701, 0x1dd9: 0x2709, 0x1dda: 0x2711, 0x1ddb: 0x2719, 0x1ddc: 0x8bd5, 0x1ddd: 0x2721, + 0x1dde: 0x2729, 0x1ddf: 0x2731, 0x1de0: 0x2739, 0x1de1: 0x2741, 0x1de2: 0x25f9, 0x1de3: 0x2749, + 0x1de4: 0x2751, 0x1de5: 0x2759, 0x1de6: 0x2761, 0x1de7: 0x2769, 0x1de8: 0x2771, 0x1de9: 0x2779, + 0x1dea: 0x2781, 0x1deb: 0x2789, 0x1dec: 0x2791, 0x1ded: 0x2799, 0x1dee: 0x27a1, 0x1def: 0x27a9, + 0x1df0: 0x27b1, 0x1df1: 0x27b9, 0x1df2: 0x27b9, 0x1df3: 0x27b9, 0x1df4: 0x8bf5, 0x1df5: 0x27c1, + 0x1df6: 0x27c9, 0x1df7: 0x27d1, 0x1df8: 0x8c15, 0x1df9: 0x27d9, 0x1dfa: 0x27e1, 0x1dfb: 0x27e9, + 0x1dfc: 0x27f1, 0x1dfd: 0x27f9, 0x1dfe: 0x2801, 0x1dff: 0x2809, // Block 0x78, offset 0x1e00 - 0x1e00: 0xc241, 0x1e01: 0xc279, 0x1e02: 0xc2b1, 0x1e03: 0x0040, 0x1e04: 0x0040, 0x1e05: 0x0040, - 0x1e06: 0x0040, 0x1e07: 0x0040, 0x1e08: 0x0040, 0x1e09: 0x0040, 0x1e0a: 0x0040, 0x1e0b: 0x0040, - 0x1e0c: 0x0040, 0x1e0d: 0x0040, 0x1e0e: 0x0040, 0x1e0f: 0x0040, 0x1e10: 0xc2d1, 0x1e11: 0xc2f1, - 0x1e12: 0xc311, 0x1e13: 0xc331, 0x1e14: 0xc351, 0x1e15: 0xc371, 0x1e16: 0xc391, 0x1e17: 0xc3b1, - 0x1e18: 0xc3d1, 0x1e19: 0xc3f1, 0x1e1a: 0xc411, 0x1e1b: 0xc431, 0x1e1c: 0xc451, 0x1e1d: 0xc471, - 0x1e1e: 0xc491, 0x1e1f: 0xc4b1, 0x1e20: 0xc4d1, 0x1e21: 0xc4f1, 0x1e22: 0xc511, 0x1e23: 0xc531, - 0x1e24: 0xc551, 0x1e25: 0xc571, 0x1e26: 0xc591, 0x1e27: 0xc5b1, 0x1e28: 0xc5d1, 0x1e29: 0xc5f1, - 0x1e2a: 0xc611, 0x1e2b: 0xc631, 0x1e2c: 0xc651, 0x1e2d: 0xc671, 0x1e2e: 0xc691, 0x1e2f: 0xc6b1, - 0x1e30: 0xc6d1, 0x1e31: 0xc6f1, 0x1e32: 0xc711, 0x1e33: 0xc731, 0x1e34: 0xc751, 0x1e35: 0xc771, - 0x1e36: 0xc791, 0x1e37: 0xc7b1, 0x1e38: 0xc7d1, 0x1e39: 0xc7f1, 0x1e3a: 0xc811, 0x1e3b: 0xc831, - 0x1e3c: 0x0040, 0x1e3d: 0x0040, 0x1e3e: 0x0040, 0x1e3f: 0x0040, + 0x1e00: 0x2811, 0x1e01: 0x2819, 0x1e02: 0x2821, 0x1e03: 0x2829, 0x1e04: 0x2831, 0x1e05: 0x2839, + 0x1e06: 0x2839, 0x1e07: 0x2841, 0x1e08: 0x2849, 0x1e09: 0x2851, 0x1e0a: 0x2859, 0x1e0b: 0x2861, + 0x1e0c: 0x2869, 0x1e0d: 0x2871, 0x1e0e: 0x2879, 0x1e0f: 0x2881, 0x1e10: 0x2889, 0x1e11: 0x2891, + 0x1e12: 0x2899, 0x1e13: 0x28a1, 0x1e14: 0x28a9, 0x1e15: 0x28b1, 0x1e16: 0x28b9, 0x1e17: 0x28c1, + 0x1e18: 0x28c9, 0x1e19: 0x8c35, 0x1e1a: 0x28d1, 0x1e1b: 0x28d9, 0x1e1c: 0x28e1, 0x1e1d: 0x24d9, + 0x1e1e: 0x28e9, 0x1e1f: 0x28f1, 0x1e20: 0x8c55, 0x1e21: 0x8c75, 0x1e22: 0x28f9, 0x1e23: 0x2901, + 0x1e24: 0x2909, 0x1e25: 0x2911, 0x1e26: 0x2919, 0x1e27: 0x2921, 0x1e28: 0x2040, 0x1e29: 0x2929, + 0x1e2a: 0x2931, 0x1e2b: 0x2931, 0x1e2c: 0x8c95, 0x1e2d: 0x2939, 0x1e2e: 0x2941, 0x1e2f: 0x2949, + 0x1e30: 0x2951, 0x1e31: 0x8cb5, 0x1e32: 0x2959, 0x1e33: 0x2961, 0x1e34: 0x2040, 0x1e35: 0x2969, + 0x1e36: 0x2971, 0x1e37: 0x2979, 0x1e38: 0x2981, 0x1e39: 0x2989, 0x1e3a: 0x2991, 0x1e3b: 0x8cd5, + 0x1e3c: 0x2999, 0x1e3d: 0x8cf5, 0x1e3e: 0x29a1, 0x1e3f: 0x29a9, // Block 0x79, offset 0x1e40 - 0x1e40: 0xcb61, 0x1e41: 0xcb81, 0x1e42: 0xcba1, 0x1e43: 0x8b55, 0x1e44: 0xcbc1, 0x1e45: 0xcbe1, - 0x1e46: 0xcc01, 0x1e47: 0xcc21, 0x1e48: 0xcc41, 0x1e49: 0xcc61, 0x1e4a: 0xcc81, 0x1e4b: 0xcca1, - 0x1e4c: 0xccc1, 0x1e4d: 0x8b75, 0x1e4e: 0xcce1, 0x1e4f: 0xcd01, 0x1e50: 0xcd21, 0x1e51: 0xcd41, - 0x1e52: 0x8b95, 0x1e53: 0xcd61, 0x1e54: 0xcd81, 0x1e55: 0xc491, 0x1e56: 0x8bb5, 0x1e57: 0xcda1, - 0x1e58: 0xcdc1, 0x1e59: 0xcde1, 0x1e5a: 0xce01, 0x1e5b: 0xce21, 0x1e5c: 0x8bd5, 0x1e5d: 0xce41, - 0x1e5e: 0xce61, 0x1e5f: 0xce81, 0x1e60: 0xcea1, 0x1e61: 0xcec1, 0x1e62: 0xc7f1, 0x1e63: 0xcee1, - 0x1e64: 0xcf01, 0x1e65: 0xcf21, 0x1e66: 0xcf41, 0x1e67: 0xcf61, 0x1e68: 0xcf81, 0x1e69: 0xcfa1, - 0x1e6a: 0xcfc1, 0x1e6b: 0xcfe1, 0x1e6c: 0xd001, 0x1e6d: 0xd021, 0x1e6e: 0xd041, 0x1e6f: 0xd061, - 0x1e70: 0xd081, 0x1e71: 0xd0a1, 0x1e72: 0xd0a1, 0x1e73: 0xd0a1, 0x1e74: 0x8bf5, 0x1e75: 0xd0c1, - 0x1e76: 0xd0e1, 0x1e77: 0xd101, 0x1e78: 0x8c15, 0x1e79: 0xd121, 0x1e7a: 0xd141, 0x1e7b: 0xd161, - 0x1e7c: 0xd181, 0x1e7d: 0xd1a1, 0x1e7e: 0xd1c1, 0x1e7f: 0xd1e1, + 0x1e40: 0x29b1, 0x1e41: 0x29b9, 0x1e42: 0x29c1, 0x1e43: 0x29c9, 0x1e44: 0x29d1, 0x1e45: 0x29d9, + 0x1e46: 0x29e1, 0x1e47: 0x29e9, 0x1e48: 0x29f1, 0x1e49: 0x8d15, 0x1e4a: 0x29f9, 0x1e4b: 0x2a01, + 0x1e4c: 0x2a09, 0x1e4d: 0x2a11, 0x1e4e: 0x2a19, 0x1e4f: 0x8d35, 0x1e50: 0x2a21, 0x1e51: 0x8d55, + 0x1e52: 0x8d75, 0x1e53: 0x2a29, 0x1e54: 0x2a31, 0x1e55: 0x2a31, 0x1e56: 0x2a39, 0x1e57: 0x8d95, + 0x1e58: 0x8db5, 0x1e59: 0x2a41, 0x1e5a: 0x2a49, 0x1e5b: 0x2a51, 0x1e5c: 0x2a59, 0x1e5d: 0x2a61, + 0x1e5e: 0x2a69, 0x1e5f: 0x2a71, 0x1e60: 0x2a79, 0x1e61: 0x2a81, 0x1e62: 0x2a89, 0x1e63: 0x2a91, + 0x1e64: 0x8dd5, 0x1e65: 0x2a99, 0x1e66: 0x2aa1, 0x1e67: 0x2aa9, 0x1e68: 0x2ab1, 0x1e69: 0x2aa9, + 0x1e6a: 0x2ab9, 0x1e6b: 0x2ac1, 0x1e6c: 0x2ac9, 0x1e6d: 0x2ad1, 0x1e6e: 0x2ad9, 0x1e6f: 0x2ae1, + 0x1e70: 0x2ae9, 0x1e71: 0x2af1, 0x1e72: 0x2af9, 0x1e73: 0x2b01, 0x1e74: 0x2b09, 0x1e75: 0x2b11, + 0x1e76: 0x2b19, 0x1e77: 0x2b21, 0x1e78: 0x8df5, 0x1e79: 0x2b29, 0x1e7a: 0x2b31, 0x1e7b: 0x2b39, + 0x1e7c: 0x2b41, 0x1e7d: 0x2b49, 0x1e7e: 0x8e15, 0x1e7f: 0x2b51, // Block 0x7a, offset 0x1e80 - 0x1e80: 0xd201, 0x1e81: 0xd221, 0x1e82: 0xd241, 0x1e83: 0xd261, 0x1e84: 0xd281, 0x1e85: 0xd2a1, - 0x1e86: 0xd2a1, 0x1e87: 0xd2c1, 0x1e88: 0xd2e1, 0x1e89: 0xd301, 0x1e8a: 0xd321, 0x1e8b: 0xd341, - 0x1e8c: 0xd361, 0x1e8d: 0xd381, 0x1e8e: 0xd3a1, 0x1e8f: 0xd3c1, 0x1e90: 0xd3e1, 0x1e91: 0xd401, - 0x1e92: 0xd421, 0x1e93: 0xd441, 0x1e94: 0xd461, 0x1e95: 0xd481, 0x1e96: 0xd4a1, 0x1e97: 0xd4c1, - 0x1e98: 0xd4e1, 0x1e99: 0x8c35, 0x1e9a: 0xd501, 0x1e9b: 0xd521, 0x1e9c: 0xd541, 0x1e9d: 0xc371, - 0x1e9e: 0xd561, 0x1e9f: 0xd581, 0x1ea0: 0x8c55, 0x1ea1: 0x8c75, 0x1ea2: 0xd5a1, 0x1ea3: 0xd5c1, - 0x1ea4: 0xd5e1, 0x1ea5: 0xd601, 0x1ea6: 0xd621, 0x1ea7: 0xd641, 0x1ea8: 0x2040, 0x1ea9: 0xd661, - 0x1eaa: 0xd681, 0x1eab: 0xd681, 0x1eac: 0x8c95, 0x1ead: 0xd6a1, 0x1eae: 0xd6c1, 0x1eaf: 0xd6e1, - 0x1eb0: 0xd701, 0x1eb1: 0x8cb5, 0x1eb2: 0xd721, 0x1eb3: 0xd741, 0x1eb4: 0x2040, 0x1eb5: 0xd761, - 0x1eb6: 0xd781, 0x1eb7: 0xd7a1, 0x1eb8: 0xd7c1, 0x1eb9: 0xd7e1, 0x1eba: 0xd801, 0x1ebb: 0x8cd5, - 0x1ebc: 0xd821, 0x1ebd: 0x8cf5, 0x1ebe: 0xd841, 0x1ebf: 0xd861, + 0x1e80: 0x2b59, 0x1e81: 0x2b61, 0x1e82: 0x2b69, 0x1e83: 0x2b71, 0x1e84: 0x2b79, 0x1e85: 0x2b81, + 0x1e86: 0x2b89, 0x1e87: 0x2b91, 0x1e88: 0x2b99, 0x1e89: 0x2ba1, 0x1e8a: 0x8e35, 0x1e8b: 0x2ba9, + 0x1e8c: 0x2bb1, 0x1e8d: 0x2bb9, 0x1e8e: 0x2bc1, 0x1e8f: 0x2bc9, 0x1e90: 0x2bd1, 0x1e91: 0x2bd9, + 0x1e92: 0x2be1, 0x1e93: 0x2be9, 0x1e94: 0x2bf1, 0x1e95: 0x2bf9, 0x1e96: 0x2c01, 0x1e97: 0x2c09, + 0x1e98: 0x2c11, 0x1e99: 0x2c19, 0x1e9a: 0x2c21, 0x1e9b: 0x2c29, 0x1e9c: 0x2c31, 0x1e9d: 0x8e55, + 0x1e9e: 0x2c39, 0x1e9f: 0x2c41, 0x1ea0: 0x2c49, 0x1ea1: 0x2c51, 0x1ea2: 0x2c59, 0x1ea3: 0x8e75, + 0x1ea4: 0x2c61, 0x1ea5: 0x2c69, 0x1ea6: 0x2c71, 0x1ea7: 0x2c79, 0x1ea8: 0x2c81, 0x1ea9: 0x2c89, + 0x1eaa: 0x2c91, 0x1eab: 0x2c99, 0x1eac: 0x7f0d, 0x1ead: 0x2ca1, 0x1eae: 0x2ca9, 0x1eaf: 0x2cb1, + 0x1eb0: 0x8e95, 0x1eb1: 0x2cb9, 0x1eb2: 0x2cc1, 0x1eb3: 0x2cc9, 0x1eb4: 0x2cd1, 0x1eb5: 0x2cd9, + 0x1eb6: 0x2ce1, 0x1eb7: 0x8eb5, 0x1eb8: 0x8ed5, 0x1eb9: 0x8ef5, 0x1eba: 0x2ce9, 0x1ebb: 0x8f15, + 0x1ebc: 0x2cf1, 0x1ebd: 0x2cf9, 0x1ebe: 0x2d01, 0x1ebf: 0x2d09, // Block 0x7b, offset 0x1ec0 - 0x1ec0: 0xd881, 0x1ec1: 0xd8a1, 0x1ec2: 0xd8c1, 0x1ec3: 0xd8e1, 0x1ec4: 0xd901, 0x1ec5: 0xd921, - 0x1ec6: 0xd941, 0x1ec7: 0xd961, 0x1ec8: 0xd981, 0x1ec9: 0x8d15, 0x1eca: 0xd9a1, 0x1ecb: 0xd9c1, - 0x1ecc: 0xd9e1, 0x1ecd: 0xda01, 0x1ece: 0xda21, 0x1ecf: 0x8d35, 0x1ed0: 0xda41, 0x1ed1: 0x8d55, - 0x1ed2: 0x8d75, 0x1ed3: 0xda61, 0x1ed4: 0xda81, 0x1ed5: 0xda81, 0x1ed6: 0xdaa1, 0x1ed7: 0x8d95, - 0x1ed8: 0x8db5, 0x1ed9: 0xdac1, 0x1eda: 0xdae1, 0x1edb: 0xdb01, 0x1edc: 0xdb21, 0x1edd: 0xdb41, - 0x1ede: 0xdb61, 0x1edf: 0xdb81, 0x1ee0: 0xdba1, 0x1ee1: 0xdbc1, 0x1ee2: 0xdbe1, 0x1ee3: 0xdc01, - 0x1ee4: 0x8dd5, 0x1ee5: 0xdc21, 0x1ee6: 0xdc41, 0x1ee7: 0xdc61, 0x1ee8: 0xdc81, 0x1ee9: 0xdc61, - 0x1eea: 0xdca1, 0x1eeb: 0xdcc1, 0x1eec: 0xdce1, 0x1eed: 0xdd01, 0x1eee: 0xdd21, 0x1eef: 0xdd41, - 0x1ef0: 0xdd61, 0x1ef1: 0xdd81, 0x1ef2: 0xdda1, 0x1ef3: 0xddc1, 0x1ef4: 0xdde1, 0x1ef5: 0xde01, - 0x1ef6: 0xde21, 0x1ef7: 0xde41, 0x1ef8: 0x8df5, 0x1ef9: 0xde61, 0x1efa: 0xde81, 0x1efb: 0xdea1, - 0x1efc: 0xdec1, 0x1efd: 0xdee1, 0x1efe: 0x8e15, 0x1eff: 0xdf01, + 0x1ec0: 0x2d11, 0x1ec1: 0x2d19, 0x1ec2: 0x2d21, 0x1ec3: 0x2d29, 0x1ec4: 0x2d31, 0x1ec5: 0x2d39, + 0x1ec6: 0x8f35, 0x1ec7: 0x2d41, 0x1ec8: 0x2d49, 0x1ec9: 0x2d51, 0x1eca: 0x2d59, 0x1ecb: 0x2d61, + 0x1ecc: 0x2d69, 0x1ecd: 0x8f55, 0x1ece: 0x2d71, 0x1ecf: 0x2d79, 0x1ed0: 0x8f75, 0x1ed1: 0x8f95, + 0x1ed2: 0x2d81, 0x1ed3: 0x2d89, 0x1ed4: 0x2d91, 0x1ed5: 0x2d99, 0x1ed6: 0x2da1, 0x1ed7: 0x2da9, + 0x1ed8: 0x2db1, 0x1ed9: 0x2db9, 0x1eda: 0x2dc1, 0x1edb: 0x8fb5, 0x1edc: 0x2dc9, 0x1edd: 0x8fd5, + 0x1ede: 0x2dd1, 0x1edf: 0x2040, 0x1ee0: 0x2dd9, 0x1ee1: 0x2de1, 0x1ee2: 0x2de9, 0x1ee3: 0x8ff5, + 0x1ee4: 0x2df1, 0x1ee5: 0x2df9, 0x1ee6: 0x9015, 0x1ee7: 0x9035, 0x1ee8: 0x2e01, 0x1ee9: 0x2e09, + 0x1eea: 0x2e11, 0x1eeb: 0x2e19, 0x1eec: 0x2e21, 0x1eed: 0x2e21, 0x1eee: 0x2e29, 0x1eef: 0x2e31, + 0x1ef0: 0x2e39, 0x1ef1: 0x2e41, 0x1ef2: 0x2e49, 0x1ef3: 0x2e51, 0x1ef4: 0x2e59, 0x1ef5: 0x9055, + 0x1ef6: 0x2e61, 0x1ef7: 0x9075, 0x1ef8: 0x2e69, 0x1ef9: 0x9095, 0x1efa: 0x2e71, 0x1efb: 0x90b5, + 0x1efc: 0x90d5, 0x1efd: 0x90f5, 0x1efe: 0x2e79, 0x1eff: 0x2e81, // Block 0x7c, offset 0x1f00 - 0x1f00: 0xe601, 0x1f01: 0xe621, 0x1f02: 0xe641, 0x1f03: 0xe661, 0x1f04: 0xe681, 0x1f05: 0xe6a1, - 0x1f06: 0x8f35, 0x1f07: 0xe6c1, 0x1f08: 0xe6e1, 0x1f09: 0xe701, 0x1f0a: 0xe721, 0x1f0b: 0xe741, - 0x1f0c: 0xe761, 0x1f0d: 0x8f55, 0x1f0e: 0xe781, 0x1f0f: 0xe7a1, 0x1f10: 0x8f75, 0x1f11: 0x8f95, - 0x1f12: 0xe7c1, 0x1f13: 0xe7e1, 0x1f14: 0xe801, 0x1f15: 0xe821, 0x1f16: 0xe841, 0x1f17: 0xe861, - 0x1f18: 0xe881, 0x1f19: 0xe8a1, 0x1f1a: 0xe8c1, 0x1f1b: 0x8fb5, 0x1f1c: 0xe8e1, 0x1f1d: 0x8fd5, - 0x1f1e: 0xe901, 0x1f1f: 0x2040, 0x1f20: 0xe921, 0x1f21: 0xe941, 0x1f22: 0xe961, 0x1f23: 0x8ff5, - 0x1f24: 0xe981, 0x1f25: 0xe9a1, 0x1f26: 0x9015, 0x1f27: 0x9035, 0x1f28: 0xe9c1, 0x1f29: 0xe9e1, - 0x1f2a: 0xea01, 0x1f2b: 0xea21, 0x1f2c: 0xea41, 0x1f2d: 0xea41, 0x1f2e: 0xea61, 0x1f2f: 0xea81, - 0x1f30: 0xeaa1, 0x1f31: 0xeac1, 0x1f32: 0xeae1, 0x1f33: 0xeb01, 0x1f34: 0xeb21, 0x1f35: 0x9055, - 0x1f36: 0xeb41, 0x1f37: 0x9075, 0x1f38: 0xeb61, 0x1f39: 0x9095, 0x1f3a: 0xeb81, 0x1f3b: 0x90b5, - 0x1f3c: 0x90d5, 0x1f3d: 0x90f5, 0x1f3e: 0xeba1, 0x1f3f: 0xebc1, + 0x1f00: 0x2e89, 0x1f01: 0x9115, 0x1f02: 0x9135, 0x1f03: 0x9155, 0x1f04: 0x9175, 0x1f05: 0x2e91, + 0x1f06: 0x2e99, 0x1f07: 0x2e99, 0x1f08: 0x2ea1, 0x1f09: 0x2ea9, 0x1f0a: 0x2eb1, 0x1f0b: 0x2eb9, + 0x1f0c: 0x2ec1, 0x1f0d: 0x9195, 0x1f0e: 0x2ec9, 0x1f0f: 0x2ed1, 0x1f10: 0x2ed9, 0x1f11: 0x2ee1, + 0x1f12: 0x91b5, 0x1f13: 0x2ee9, 0x1f14: 0x91d5, 0x1f15: 0x91f5, 0x1f16: 0x2ef1, 0x1f17: 0x2ef9, + 0x1f18: 0x2f01, 0x1f19: 0x2f09, 0x1f1a: 0x2f11, 0x1f1b: 0x2f19, 0x1f1c: 0x9215, 0x1f1d: 0x9235, + 0x1f1e: 0x9255, 0x1f1f: 0x2040, 0x1f20: 0x2f21, 0x1f21: 0x9275, 0x1f22: 0x2f29, 0x1f23: 0x2f31, + 0x1f24: 0x2f39, 0x1f25: 0x9295, 0x1f26: 0x2f41, 0x1f27: 0x2f49, 0x1f28: 0x2f51, 0x1f29: 0x2f59, + 0x1f2a: 0x2f61, 0x1f2b: 0x92b5, 0x1f2c: 0x2f69, 0x1f2d: 0x2f71, 0x1f2e: 0x2f79, 0x1f2f: 0x2f81, + 0x1f30: 0x2f89, 0x1f31: 0x2f91, 0x1f32: 0x92d5, 0x1f33: 0x92f5, 0x1f34: 0x2f99, 0x1f35: 0x9315, + 0x1f36: 0x2fa1, 0x1f37: 0x9335, 0x1f38: 0x2fa9, 0x1f39: 0x2fb1, 0x1f3a: 0x2fb9, 0x1f3b: 0x9355, + 0x1f3c: 0x9375, 0x1f3d: 0x2fc1, 0x1f3e: 0x9395, 0x1f3f: 0x2fc9, // Block 0x7d, offset 0x1f40 - 0x1f40: 0xebe1, 0x1f41: 0x9115, 0x1f42: 0x9135, 0x1f43: 0x9155, 0x1f44: 0x9175, 0x1f45: 0xec01, - 0x1f46: 0xec21, 0x1f47: 0xec21, 0x1f48: 0xec41, 0x1f49: 0xec61, 0x1f4a: 0xec81, 0x1f4b: 0xeca1, - 0x1f4c: 0xecc1, 0x1f4d: 0x9195, 0x1f4e: 0xece1, 0x1f4f: 0xed01, 0x1f50: 0xed21, 0x1f51: 0xed41, - 0x1f52: 0x91b5, 0x1f53: 0xed61, 0x1f54: 0x91d5, 0x1f55: 0x91f5, 0x1f56: 0xed81, 0x1f57: 0xeda1, - 0x1f58: 0xedc1, 0x1f59: 0xede1, 0x1f5a: 0xee01, 0x1f5b: 0xee21, 0x1f5c: 0x9215, 0x1f5d: 0x9235, - 0x1f5e: 0x9255, 0x1f5f: 0x2040, 0x1f60: 0xee41, 0x1f61: 0x9275, 0x1f62: 0xee61, 0x1f63: 0xee81, - 0x1f64: 0xeea1, 0x1f65: 0x9295, 0x1f66: 0xeec1, 0x1f67: 0xeee1, 0x1f68: 0xef01, 0x1f69: 0xef21, - 0x1f6a: 0xef41, 0x1f6b: 0x92b5, 0x1f6c: 0xef61, 0x1f6d: 0xef81, 0x1f6e: 0xefa1, 0x1f6f: 0xefc1, - 0x1f70: 0xefe1, 0x1f71: 0xf001, 0x1f72: 0x92d5, 0x1f73: 0x92f5, 0x1f74: 0xf021, 0x1f75: 0x9315, - 0x1f76: 0xf041, 0x1f77: 0x9335, 0x1f78: 0xf061, 0x1f79: 0xf081, 0x1f7a: 0xf0a1, 0x1f7b: 0x9355, - 0x1f7c: 0x9375, 0x1f7d: 0xf0c1, 0x1f7e: 0x9395, 0x1f7f: 0xf0e1, + 0x1f40: 0x93b5, 0x1f41: 0x2fd1, 0x1f42: 0x2fd9, 0x1f43: 0x2fe1, 0x1f44: 0x2fe9, 0x1f45: 0x2ff1, + 0x1f46: 0x2ff9, 0x1f47: 0x93d5, 0x1f48: 0x93f5, 0x1f49: 0x9415, 0x1f4a: 0x9435, 0x1f4b: 0x2a29, + 0x1f4c: 0x3001, 0x1f4d: 0x3009, 0x1f4e: 0x3011, 0x1f4f: 0x3019, 0x1f50: 0x3021, 0x1f51: 0x3029, + 0x1f52: 0x3031, 0x1f53: 0x3039, 0x1f54: 0x3041, 0x1f55: 0x3049, 0x1f56: 0x3051, 0x1f57: 0x9455, + 0x1f58: 0x3059, 0x1f59: 0x3061, 0x1f5a: 0x3069, 0x1f5b: 0x3071, 0x1f5c: 0x3079, 0x1f5d: 0x3081, + 0x1f5e: 0x3089, 0x1f5f: 0x3091, 0x1f60: 0x3099, 0x1f61: 0x30a1, 0x1f62: 0x30a9, 0x1f63: 0x30b1, + 0x1f64: 0x9475, 0x1f65: 0x9495, 0x1f66: 0x94b5, 0x1f67: 0x30b9, 0x1f68: 0x30c1, 0x1f69: 0x30c9, + 0x1f6a: 0x30d1, 0x1f6b: 0x94d5, 0x1f6c: 0x30d9, 0x1f6d: 0x94f5, 0x1f6e: 0x30e1, 0x1f6f: 0x30e9, + 0x1f70: 0x9515, 0x1f71: 0x9535, 0x1f72: 0x30f1, 0x1f73: 0x30f9, 0x1f74: 0x3101, 0x1f75: 0x3109, + 0x1f76: 0x3111, 0x1f77: 0x3119, 0x1f78: 0x3121, 0x1f79: 0x3129, 0x1f7a: 0x3131, 0x1f7b: 0x3139, + 0x1f7c: 0x3141, 0x1f7d: 0x3149, 0x1f7e: 0x3151, 0x1f7f: 0x2040, // Block 0x7e, offset 0x1f80 - 0x1f80: 0xf721, 0x1f81: 0xf741, 0x1f82: 0xf761, 0x1f83: 0xf781, 0x1f84: 0xf7a1, 0x1f85: 0x9555, - 0x1f86: 0xf7c1, 0x1f87: 0xf7e1, 0x1f88: 0xf801, 0x1f89: 0xf821, 0x1f8a: 0xf841, 0x1f8b: 0x9575, - 0x1f8c: 0x9595, 0x1f8d: 0xf861, 0x1f8e: 0xf881, 0x1f8f: 0xf8a1, 0x1f90: 0xf8c1, 0x1f91: 0xf8e1, - 0x1f92: 0xf901, 0x1f93: 0x95b5, 0x1f94: 0xf921, 0x1f95: 0xf941, 0x1f96: 0xf961, 0x1f97: 0xf981, - 0x1f98: 0x95d5, 0x1f99: 0x95f5, 0x1f9a: 0xf9a1, 0x1f9b: 0xf9c1, 0x1f9c: 0xf9e1, 0x1f9d: 0x9615, - 0x1f9e: 0xfa01, 0x1f9f: 0xfa21, 0x1fa0: 0x684d, 0x1fa1: 0x9635, 0x1fa2: 0xfa41, 0x1fa3: 0xfa61, - 0x1fa4: 0xfa81, 0x1fa5: 0x9655, 0x1fa6: 0xfaa1, 0x1fa7: 0xfac1, 0x1fa8: 0xfae1, 0x1fa9: 0xfb01, - 0x1faa: 0xfb21, 0x1fab: 0xfb41, 0x1fac: 0xfb61, 0x1fad: 0x9675, 0x1fae: 0xfb81, 0x1faf: 0xfba1, - 0x1fb0: 0xfbc1, 0x1fb1: 0x9695, 0x1fb2: 0xfbe1, 0x1fb3: 0xfc01, 0x1fb4: 0xfc21, 0x1fb5: 0xfc41, - 0x1fb6: 0x7b6d, 0x1fb7: 0x96b5, 0x1fb8: 0xfc61, 0x1fb9: 0xfc81, 0x1fba: 0xfca1, 0x1fbb: 0x96d5, - 0x1fbc: 0xfcc1, 0x1fbd: 0x96f5, 0x1fbe: 0xfce1, 0x1fbf: 0xfce1, + 0x1f80: 0x3159, 0x1f81: 0x3161, 0x1f82: 0x3169, 0x1f83: 0x3171, 0x1f84: 0x3179, 0x1f85: 0x9555, + 0x1f86: 0x3181, 0x1f87: 0x3189, 0x1f88: 0x3191, 0x1f89: 0x3199, 0x1f8a: 0x31a1, 0x1f8b: 0x9575, + 0x1f8c: 0x9595, 0x1f8d: 0x31a9, 0x1f8e: 0x31b1, 0x1f8f: 0x31b9, 0x1f90: 0x31c1, 0x1f91: 0x31c9, + 0x1f92: 0x31d1, 0x1f93: 0x95b5, 0x1f94: 0x31d9, 0x1f95: 0x31e1, 0x1f96: 0x31e9, 0x1f97: 0x31f1, + 0x1f98: 0x95d5, 0x1f99: 0x95f5, 0x1f9a: 0x31f9, 0x1f9b: 0x3201, 0x1f9c: 0x3209, 0x1f9d: 0x9615, + 0x1f9e: 0x3211, 0x1f9f: 0x3219, 0x1fa0: 0x684d, 0x1fa1: 0x9635, 0x1fa2: 0x3221, 0x1fa3: 0x3229, + 0x1fa4: 0x3231, 0x1fa5: 0x9655, 0x1fa6: 0x3239, 0x1fa7: 0x3241, 0x1fa8: 0x3249, 0x1fa9: 0x3251, + 0x1faa: 0x3259, 0x1fab: 0x3261, 0x1fac: 0x3269, 0x1fad: 0x9675, 0x1fae: 0x3271, 0x1faf: 0x3279, + 0x1fb0: 0x3281, 0x1fb1: 0x9695, 0x1fb2: 0x3289, 0x1fb3: 0x3291, 0x1fb4: 0x3299, 0x1fb5: 0x32a1, + 0x1fb6: 0x7b6d, 0x1fb7: 0x96b5, 0x1fb8: 0x32a9, 0x1fb9: 0x32b1, 0x1fba: 0x32b9, 0x1fbb: 0x96d5, + 0x1fbc: 0x32c1, 0x1fbd: 0x96f5, 0x1fbe: 0x32c9, 0x1fbf: 0x32c9, // Block 0x7f, offset 0x1fc0 - 0x1fc0: 0xfd01, 0x1fc1: 0x9715, 0x1fc2: 0xfd21, 0x1fc3: 0xfd41, 0x1fc4: 0xfd61, 0x1fc5: 0xfd81, - 0x1fc6: 0xfda1, 0x1fc7: 0xfdc1, 0x1fc8: 0xfde1, 0x1fc9: 0x9735, 0x1fca: 0xfe01, 0x1fcb: 0xfe21, - 0x1fcc: 0xfe41, 0x1fcd: 0xfe61, 0x1fce: 0xfe81, 0x1fcf: 0xfea1, 0x1fd0: 0x9755, 0x1fd1: 0xfec1, - 0x1fd2: 0x9775, 0x1fd3: 0x9795, 0x1fd4: 0x97b5, 0x1fd5: 0xfee1, 0x1fd6: 0xff01, 0x1fd7: 0xff21, - 0x1fd8: 0xff41, 0x1fd9: 0xff61, 0x1fda: 0xff81, 0x1fdb: 0xffa1, 0x1fdc: 0xffc1, 0x1fdd: 0x97d5, + 0x1fc0: 0x32d1, 0x1fc1: 0x9715, 0x1fc2: 0x32d9, 0x1fc3: 0x32e1, 0x1fc4: 0x32e9, 0x1fc5: 0x32f1, + 0x1fc6: 0x32f9, 0x1fc7: 0x3301, 0x1fc8: 0x3309, 0x1fc9: 0x9735, 0x1fca: 0x3311, 0x1fcb: 0x3319, + 0x1fcc: 0x3321, 0x1fcd: 0x3329, 0x1fce: 0x3331, 0x1fcf: 0x3339, 0x1fd0: 0x9755, 0x1fd1: 0x3341, + 0x1fd2: 0x9775, 0x1fd3: 0x9795, 0x1fd4: 0x97b5, 0x1fd5: 0x3349, 0x1fd6: 0x3351, 0x1fd7: 0x3359, + 0x1fd8: 0x3361, 0x1fd9: 0x3369, 0x1fda: 0x3371, 0x1fdb: 0x3379, 0x1fdc: 0x3381, 0x1fdd: 0x97d5, 0x1fde: 0x0040, 0x1fdf: 0x0040, 0x1fe0: 0x0040, 0x1fe1: 0x0040, 0x1fe2: 0x0040, 0x1fe3: 0x0040, 0x1fe4: 0x0040, 0x1fe5: 0x0040, 0x1fe6: 0x0040, 0x1fe7: 0x0040, 0x1fe8: 0x0040, 0x1fe9: 0x0040, 0x1fea: 0x0040, 0x1feb: 0x0040, 0x1fec: 0x0040, 0x1fed: 0x0040, 0x1fee: 0x0040, 0x1fef: 0x0040, @@ -2134,7 +2277,7 @@ var idnaIndex = [2368]uint16{ 0x1b8: 0xd6, 0x1b9: 0xd7, 0x1ba: 0xd8, 0x1bb: 0xd9, 0x1bc: 0xda, 0x1bd: 0xdb, 0x1be: 0xdc, 0x1bf: 0x37, // Block 0x7, offset 0x1c0 0x1c0: 0x38, 0x1c1: 0xdd, 0x1c2: 0xde, 0x1c3: 0xdf, 0x1c4: 0xe0, 0x1c5: 0x39, 0x1c6: 0x3a, 0x1c7: 0xe1, - 0x1c8: 0xe2, 0x1c9: 0x3b, 0x1ca: 0x3c, 0x1cb: 0x3d, 0x1cc: 0x3e, 0x1cd: 0x3f, 0x1ce: 0x40, 0x1cf: 0x41, + 0x1c8: 0xe2, 0x1c9: 0x3b, 0x1ca: 0x3c, 0x1cb: 0x3d, 0x1cc: 0xe3, 0x1cd: 0xe4, 0x1ce: 0x3e, 0x1cf: 0x3f, 0x1d0: 0xa0, 0x1d1: 0xa0, 0x1d2: 0xa0, 0x1d3: 0xa0, 0x1d4: 0xa0, 0x1d5: 0xa0, 0x1d6: 0xa0, 0x1d7: 0xa0, 0x1d8: 0xa0, 0x1d9: 0xa0, 0x1da: 0xa0, 0x1db: 0xa0, 0x1dc: 0xa0, 0x1dd: 0xa0, 0x1de: 0xa0, 0x1df: 0xa0, 0x1e0: 0xa0, 0x1e1: 0xa0, 0x1e2: 0xa0, 0x1e3: 0xa0, 0x1e4: 0xa0, 0x1e5: 0xa0, 0x1e6: 0xa0, 0x1e7: 0xa0, @@ -2167,143 +2310,143 @@ var idnaIndex = [2368]uint16{ 0x2a0: 0xa0, 0x2a1: 0xa0, 0x2a2: 0xa0, 0x2a3: 0xa0, 0x2a4: 0xa0, 0x2a5: 0xa0, 0x2a6: 0xa0, 0x2a7: 0xa0, 0x2a8: 0xa0, 0x2a9: 0xa0, 0x2aa: 0xa0, 0x2ab: 0xa0, 0x2ac: 0xa0, 0x2ad: 0xa0, 0x2ae: 0xa0, 0x2af: 0xa0, 0x2b0: 0xa0, 0x2b1: 0xa0, 0x2b2: 0xa0, 0x2b3: 0xa0, 0x2b4: 0xa0, 0x2b5: 0xa0, 0x2b6: 0xa0, 0x2b7: 0xa0, - 0x2b8: 0xa0, 0x2b9: 0xa0, 0x2ba: 0xa0, 0x2bb: 0xa0, 0x2bc: 0xa0, 0x2bd: 0xa0, 0x2be: 0xa0, 0x2bf: 0xe3, + 0x2b8: 0xa0, 0x2b9: 0xa0, 0x2ba: 0xa0, 0x2bb: 0xa0, 0x2bc: 0xa0, 0x2bd: 0xa0, 0x2be: 0xa0, 0x2bf: 0xe5, // Block 0xb, offset 0x2c0 0x2c0: 0xa0, 0x2c1: 0xa0, 0x2c2: 0xa0, 0x2c3: 0xa0, 0x2c4: 0xa0, 0x2c5: 0xa0, 0x2c6: 0xa0, 0x2c7: 0xa0, 0x2c8: 0xa0, 0x2c9: 0xa0, 0x2ca: 0xa0, 0x2cb: 0xa0, 0x2cc: 0xa0, 0x2cd: 0xa0, 0x2ce: 0xa0, 0x2cf: 0xa0, - 0x2d0: 0xa0, 0x2d1: 0xa0, 0x2d2: 0xe4, 0x2d3: 0xe5, 0x2d4: 0xa0, 0x2d5: 0xa0, 0x2d6: 0xa0, 0x2d7: 0xa0, - 0x2d8: 0xe6, 0x2d9: 0x42, 0x2da: 0x43, 0x2db: 0xe7, 0x2dc: 0x44, 0x2dd: 0x45, 0x2de: 0x46, 0x2df: 0xe8, - 0x2e0: 0xe9, 0x2e1: 0xea, 0x2e2: 0xeb, 0x2e3: 0xec, 0x2e4: 0xed, 0x2e5: 0xee, 0x2e6: 0xef, 0x2e7: 0xf0, - 0x2e8: 0xf1, 0x2e9: 0xf2, 0x2ea: 0xf3, 0x2eb: 0xf4, 0x2ec: 0xf5, 0x2ed: 0xf6, 0x2ee: 0xf7, 0x2ef: 0xf8, + 0x2d0: 0xa0, 0x2d1: 0xa0, 0x2d2: 0xe6, 0x2d3: 0xe7, 0x2d4: 0xa0, 0x2d5: 0xa0, 0x2d6: 0xa0, 0x2d7: 0xa0, + 0x2d8: 0xe8, 0x2d9: 0x40, 0x2da: 0x41, 0x2db: 0xe9, 0x2dc: 0x42, 0x2dd: 0x43, 0x2de: 0x44, 0x2df: 0xea, + 0x2e0: 0xeb, 0x2e1: 0xec, 0x2e2: 0xed, 0x2e3: 0xee, 0x2e4: 0xef, 0x2e5: 0xf0, 0x2e6: 0xf1, 0x2e7: 0xf2, + 0x2e8: 0xf3, 0x2e9: 0xf4, 0x2ea: 0xf5, 0x2eb: 0xf6, 0x2ec: 0xf7, 0x2ed: 0xf8, 0x2ee: 0xf9, 0x2ef: 0xfa, 0x2f0: 0xa0, 0x2f1: 0xa0, 0x2f2: 0xa0, 0x2f3: 0xa0, 0x2f4: 0xa0, 0x2f5: 0xa0, 0x2f6: 0xa0, 0x2f7: 0xa0, 0x2f8: 0xa0, 0x2f9: 0xa0, 0x2fa: 0xa0, 0x2fb: 0xa0, 0x2fc: 0xa0, 0x2fd: 0xa0, 0x2fe: 0xa0, 0x2ff: 0xa0, // Block 0xc, offset 0x300 0x300: 0xa0, 0x301: 0xa0, 0x302: 0xa0, 0x303: 0xa0, 0x304: 0xa0, 0x305: 0xa0, 0x306: 0xa0, 0x307: 0xa0, 0x308: 0xa0, 0x309: 0xa0, 0x30a: 0xa0, 0x30b: 0xa0, 0x30c: 0xa0, 0x30d: 0xa0, 0x30e: 0xa0, 0x30f: 0xa0, 0x310: 0xa0, 0x311: 0xa0, 0x312: 0xa0, 0x313: 0xa0, 0x314: 0xa0, 0x315: 0xa0, 0x316: 0xa0, 0x317: 0xa0, - 0x318: 0xa0, 0x319: 0xa0, 0x31a: 0xa0, 0x31b: 0xa0, 0x31c: 0xa0, 0x31d: 0xa0, 0x31e: 0xf9, 0x31f: 0xfa, + 0x318: 0xa0, 0x319: 0xa0, 0x31a: 0xa0, 0x31b: 0xa0, 0x31c: 0xa0, 0x31d: 0xa0, 0x31e: 0xfb, 0x31f: 0xfc, // Block 0xd, offset 0x340 - 0x340: 0xfb, 0x341: 0xfb, 0x342: 0xfb, 0x343: 0xfb, 0x344: 0xfb, 0x345: 0xfb, 0x346: 0xfb, 0x347: 0xfb, - 0x348: 0xfb, 0x349: 0xfb, 0x34a: 0xfb, 0x34b: 0xfb, 0x34c: 0xfb, 0x34d: 0xfb, 0x34e: 0xfb, 0x34f: 0xfb, - 0x350: 0xfb, 0x351: 0xfb, 0x352: 0xfb, 0x353: 0xfb, 0x354: 0xfb, 0x355: 0xfb, 0x356: 0xfb, 0x357: 0xfb, - 0x358: 0xfb, 0x359: 0xfb, 0x35a: 0xfb, 0x35b: 0xfb, 0x35c: 0xfb, 0x35d: 0xfb, 0x35e: 0xfb, 0x35f: 0xfb, - 0x360: 0xfb, 0x361: 0xfb, 0x362: 0xfb, 0x363: 0xfb, 0x364: 0xfb, 0x365: 0xfb, 0x366: 0xfb, 0x367: 0xfb, - 0x368: 0xfb, 0x369: 0xfb, 0x36a: 0xfb, 0x36b: 0xfb, 0x36c: 0xfb, 0x36d: 0xfb, 0x36e: 0xfb, 0x36f: 0xfb, - 0x370: 0xfb, 0x371: 0xfb, 0x372: 0xfb, 0x373: 0xfb, 0x374: 0xfb, 0x375: 0xfb, 0x376: 0xfb, 0x377: 0xfb, - 0x378: 0xfb, 0x379: 0xfb, 0x37a: 0xfb, 0x37b: 0xfb, 0x37c: 0xfb, 0x37d: 0xfb, 0x37e: 0xfb, 0x37f: 0xfb, + 0x340: 0xfd, 0x341: 0xfd, 0x342: 0xfd, 0x343: 0xfd, 0x344: 0xfd, 0x345: 0xfd, 0x346: 0xfd, 0x347: 0xfd, + 0x348: 0xfd, 0x349: 0xfd, 0x34a: 0xfd, 0x34b: 0xfd, 0x34c: 0xfd, 0x34d: 0xfd, 0x34e: 0xfd, 0x34f: 0xfd, + 0x350: 0xfd, 0x351: 0xfd, 0x352: 0xfd, 0x353: 0xfd, 0x354: 0xfd, 0x355: 0xfd, 0x356: 0xfd, 0x357: 0xfd, + 0x358: 0xfd, 0x359: 0xfd, 0x35a: 0xfd, 0x35b: 0xfd, 0x35c: 0xfd, 0x35d: 0xfd, 0x35e: 0xfd, 0x35f: 0xfd, + 0x360: 0xfd, 0x361: 0xfd, 0x362: 0xfd, 0x363: 0xfd, 0x364: 0xfd, 0x365: 0xfd, 0x366: 0xfd, 0x367: 0xfd, + 0x368: 0xfd, 0x369: 0xfd, 0x36a: 0xfd, 0x36b: 0xfd, 0x36c: 0xfd, 0x36d: 0xfd, 0x36e: 0xfd, 0x36f: 0xfd, + 0x370: 0xfd, 0x371: 0xfd, 0x372: 0xfd, 0x373: 0xfd, 0x374: 0xfd, 0x375: 0xfd, 0x376: 0xfd, 0x377: 0xfd, + 0x378: 0xfd, 0x379: 0xfd, 0x37a: 0xfd, 0x37b: 0xfd, 0x37c: 0xfd, 0x37d: 0xfd, 0x37e: 0xfd, 0x37f: 0xfd, // Block 0xe, offset 0x380 - 0x380: 0xfb, 0x381: 0xfb, 0x382: 0xfb, 0x383: 0xfb, 0x384: 0xfb, 0x385: 0xfb, 0x386: 0xfb, 0x387: 0xfb, - 0x388: 0xfb, 0x389: 0xfb, 0x38a: 0xfb, 0x38b: 0xfb, 0x38c: 0xfb, 0x38d: 0xfb, 0x38e: 0xfb, 0x38f: 0xfb, - 0x390: 0xfb, 0x391: 0xfb, 0x392: 0xfb, 0x393: 0xfb, 0x394: 0xfb, 0x395: 0xfb, 0x396: 0xfb, 0x397: 0xfb, - 0x398: 0xfb, 0x399: 0xfb, 0x39a: 0xfb, 0x39b: 0xfb, 0x39c: 0xfb, 0x39d: 0xfb, 0x39e: 0xfb, 0x39f: 0xfb, - 0x3a0: 0xfb, 0x3a1: 0xfb, 0x3a2: 0xfb, 0x3a3: 0xfb, 0x3a4: 0xfc, 0x3a5: 0xfd, 0x3a6: 0xfe, 0x3a7: 0xff, - 0x3a8: 0x47, 0x3a9: 0x100, 0x3aa: 0x101, 0x3ab: 0x48, 0x3ac: 0x49, 0x3ad: 0x4a, 0x3ae: 0x4b, 0x3af: 0x4c, - 0x3b0: 0x102, 0x3b1: 0x4d, 0x3b2: 0x4e, 0x3b3: 0x4f, 0x3b4: 0x50, 0x3b5: 0x51, 0x3b6: 0x103, 0x3b7: 0x52, - 0x3b8: 0x53, 0x3b9: 0x54, 0x3ba: 0x55, 0x3bb: 0x56, 0x3bc: 0x57, 0x3bd: 0x58, 0x3be: 0x59, 0x3bf: 0x5a, + 0x380: 0xfd, 0x381: 0xfd, 0x382: 0xfd, 0x383: 0xfd, 0x384: 0xfd, 0x385: 0xfd, 0x386: 0xfd, 0x387: 0xfd, + 0x388: 0xfd, 0x389: 0xfd, 0x38a: 0xfd, 0x38b: 0xfd, 0x38c: 0xfd, 0x38d: 0xfd, 0x38e: 0xfd, 0x38f: 0xfd, + 0x390: 0xfd, 0x391: 0xfd, 0x392: 0xfd, 0x393: 0xfd, 0x394: 0xfd, 0x395: 0xfd, 0x396: 0xfd, 0x397: 0xfd, + 0x398: 0xfd, 0x399: 0xfd, 0x39a: 0xfd, 0x39b: 0xfd, 0x39c: 0xfd, 0x39d: 0xfd, 0x39e: 0xfd, 0x39f: 0xfd, + 0x3a0: 0xfd, 0x3a1: 0xfd, 0x3a2: 0xfd, 0x3a3: 0xfd, 0x3a4: 0xfe, 0x3a5: 0xff, 0x3a6: 0x100, 0x3a7: 0x101, + 0x3a8: 0x45, 0x3a9: 0x102, 0x3aa: 0x103, 0x3ab: 0x46, 0x3ac: 0x47, 0x3ad: 0x48, 0x3ae: 0x49, 0x3af: 0x4a, + 0x3b0: 0x104, 0x3b1: 0x4b, 0x3b2: 0x4c, 0x3b3: 0x4d, 0x3b4: 0x4e, 0x3b5: 0x4f, 0x3b6: 0x105, 0x3b7: 0x50, + 0x3b8: 0x51, 0x3b9: 0x52, 0x3ba: 0x53, 0x3bb: 0x54, 0x3bc: 0x55, 0x3bd: 0x56, 0x3be: 0x57, 0x3bf: 0x58, // Block 0xf, offset 0x3c0 - 0x3c0: 0x104, 0x3c1: 0x105, 0x3c2: 0xa0, 0x3c3: 0x106, 0x3c4: 0x107, 0x3c5: 0x9c, 0x3c6: 0x108, 0x3c7: 0x109, - 0x3c8: 0xfb, 0x3c9: 0xfb, 0x3ca: 0x10a, 0x3cb: 0x10b, 0x3cc: 0x10c, 0x3cd: 0x10d, 0x3ce: 0x10e, 0x3cf: 0x10f, - 0x3d0: 0x110, 0x3d1: 0xa0, 0x3d2: 0x111, 0x3d3: 0x112, 0x3d4: 0x113, 0x3d5: 0x114, 0x3d6: 0xfb, 0x3d7: 0xfb, - 0x3d8: 0xa0, 0x3d9: 0xa0, 0x3da: 0xa0, 0x3db: 0xa0, 0x3dc: 0x115, 0x3dd: 0x116, 0x3de: 0xfb, 0x3df: 0xfb, - 0x3e0: 0x117, 0x3e1: 0x118, 0x3e2: 0x119, 0x3e3: 0x11a, 0x3e4: 0x11b, 0x3e5: 0xfb, 0x3e6: 0x11c, 0x3e7: 0x11d, - 0x3e8: 0x11e, 0x3e9: 0x11f, 0x3ea: 0x120, 0x3eb: 0x5b, 0x3ec: 0x121, 0x3ed: 0x122, 0x3ee: 0x5c, 0x3ef: 0xfb, - 0x3f0: 0x123, 0x3f1: 0x124, 0x3f2: 0x125, 0x3f3: 0x126, 0x3f4: 0x127, 0x3f5: 0xfb, 0x3f6: 0xfb, 0x3f7: 0xfb, - 0x3f8: 0xfb, 0x3f9: 0x128, 0x3fa: 0x129, 0x3fb: 0xfb, 0x3fc: 0x12a, 0x3fd: 0x12b, 0x3fe: 0x12c, 0x3ff: 0x12d, + 0x3c0: 0x106, 0x3c1: 0x107, 0x3c2: 0xa0, 0x3c3: 0x108, 0x3c4: 0x109, 0x3c5: 0x9c, 0x3c6: 0x10a, 0x3c7: 0x10b, + 0x3c8: 0xfd, 0x3c9: 0xfd, 0x3ca: 0x10c, 0x3cb: 0x10d, 0x3cc: 0x10e, 0x3cd: 0x10f, 0x3ce: 0x110, 0x3cf: 0x111, + 0x3d0: 0x112, 0x3d1: 0xa0, 0x3d2: 0x113, 0x3d3: 0x114, 0x3d4: 0x115, 0x3d5: 0x116, 0x3d6: 0xfd, 0x3d7: 0xfd, + 0x3d8: 0xa0, 0x3d9: 0xa0, 0x3da: 0xa0, 0x3db: 0xa0, 0x3dc: 0x117, 0x3dd: 0x118, 0x3de: 0xfd, 0x3df: 0xfd, + 0x3e0: 0x119, 0x3e1: 0x11a, 0x3e2: 0x11b, 0x3e3: 0x11c, 0x3e4: 0x11d, 0x3e5: 0xfd, 0x3e6: 0x11e, 0x3e7: 0x11f, + 0x3e8: 0x120, 0x3e9: 0x121, 0x3ea: 0x122, 0x3eb: 0x59, 0x3ec: 0x123, 0x3ed: 0x124, 0x3ee: 0x5a, 0x3ef: 0xfd, + 0x3f0: 0x125, 0x3f1: 0x126, 0x3f2: 0x127, 0x3f3: 0x128, 0x3f4: 0x129, 0x3f5: 0xfd, 0x3f6: 0xfd, 0x3f7: 0xfd, + 0x3f8: 0xfd, 0x3f9: 0x12a, 0x3fa: 0x12b, 0x3fb: 0xfd, 0x3fc: 0x12c, 0x3fd: 0x12d, 0x3fe: 0x12e, 0x3ff: 0x12f, // Block 0x10, offset 0x400 - 0x400: 0x12e, 0x401: 0x12f, 0x402: 0x130, 0x403: 0x131, 0x404: 0x132, 0x405: 0x133, 0x406: 0x134, 0x407: 0x135, - 0x408: 0x136, 0x409: 0xfb, 0x40a: 0x137, 0x40b: 0x138, 0x40c: 0x5d, 0x40d: 0x5e, 0x40e: 0xfb, 0x40f: 0xfb, - 0x410: 0x139, 0x411: 0x13a, 0x412: 0x13b, 0x413: 0x13c, 0x414: 0xfb, 0x415: 0xfb, 0x416: 0x13d, 0x417: 0x13e, - 0x418: 0x13f, 0x419: 0x140, 0x41a: 0x141, 0x41b: 0x142, 0x41c: 0x143, 0x41d: 0xfb, 0x41e: 0xfb, 0x41f: 0xfb, - 0x420: 0x144, 0x421: 0xfb, 0x422: 0x145, 0x423: 0x146, 0x424: 0x5f, 0x425: 0x147, 0x426: 0x148, 0x427: 0x149, - 0x428: 0x14a, 0x429: 0x14b, 0x42a: 0x14c, 0x42b: 0x14d, 0x42c: 0xfb, 0x42d: 0xfb, 0x42e: 0xfb, 0x42f: 0xfb, - 0x430: 0x14e, 0x431: 0x14f, 0x432: 0x150, 0x433: 0xfb, 0x434: 0x151, 0x435: 0x152, 0x436: 0x153, 0x437: 0xfb, - 0x438: 0xfb, 0x439: 0xfb, 0x43a: 0xfb, 0x43b: 0x154, 0x43c: 0xfb, 0x43d: 0xfb, 0x43e: 0x155, 0x43f: 0x156, + 0x400: 0x130, 0x401: 0x131, 0x402: 0x132, 0x403: 0x133, 0x404: 0x134, 0x405: 0x135, 0x406: 0x136, 0x407: 0x137, + 0x408: 0x138, 0x409: 0xfd, 0x40a: 0x139, 0x40b: 0x13a, 0x40c: 0x5b, 0x40d: 0x5c, 0x40e: 0xfd, 0x40f: 0xfd, + 0x410: 0x13b, 0x411: 0x13c, 0x412: 0x13d, 0x413: 0x13e, 0x414: 0xfd, 0x415: 0xfd, 0x416: 0x13f, 0x417: 0x140, + 0x418: 0x141, 0x419: 0x142, 0x41a: 0x143, 0x41b: 0x144, 0x41c: 0x145, 0x41d: 0xfd, 0x41e: 0xfd, 0x41f: 0xfd, + 0x420: 0x146, 0x421: 0xfd, 0x422: 0x147, 0x423: 0x148, 0x424: 0x5d, 0x425: 0x149, 0x426: 0x14a, 0x427: 0x14b, + 0x428: 0x14c, 0x429: 0x14d, 0x42a: 0x14e, 0x42b: 0x14f, 0x42c: 0xfd, 0x42d: 0xfd, 0x42e: 0xfd, 0x42f: 0xfd, + 0x430: 0x150, 0x431: 0x151, 0x432: 0x152, 0x433: 0xfd, 0x434: 0x153, 0x435: 0x154, 0x436: 0x155, 0x437: 0xfd, + 0x438: 0xfd, 0x439: 0xfd, 0x43a: 0xfd, 0x43b: 0x156, 0x43c: 0xfd, 0x43d: 0xfd, 0x43e: 0x157, 0x43f: 0x158, // Block 0x11, offset 0x440 0x440: 0xa0, 0x441: 0xa0, 0x442: 0xa0, 0x443: 0xa0, 0x444: 0xa0, 0x445: 0xa0, 0x446: 0xa0, 0x447: 0xa0, - 0x448: 0xa0, 0x449: 0xa0, 0x44a: 0xa0, 0x44b: 0xa0, 0x44c: 0xa0, 0x44d: 0xa0, 0x44e: 0x157, 0x44f: 0xfb, - 0x450: 0x9c, 0x451: 0x158, 0x452: 0xa0, 0x453: 0xa0, 0x454: 0xa0, 0x455: 0x159, 0x456: 0xfb, 0x457: 0xfb, - 0x458: 0xfb, 0x459: 0xfb, 0x45a: 0xfb, 0x45b: 0xfb, 0x45c: 0xfb, 0x45d: 0xfb, 0x45e: 0xfb, 0x45f: 0xfb, - 0x460: 0xfb, 0x461: 0xfb, 0x462: 0xfb, 0x463: 0xfb, 0x464: 0xfb, 0x465: 0xfb, 0x466: 0xfb, 0x467: 0xfb, - 0x468: 0xfb, 0x469: 0xfb, 0x46a: 0xfb, 0x46b: 0xfb, 0x46c: 0xfb, 0x46d: 0xfb, 0x46e: 0xfb, 0x46f: 0xfb, - 0x470: 0xfb, 0x471: 0xfb, 0x472: 0xfb, 0x473: 0xfb, 0x474: 0xfb, 0x475: 0xfb, 0x476: 0xfb, 0x477: 0xfb, - 0x478: 0xfb, 0x479: 0xfb, 0x47a: 0xfb, 0x47b: 0xfb, 0x47c: 0xfb, 0x47d: 0xfb, 0x47e: 0xfb, 0x47f: 0xfb, + 0x448: 0xa0, 0x449: 0xa0, 0x44a: 0xa0, 0x44b: 0xa0, 0x44c: 0xa0, 0x44d: 0xa0, 0x44e: 0x159, 0x44f: 0xfd, + 0x450: 0x9c, 0x451: 0x15a, 0x452: 0xa0, 0x453: 0xa0, 0x454: 0xa0, 0x455: 0x15b, 0x456: 0xfd, 0x457: 0xfd, + 0x458: 0xfd, 0x459: 0xfd, 0x45a: 0xfd, 0x45b: 0xfd, 0x45c: 0xfd, 0x45d: 0xfd, 0x45e: 0xfd, 0x45f: 0xfd, + 0x460: 0xfd, 0x461: 0xfd, 0x462: 0xfd, 0x463: 0xfd, 0x464: 0xfd, 0x465: 0xfd, 0x466: 0xfd, 0x467: 0xfd, + 0x468: 0xfd, 0x469: 0xfd, 0x46a: 0xfd, 0x46b: 0xfd, 0x46c: 0xfd, 0x46d: 0xfd, 0x46e: 0xfd, 0x46f: 0xfd, + 0x470: 0xfd, 0x471: 0xfd, 0x472: 0xfd, 0x473: 0xfd, 0x474: 0xfd, 0x475: 0xfd, 0x476: 0xfd, 0x477: 0xfd, + 0x478: 0xfd, 0x479: 0xfd, 0x47a: 0xfd, 0x47b: 0xfd, 0x47c: 0xfd, 0x47d: 0xfd, 0x47e: 0xfd, 0x47f: 0xfd, // Block 0x12, offset 0x480 0x480: 0xa0, 0x481: 0xa0, 0x482: 0xa0, 0x483: 0xa0, 0x484: 0xa0, 0x485: 0xa0, 0x486: 0xa0, 0x487: 0xa0, 0x488: 0xa0, 0x489: 0xa0, 0x48a: 0xa0, 0x48b: 0xa0, 0x48c: 0xa0, 0x48d: 0xa0, 0x48e: 0xa0, 0x48f: 0xa0, - 0x490: 0x15a, 0x491: 0xfb, 0x492: 0xfb, 0x493: 0xfb, 0x494: 0xfb, 0x495: 0xfb, 0x496: 0xfb, 0x497: 0xfb, - 0x498: 0xfb, 0x499: 0xfb, 0x49a: 0xfb, 0x49b: 0xfb, 0x49c: 0xfb, 0x49d: 0xfb, 0x49e: 0xfb, 0x49f: 0xfb, - 0x4a0: 0xfb, 0x4a1: 0xfb, 0x4a2: 0xfb, 0x4a3: 0xfb, 0x4a4: 0xfb, 0x4a5: 0xfb, 0x4a6: 0xfb, 0x4a7: 0xfb, - 0x4a8: 0xfb, 0x4a9: 0xfb, 0x4aa: 0xfb, 0x4ab: 0xfb, 0x4ac: 0xfb, 0x4ad: 0xfb, 0x4ae: 0xfb, 0x4af: 0xfb, - 0x4b0: 0xfb, 0x4b1: 0xfb, 0x4b2: 0xfb, 0x4b3: 0xfb, 0x4b4: 0xfb, 0x4b5: 0xfb, 0x4b6: 0xfb, 0x4b7: 0xfb, - 0x4b8: 0xfb, 0x4b9: 0xfb, 0x4ba: 0xfb, 0x4bb: 0xfb, 0x4bc: 0xfb, 0x4bd: 0xfb, 0x4be: 0xfb, 0x4bf: 0xfb, + 0x490: 0x15c, 0x491: 0xfd, 0x492: 0xfd, 0x493: 0xfd, 0x494: 0xfd, 0x495: 0xfd, 0x496: 0xfd, 0x497: 0xfd, + 0x498: 0xfd, 0x499: 0xfd, 0x49a: 0xfd, 0x49b: 0xfd, 0x49c: 0xfd, 0x49d: 0xfd, 0x49e: 0xfd, 0x49f: 0xfd, + 0x4a0: 0xfd, 0x4a1: 0xfd, 0x4a2: 0xfd, 0x4a3: 0xfd, 0x4a4: 0xfd, 0x4a5: 0xfd, 0x4a6: 0xfd, 0x4a7: 0xfd, + 0x4a8: 0xfd, 0x4a9: 0xfd, 0x4aa: 0xfd, 0x4ab: 0xfd, 0x4ac: 0xfd, 0x4ad: 0xfd, 0x4ae: 0xfd, 0x4af: 0xfd, + 0x4b0: 0xfd, 0x4b1: 0xfd, 0x4b2: 0xfd, 0x4b3: 0xfd, 0x4b4: 0xfd, 0x4b5: 0xfd, 0x4b6: 0xfd, 0x4b7: 0xfd, + 0x4b8: 0xfd, 0x4b9: 0xfd, 0x4ba: 0xfd, 0x4bb: 0xfd, 0x4bc: 0xfd, 0x4bd: 0xfd, 0x4be: 0xfd, 0x4bf: 0xfd, // Block 0x13, offset 0x4c0 - 0x4c0: 0xfb, 0x4c1: 0xfb, 0x4c2: 0xfb, 0x4c3: 0xfb, 0x4c4: 0xfb, 0x4c5: 0xfb, 0x4c6: 0xfb, 0x4c7: 0xfb, - 0x4c8: 0xfb, 0x4c9: 0xfb, 0x4ca: 0xfb, 0x4cb: 0xfb, 0x4cc: 0xfb, 0x4cd: 0xfb, 0x4ce: 0xfb, 0x4cf: 0xfb, + 0x4c0: 0xfd, 0x4c1: 0xfd, 0x4c2: 0xfd, 0x4c3: 0xfd, 0x4c4: 0xfd, 0x4c5: 0xfd, 0x4c6: 0xfd, 0x4c7: 0xfd, + 0x4c8: 0xfd, 0x4c9: 0xfd, 0x4ca: 0xfd, 0x4cb: 0xfd, 0x4cc: 0xfd, 0x4cd: 0xfd, 0x4ce: 0xfd, 0x4cf: 0xfd, 0x4d0: 0xa0, 0x4d1: 0xa0, 0x4d2: 0xa0, 0x4d3: 0xa0, 0x4d4: 0xa0, 0x4d5: 0xa0, 0x4d6: 0xa0, 0x4d7: 0xa0, - 0x4d8: 0xa0, 0x4d9: 0x15b, 0x4da: 0xfb, 0x4db: 0xfb, 0x4dc: 0xfb, 0x4dd: 0xfb, 0x4de: 0xfb, 0x4df: 0xfb, - 0x4e0: 0xfb, 0x4e1: 0xfb, 0x4e2: 0xfb, 0x4e3: 0xfb, 0x4e4: 0xfb, 0x4e5: 0xfb, 0x4e6: 0xfb, 0x4e7: 0xfb, - 0x4e8: 0xfb, 0x4e9: 0xfb, 0x4ea: 0xfb, 0x4eb: 0xfb, 0x4ec: 0xfb, 0x4ed: 0xfb, 0x4ee: 0xfb, 0x4ef: 0xfb, - 0x4f0: 0xfb, 0x4f1: 0xfb, 0x4f2: 0xfb, 0x4f3: 0xfb, 0x4f4: 0xfb, 0x4f5: 0xfb, 0x4f6: 0xfb, 0x4f7: 0xfb, - 0x4f8: 0xfb, 0x4f9: 0xfb, 0x4fa: 0xfb, 0x4fb: 0xfb, 0x4fc: 0xfb, 0x4fd: 0xfb, 0x4fe: 0xfb, 0x4ff: 0xfb, + 0x4d8: 0xa0, 0x4d9: 0x15d, 0x4da: 0xfd, 0x4db: 0xfd, 0x4dc: 0xfd, 0x4dd: 0xfd, 0x4de: 0xfd, 0x4df: 0xfd, + 0x4e0: 0xfd, 0x4e1: 0xfd, 0x4e2: 0xfd, 0x4e3: 0xfd, 0x4e4: 0xfd, 0x4e5: 0xfd, 0x4e6: 0xfd, 0x4e7: 0xfd, + 0x4e8: 0xfd, 0x4e9: 0xfd, 0x4ea: 0xfd, 0x4eb: 0xfd, 0x4ec: 0xfd, 0x4ed: 0xfd, 0x4ee: 0xfd, 0x4ef: 0xfd, + 0x4f0: 0xfd, 0x4f1: 0xfd, 0x4f2: 0xfd, 0x4f3: 0xfd, 0x4f4: 0xfd, 0x4f5: 0xfd, 0x4f6: 0xfd, 0x4f7: 0xfd, + 0x4f8: 0xfd, 0x4f9: 0xfd, 0x4fa: 0xfd, 0x4fb: 0xfd, 0x4fc: 0xfd, 0x4fd: 0xfd, 0x4fe: 0xfd, 0x4ff: 0xfd, // Block 0x14, offset 0x500 - 0x500: 0xfb, 0x501: 0xfb, 0x502: 0xfb, 0x503: 0xfb, 0x504: 0xfb, 0x505: 0xfb, 0x506: 0xfb, 0x507: 0xfb, - 0x508: 0xfb, 0x509: 0xfb, 0x50a: 0xfb, 0x50b: 0xfb, 0x50c: 0xfb, 0x50d: 0xfb, 0x50e: 0xfb, 0x50f: 0xfb, - 0x510: 0xfb, 0x511: 0xfb, 0x512: 0xfb, 0x513: 0xfb, 0x514: 0xfb, 0x515: 0xfb, 0x516: 0xfb, 0x517: 0xfb, - 0x518: 0xfb, 0x519: 0xfb, 0x51a: 0xfb, 0x51b: 0xfb, 0x51c: 0xfb, 0x51d: 0xfb, 0x51e: 0xfb, 0x51f: 0xfb, + 0x500: 0xfd, 0x501: 0xfd, 0x502: 0xfd, 0x503: 0xfd, 0x504: 0xfd, 0x505: 0xfd, 0x506: 0xfd, 0x507: 0xfd, + 0x508: 0xfd, 0x509: 0xfd, 0x50a: 0xfd, 0x50b: 0xfd, 0x50c: 0xfd, 0x50d: 0xfd, 0x50e: 0xfd, 0x50f: 0xfd, + 0x510: 0xfd, 0x511: 0xfd, 0x512: 0xfd, 0x513: 0xfd, 0x514: 0xfd, 0x515: 0xfd, 0x516: 0xfd, 0x517: 0xfd, + 0x518: 0xfd, 0x519: 0xfd, 0x51a: 0xfd, 0x51b: 0xfd, 0x51c: 0xfd, 0x51d: 0xfd, 0x51e: 0xfd, 0x51f: 0xfd, 0x520: 0xa0, 0x521: 0xa0, 0x522: 0xa0, 0x523: 0xa0, 0x524: 0xa0, 0x525: 0xa0, 0x526: 0xa0, 0x527: 0xa0, - 0x528: 0x14d, 0x529: 0x15c, 0x52a: 0xfb, 0x52b: 0x15d, 0x52c: 0x15e, 0x52d: 0x15f, 0x52e: 0x160, 0x52f: 0xfb, - 0x530: 0xfb, 0x531: 0xfb, 0x532: 0xfb, 0x533: 0xfb, 0x534: 0xfb, 0x535: 0xfb, 0x536: 0xfb, 0x537: 0xfb, - 0x538: 0xfb, 0x539: 0x161, 0x53a: 0x162, 0x53b: 0xfb, 0x53c: 0xa0, 0x53d: 0x163, 0x53e: 0x164, 0x53f: 0x165, + 0x528: 0x14f, 0x529: 0x15e, 0x52a: 0xfd, 0x52b: 0x15f, 0x52c: 0x160, 0x52d: 0x161, 0x52e: 0x162, 0x52f: 0xfd, + 0x530: 0xfd, 0x531: 0xfd, 0x532: 0xfd, 0x533: 0xfd, 0x534: 0xfd, 0x535: 0xfd, 0x536: 0xfd, 0x537: 0xfd, + 0x538: 0xfd, 0x539: 0x163, 0x53a: 0x164, 0x53b: 0xfd, 0x53c: 0xa0, 0x53d: 0x165, 0x53e: 0x166, 0x53f: 0x167, // Block 0x15, offset 0x540 0x540: 0xa0, 0x541: 0xa0, 0x542: 0xa0, 0x543: 0xa0, 0x544: 0xa0, 0x545: 0xa0, 0x546: 0xa0, 0x547: 0xa0, 0x548: 0xa0, 0x549: 0xa0, 0x54a: 0xa0, 0x54b: 0xa0, 0x54c: 0xa0, 0x54d: 0xa0, 0x54e: 0xa0, 0x54f: 0xa0, 0x550: 0xa0, 0x551: 0xa0, 0x552: 0xa0, 0x553: 0xa0, 0x554: 0xa0, 0x555: 0xa0, 0x556: 0xa0, 0x557: 0xa0, - 0x558: 0xa0, 0x559: 0xa0, 0x55a: 0xa0, 0x55b: 0xa0, 0x55c: 0xa0, 0x55d: 0xa0, 0x55e: 0xa0, 0x55f: 0x166, + 0x558: 0xa0, 0x559: 0xa0, 0x55a: 0xa0, 0x55b: 0xa0, 0x55c: 0xa0, 0x55d: 0xa0, 0x55e: 0xa0, 0x55f: 0x168, 0x560: 0xa0, 0x561: 0xa0, 0x562: 0xa0, 0x563: 0xa0, 0x564: 0xa0, 0x565: 0xa0, 0x566: 0xa0, 0x567: 0xa0, 0x568: 0xa0, 0x569: 0xa0, 0x56a: 0xa0, 0x56b: 0xa0, 0x56c: 0xa0, 0x56d: 0xa0, 0x56e: 0xa0, 0x56f: 0xa0, - 0x570: 0xa0, 0x571: 0xa0, 0x572: 0xa0, 0x573: 0x167, 0x574: 0x168, 0x575: 0xfb, 0x576: 0xfb, 0x577: 0xfb, - 0x578: 0xfb, 0x579: 0xfb, 0x57a: 0xfb, 0x57b: 0xfb, 0x57c: 0xfb, 0x57d: 0xfb, 0x57e: 0xfb, 0x57f: 0xfb, + 0x570: 0xa0, 0x571: 0xa0, 0x572: 0xa0, 0x573: 0x169, 0x574: 0x16a, 0x575: 0xfd, 0x576: 0xfd, 0x577: 0xfd, + 0x578: 0xfd, 0x579: 0xfd, 0x57a: 0xfd, 0x57b: 0xfd, 0x57c: 0xfd, 0x57d: 0xfd, 0x57e: 0xfd, 0x57f: 0xfd, // Block 0x16, offset 0x580 - 0x580: 0xa0, 0x581: 0xa0, 0x582: 0xa0, 0x583: 0xa0, 0x584: 0x169, 0x585: 0x16a, 0x586: 0xa0, 0x587: 0xa0, - 0x588: 0xa0, 0x589: 0xa0, 0x58a: 0xa0, 0x58b: 0x16b, 0x58c: 0xfb, 0x58d: 0xfb, 0x58e: 0xfb, 0x58f: 0xfb, - 0x590: 0xfb, 0x591: 0xfb, 0x592: 0xfb, 0x593: 0xfb, 0x594: 0xfb, 0x595: 0xfb, 0x596: 0xfb, 0x597: 0xfb, - 0x598: 0xfb, 0x599: 0xfb, 0x59a: 0xfb, 0x59b: 0xfb, 0x59c: 0xfb, 0x59d: 0xfb, 0x59e: 0xfb, 0x59f: 0xfb, - 0x5a0: 0xfb, 0x5a1: 0xfb, 0x5a2: 0xfb, 0x5a3: 0xfb, 0x5a4: 0xfb, 0x5a5: 0xfb, 0x5a6: 0xfb, 0x5a7: 0xfb, - 0x5a8: 0xfb, 0x5a9: 0xfb, 0x5aa: 0xfb, 0x5ab: 0xfb, 0x5ac: 0xfb, 0x5ad: 0xfb, 0x5ae: 0xfb, 0x5af: 0xfb, - 0x5b0: 0xa0, 0x5b1: 0x16c, 0x5b2: 0x16d, 0x5b3: 0xfb, 0x5b4: 0xfb, 0x5b5: 0xfb, 0x5b6: 0xfb, 0x5b7: 0xfb, - 0x5b8: 0xfb, 0x5b9: 0xfb, 0x5ba: 0xfb, 0x5bb: 0xfb, 0x5bc: 0xfb, 0x5bd: 0xfb, 0x5be: 0xfb, 0x5bf: 0xfb, + 0x580: 0xa0, 0x581: 0xa0, 0x582: 0xa0, 0x583: 0xa0, 0x584: 0x16b, 0x585: 0x16c, 0x586: 0xa0, 0x587: 0xa0, + 0x588: 0xa0, 0x589: 0xa0, 0x58a: 0xa0, 0x58b: 0x16d, 0x58c: 0xfd, 0x58d: 0xfd, 0x58e: 0xfd, 0x58f: 0xfd, + 0x590: 0xfd, 0x591: 0xfd, 0x592: 0xfd, 0x593: 0xfd, 0x594: 0xfd, 0x595: 0xfd, 0x596: 0xfd, 0x597: 0xfd, + 0x598: 0xfd, 0x599: 0xfd, 0x59a: 0xfd, 0x59b: 0xfd, 0x59c: 0xfd, 0x59d: 0xfd, 0x59e: 0xfd, 0x59f: 0xfd, + 0x5a0: 0xfd, 0x5a1: 0xfd, 0x5a2: 0xfd, 0x5a3: 0xfd, 0x5a4: 0xfd, 0x5a5: 0xfd, 0x5a6: 0xfd, 0x5a7: 0xfd, + 0x5a8: 0xfd, 0x5a9: 0xfd, 0x5aa: 0xfd, 0x5ab: 0xfd, 0x5ac: 0xfd, 0x5ad: 0xfd, 0x5ae: 0xfd, 0x5af: 0xfd, + 0x5b0: 0xa0, 0x5b1: 0x16e, 0x5b2: 0x16f, 0x5b3: 0xfd, 0x5b4: 0xfd, 0x5b5: 0xfd, 0x5b6: 0xfd, 0x5b7: 0xfd, + 0x5b8: 0xfd, 0x5b9: 0xfd, 0x5ba: 0xfd, 0x5bb: 0xfd, 0x5bc: 0xfd, 0x5bd: 0xfd, 0x5be: 0xfd, 0x5bf: 0xfd, // Block 0x17, offset 0x5c0 - 0x5c0: 0x9c, 0x5c1: 0x9c, 0x5c2: 0x9c, 0x5c3: 0x16e, 0x5c4: 0x16f, 0x5c5: 0x170, 0x5c6: 0x171, 0x5c7: 0x172, - 0x5c8: 0x9c, 0x5c9: 0x173, 0x5ca: 0xfb, 0x5cb: 0x174, 0x5cc: 0x9c, 0x5cd: 0x175, 0x5ce: 0xfb, 0x5cf: 0xfb, - 0x5d0: 0x60, 0x5d1: 0x61, 0x5d2: 0x62, 0x5d3: 0x63, 0x5d4: 0x64, 0x5d5: 0x65, 0x5d6: 0x66, 0x5d7: 0x67, - 0x5d8: 0x68, 0x5d9: 0x69, 0x5da: 0x6a, 0x5db: 0x6b, 0x5dc: 0x6c, 0x5dd: 0x6d, 0x5de: 0x6e, 0x5df: 0x6f, + 0x5c0: 0x9c, 0x5c1: 0x9c, 0x5c2: 0x9c, 0x5c3: 0x170, 0x5c4: 0x171, 0x5c5: 0x172, 0x5c6: 0x173, 0x5c7: 0x174, + 0x5c8: 0x9c, 0x5c9: 0x175, 0x5ca: 0xfd, 0x5cb: 0x176, 0x5cc: 0x9c, 0x5cd: 0x177, 0x5ce: 0xfd, 0x5cf: 0xfd, + 0x5d0: 0x5e, 0x5d1: 0x5f, 0x5d2: 0x60, 0x5d3: 0x61, 0x5d4: 0x62, 0x5d5: 0x63, 0x5d6: 0x64, 0x5d7: 0x65, + 0x5d8: 0x66, 0x5d9: 0x67, 0x5da: 0x68, 0x5db: 0x69, 0x5dc: 0x6a, 0x5dd: 0x6b, 0x5de: 0x6c, 0x5df: 0x6d, 0x5e0: 0x9c, 0x5e1: 0x9c, 0x5e2: 0x9c, 0x5e3: 0x9c, 0x5e4: 0x9c, 0x5e5: 0x9c, 0x5e6: 0x9c, 0x5e7: 0x9c, - 0x5e8: 0x176, 0x5e9: 0x177, 0x5ea: 0x178, 0x5eb: 0xfb, 0x5ec: 0xfb, 0x5ed: 0xfb, 0x5ee: 0xfb, 0x5ef: 0xfb, - 0x5f0: 0xfb, 0x5f1: 0xfb, 0x5f2: 0xfb, 0x5f3: 0xfb, 0x5f4: 0xfb, 0x5f5: 0xfb, 0x5f6: 0xfb, 0x5f7: 0xfb, - 0x5f8: 0xfb, 0x5f9: 0xfb, 0x5fa: 0xfb, 0x5fb: 0xfb, 0x5fc: 0xfb, 0x5fd: 0xfb, 0x5fe: 0xfb, 0x5ff: 0xfb, + 0x5e8: 0x178, 0x5e9: 0x179, 0x5ea: 0x17a, 0x5eb: 0xfd, 0x5ec: 0xfd, 0x5ed: 0xfd, 0x5ee: 0xfd, 0x5ef: 0xfd, + 0x5f0: 0xfd, 0x5f1: 0xfd, 0x5f2: 0xfd, 0x5f3: 0xfd, 0x5f4: 0xfd, 0x5f5: 0xfd, 0x5f6: 0xfd, 0x5f7: 0xfd, + 0x5f8: 0xfd, 0x5f9: 0xfd, 0x5fa: 0xfd, 0x5fb: 0xfd, 0x5fc: 0xfd, 0x5fd: 0xfd, 0x5fe: 0xfd, 0x5ff: 0xfd, // Block 0x18, offset 0x600 - 0x600: 0x179, 0x601: 0xfb, 0x602: 0xfb, 0x603: 0xfb, 0x604: 0x17a, 0x605: 0x17b, 0x606: 0xfb, 0x607: 0xfb, - 0x608: 0xfb, 0x609: 0xfb, 0x60a: 0xfb, 0x60b: 0x17c, 0x60c: 0xfb, 0x60d: 0xfb, 0x60e: 0xfb, 0x60f: 0xfb, - 0x610: 0xfb, 0x611: 0xfb, 0x612: 0xfb, 0x613: 0xfb, 0x614: 0xfb, 0x615: 0xfb, 0x616: 0xfb, 0x617: 0xfb, - 0x618: 0xfb, 0x619: 0xfb, 0x61a: 0xfb, 0x61b: 0xfb, 0x61c: 0xfb, 0x61d: 0xfb, 0x61e: 0xfb, 0x61f: 0xfb, - 0x620: 0x123, 0x621: 0x123, 0x622: 0x123, 0x623: 0x17d, 0x624: 0x70, 0x625: 0x17e, 0x626: 0xfb, 0x627: 0xfb, - 0x628: 0xfb, 0x629: 0xfb, 0x62a: 0xfb, 0x62b: 0xfb, 0x62c: 0xfb, 0x62d: 0xfb, 0x62e: 0xfb, 0x62f: 0xfb, - 0x630: 0xfb, 0x631: 0x17f, 0x632: 0x180, 0x633: 0xfb, 0x634: 0x181, 0x635: 0xfb, 0x636: 0xfb, 0x637: 0xfb, - 0x638: 0x71, 0x639: 0x72, 0x63a: 0x73, 0x63b: 0x182, 0x63c: 0xfb, 0x63d: 0xfb, 0x63e: 0xfb, 0x63f: 0xfb, + 0x600: 0x17b, 0x601: 0xfd, 0x602: 0xfd, 0x603: 0xfd, 0x604: 0x17c, 0x605: 0x17d, 0x606: 0xfd, 0x607: 0xfd, + 0x608: 0xfd, 0x609: 0xfd, 0x60a: 0xfd, 0x60b: 0x17e, 0x60c: 0xfd, 0x60d: 0xfd, 0x60e: 0xfd, 0x60f: 0xfd, + 0x610: 0xfd, 0x611: 0xfd, 0x612: 0xfd, 0x613: 0xfd, 0x614: 0xfd, 0x615: 0xfd, 0x616: 0xfd, 0x617: 0xfd, + 0x618: 0xfd, 0x619: 0xfd, 0x61a: 0xfd, 0x61b: 0xfd, 0x61c: 0xfd, 0x61d: 0xfd, 0x61e: 0xfd, 0x61f: 0xfd, + 0x620: 0x125, 0x621: 0x125, 0x622: 0x125, 0x623: 0x17f, 0x624: 0x6e, 0x625: 0x180, 0x626: 0xfd, 0x627: 0xfd, + 0x628: 0xfd, 0x629: 0xfd, 0x62a: 0xfd, 0x62b: 0xfd, 0x62c: 0xfd, 0x62d: 0xfd, 0x62e: 0xfd, 0x62f: 0xfd, + 0x630: 0xfd, 0x631: 0x181, 0x632: 0x182, 0x633: 0xfd, 0x634: 0x183, 0x635: 0xfd, 0x636: 0xfd, 0x637: 0xfd, + 0x638: 0x6f, 0x639: 0x70, 0x63a: 0x71, 0x63b: 0x184, 0x63c: 0xfd, 0x63d: 0xfd, 0x63e: 0xfd, 0x63f: 0xfd, // Block 0x19, offset 0x640 - 0x640: 0x183, 0x641: 0x9c, 0x642: 0x184, 0x643: 0x185, 0x644: 0x74, 0x645: 0x75, 0x646: 0x186, 0x647: 0x187, - 0x648: 0x76, 0x649: 0x188, 0x64a: 0xfb, 0x64b: 0xfb, 0x64c: 0x9c, 0x64d: 0x9c, 0x64e: 0x9c, 0x64f: 0x9c, + 0x640: 0x185, 0x641: 0x9c, 0x642: 0x186, 0x643: 0x187, 0x644: 0x72, 0x645: 0x73, 0x646: 0x188, 0x647: 0x189, + 0x648: 0x74, 0x649: 0x18a, 0x64a: 0xfd, 0x64b: 0xfd, 0x64c: 0x9c, 0x64d: 0x9c, 0x64e: 0x9c, 0x64f: 0x9c, 0x650: 0x9c, 0x651: 0x9c, 0x652: 0x9c, 0x653: 0x9c, 0x654: 0x9c, 0x655: 0x9c, 0x656: 0x9c, 0x657: 0x9c, - 0x658: 0x9c, 0x659: 0x9c, 0x65a: 0x9c, 0x65b: 0x189, 0x65c: 0x9c, 0x65d: 0x18a, 0x65e: 0x9c, 0x65f: 0x18b, - 0x660: 0x18c, 0x661: 0x18d, 0x662: 0x18e, 0x663: 0xfb, 0x664: 0x9c, 0x665: 0x18f, 0x666: 0x9c, 0x667: 0x190, - 0x668: 0x9c, 0x669: 0x191, 0x66a: 0x192, 0x66b: 0x193, 0x66c: 0x9c, 0x66d: 0x9c, 0x66e: 0x194, 0x66f: 0x195, - 0x670: 0xfb, 0x671: 0xfb, 0x672: 0xfb, 0x673: 0xfb, 0x674: 0xfb, 0x675: 0xfb, 0x676: 0xfb, 0x677: 0xfb, - 0x678: 0xfb, 0x679: 0xfb, 0x67a: 0xfb, 0x67b: 0xfb, 0x67c: 0xfb, 0x67d: 0xfb, 0x67e: 0xfb, 0x67f: 0xfb, + 0x658: 0x9c, 0x659: 0x9c, 0x65a: 0x9c, 0x65b: 0x18b, 0x65c: 0x9c, 0x65d: 0x18c, 0x65e: 0x9c, 0x65f: 0x18d, + 0x660: 0x18e, 0x661: 0x18f, 0x662: 0x190, 0x663: 0xfd, 0x664: 0x9c, 0x665: 0x191, 0x666: 0x9c, 0x667: 0x192, + 0x668: 0x9c, 0x669: 0x193, 0x66a: 0x194, 0x66b: 0x195, 0x66c: 0x9c, 0x66d: 0x9c, 0x66e: 0x196, 0x66f: 0x197, + 0x670: 0xfd, 0x671: 0xfd, 0x672: 0xfd, 0x673: 0xfd, 0x674: 0xfd, 0x675: 0xfd, 0x676: 0xfd, 0x677: 0xfd, + 0x678: 0xfd, 0x679: 0xfd, 0x67a: 0xfd, 0x67b: 0xfd, 0x67c: 0xfd, 0x67d: 0xfd, 0x67e: 0xfd, 0x67f: 0xfd, // Block 0x1a, offset 0x680 0x680: 0xa0, 0x681: 0xa0, 0x682: 0xa0, 0x683: 0xa0, 0x684: 0xa0, 0x685: 0xa0, 0x686: 0xa0, 0x687: 0xa0, 0x688: 0xa0, 0x689: 0xa0, 0x68a: 0xa0, 0x68b: 0xa0, 0x68c: 0xa0, 0x68d: 0xa0, 0x68e: 0xa0, 0x68f: 0xa0, 0x690: 0xa0, 0x691: 0xa0, 0x692: 0xa0, 0x693: 0xa0, 0x694: 0xa0, 0x695: 0xa0, 0x696: 0xa0, 0x697: 0xa0, - 0x698: 0xa0, 0x699: 0xa0, 0x69a: 0xa0, 0x69b: 0x196, 0x69c: 0xa0, 0x69d: 0xa0, 0x69e: 0xa0, 0x69f: 0xa0, + 0x698: 0xa0, 0x699: 0xa0, 0x69a: 0xa0, 0x69b: 0x198, 0x69c: 0xa0, 0x69d: 0xa0, 0x69e: 0xa0, 0x69f: 0xa0, 0x6a0: 0xa0, 0x6a1: 0xa0, 0x6a2: 0xa0, 0x6a3: 0xa0, 0x6a4: 0xa0, 0x6a5: 0xa0, 0x6a6: 0xa0, 0x6a7: 0xa0, 0x6a8: 0xa0, 0x6a9: 0xa0, 0x6aa: 0xa0, 0x6ab: 0xa0, 0x6ac: 0xa0, 0x6ad: 0xa0, 0x6ae: 0xa0, 0x6af: 0xa0, 0x6b0: 0xa0, 0x6b1: 0xa0, 0x6b2: 0xa0, 0x6b3: 0xa0, 0x6b4: 0xa0, 0x6b5: 0xa0, 0x6b6: 0xa0, 0x6b7: 0xa0, @@ -2312,8 +2455,8 @@ var idnaIndex = [2368]uint16{ 0x6c0: 0xa0, 0x6c1: 0xa0, 0x6c2: 0xa0, 0x6c3: 0xa0, 0x6c4: 0xa0, 0x6c5: 0xa0, 0x6c6: 0xa0, 0x6c7: 0xa0, 0x6c8: 0xa0, 0x6c9: 0xa0, 0x6ca: 0xa0, 0x6cb: 0xa0, 0x6cc: 0xa0, 0x6cd: 0xa0, 0x6ce: 0xa0, 0x6cf: 0xa0, 0x6d0: 0xa0, 0x6d1: 0xa0, 0x6d2: 0xa0, 0x6d3: 0xa0, 0x6d4: 0xa0, 0x6d5: 0xa0, 0x6d6: 0xa0, 0x6d7: 0xa0, - 0x6d8: 0xa0, 0x6d9: 0xa0, 0x6da: 0xa0, 0x6db: 0xa0, 0x6dc: 0x197, 0x6dd: 0xa0, 0x6de: 0xa0, 0x6df: 0xa0, - 0x6e0: 0x198, 0x6e1: 0xa0, 0x6e2: 0xa0, 0x6e3: 0xa0, 0x6e4: 0xa0, 0x6e5: 0xa0, 0x6e6: 0xa0, 0x6e7: 0xa0, + 0x6d8: 0xa0, 0x6d9: 0xa0, 0x6da: 0xa0, 0x6db: 0xa0, 0x6dc: 0x199, 0x6dd: 0xa0, 0x6de: 0xa0, 0x6df: 0xa0, + 0x6e0: 0x19a, 0x6e1: 0xa0, 0x6e2: 0xa0, 0x6e3: 0xa0, 0x6e4: 0xa0, 0x6e5: 0xa0, 0x6e6: 0xa0, 0x6e7: 0xa0, 0x6e8: 0xa0, 0x6e9: 0xa0, 0x6ea: 0xa0, 0x6eb: 0xa0, 0x6ec: 0xa0, 0x6ed: 0xa0, 0x6ee: 0xa0, 0x6ef: 0xa0, 0x6f0: 0xa0, 0x6f1: 0xa0, 0x6f2: 0xa0, 0x6f3: 0xa0, 0x6f4: 0xa0, 0x6f5: 0xa0, 0x6f6: 0xa0, 0x6f7: 0xa0, 0x6f8: 0xa0, 0x6f9: 0xa0, 0x6fa: 0xa0, 0x6fb: 0xa0, 0x6fc: 0xa0, 0x6fd: 0xa0, 0x6fe: 0xa0, 0x6ff: 0xa0, @@ -2325,34 +2468,34 @@ var idnaIndex = [2368]uint16{ 0x720: 0xa0, 0x721: 0xa0, 0x722: 0xa0, 0x723: 0xa0, 0x724: 0xa0, 0x725: 0xa0, 0x726: 0xa0, 0x727: 0xa0, 0x728: 0xa0, 0x729: 0xa0, 0x72a: 0xa0, 0x72b: 0xa0, 0x72c: 0xa0, 0x72d: 0xa0, 0x72e: 0xa0, 0x72f: 0xa0, 0x730: 0xa0, 0x731: 0xa0, 0x732: 0xa0, 0x733: 0xa0, 0x734: 0xa0, 0x735: 0xa0, 0x736: 0xa0, 0x737: 0xa0, - 0x738: 0xa0, 0x739: 0xa0, 0x73a: 0x199, 0x73b: 0xa0, 0x73c: 0xa0, 0x73d: 0xa0, 0x73e: 0xa0, 0x73f: 0xa0, + 0x738: 0xa0, 0x739: 0xa0, 0x73a: 0x19b, 0x73b: 0xa0, 0x73c: 0xa0, 0x73d: 0xa0, 0x73e: 0xa0, 0x73f: 0xa0, // Block 0x1d, offset 0x740 0x740: 0xa0, 0x741: 0xa0, 0x742: 0xa0, 0x743: 0xa0, 0x744: 0xa0, 0x745: 0xa0, 0x746: 0xa0, 0x747: 0xa0, 0x748: 0xa0, 0x749: 0xa0, 0x74a: 0xa0, 0x74b: 0xa0, 0x74c: 0xa0, 0x74d: 0xa0, 0x74e: 0xa0, 0x74f: 0xa0, 0x750: 0xa0, 0x751: 0xa0, 0x752: 0xa0, 0x753: 0xa0, 0x754: 0xa0, 0x755: 0xa0, 0x756: 0xa0, 0x757: 0xa0, 0x758: 0xa0, 0x759: 0xa0, 0x75a: 0xa0, 0x75b: 0xa0, 0x75c: 0xa0, 0x75d: 0xa0, 0x75e: 0xa0, 0x75f: 0xa0, 0x760: 0xa0, 0x761: 0xa0, 0x762: 0xa0, 0x763: 0xa0, 0x764: 0xa0, 0x765: 0xa0, 0x766: 0xa0, 0x767: 0xa0, - 0x768: 0xa0, 0x769: 0xa0, 0x76a: 0xa0, 0x76b: 0xa0, 0x76c: 0xa0, 0x76d: 0xa0, 0x76e: 0xa0, 0x76f: 0x19a, - 0x770: 0xfb, 0x771: 0xfb, 0x772: 0xfb, 0x773: 0xfb, 0x774: 0xfb, 0x775: 0xfb, 0x776: 0xfb, 0x777: 0xfb, - 0x778: 0xfb, 0x779: 0xfb, 0x77a: 0xfb, 0x77b: 0xfb, 0x77c: 0xfb, 0x77d: 0xfb, 0x77e: 0xfb, 0x77f: 0xfb, + 0x768: 0xa0, 0x769: 0xa0, 0x76a: 0xa0, 0x76b: 0xa0, 0x76c: 0xa0, 0x76d: 0xa0, 0x76e: 0xa0, 0x76f: 0x19c, + 0x770: 0xfd, 0x771: 0xfd, 0x772: 0xfd, 0x773: 0xfd, 0x774: 0xfd, 0x775: 0xfd, 0x776: 0xfd, 0x777: 0xfd, + 0x778: 0xfd, 0x779: 0xfd, 0x77a: 0xfd, 0x77b: 0xfd, 0x77c: 0xfd, 0x77d: 0xfd, 0x77e: 0xfd, 0x77f: 0xfd, // Block 0x1e, offset 0x780 - 0x780: 0xfb, 0x781: 0xfb, 0x782: 0xfb, 0x783: 0xfb, 0x784: 0xfb, 0x785: 0xfb, 0x786: 0xfb, 0x787: 0xfb, - 0x788: 0xfb, 0x789: 0xfb, 0x78a: 0xfb, 0x78b: 0xfb, 0x78c: 0xfb, 0x78d: 0xfb, 0x78e: 0xfb, 0x78f: 0xfb, - 0x790: 0xfb, 0x791: 0xfb, 0x792: 0xfb, 0x793: 0xfb, 0x794: 0xfb, 0x795: 0xfb, 0x796: 0xfb, 0x797: 0xfb, - 0x798: 0xfb, 0x799: 0xfb, 0x79a: 0xfb, 0x79b: 0xfb, 0x79c: 0xfb, 0x79d: 0xfb, 0x79e: 0xfb, 0x79f: 0xfb, - 0x7a0: 0x77, 0x7a1: 0x78, 0x7a2: 0x79, 0x7a3: 0x19b, 0x7a4: 0x7a, 0x7a5: 0x7b, 0x7a6: 0x19c, 0x7a7: 0x7c, - 0x7a8: 0x7d, 0x7a9: 0xfb, 0x7aa: 0xfb, 0x7ab: 0xfb, 0x7ac: 0xfb, 0x7ad: 0xfb, 0x7ae: 0xfb, 0x7af: 0xfb, - 0x7b0: 0xfb, 0x7b1: 0xfb, 0x7b2: 0xfb, 0x7b3: 0xfb, 0x7b4: 0xfb, 0x7b5: 0xfb, 0x7b6: 0xfb, 0x7b7: 0xfb, - 0x7b8: 0xfb, 0x7b9: 0xfb, 0x7ba: 0xfb, 0x7bb: 0xfb, 0x7bc: 0xfb, 0x7bd: 0xfb, 0x7be: 0xfb, 0x7bf: 0xfb, + 0x780: 0xfd, 0x781: 0xfd, 0x782: 0xfd, 0x783: 0xfd, 0x784: 0xfd, 0x785: 0xfd, 0x786: 0xfd, 0x787: 0xfd, + 0x788: 0xfd, 0x789: 0xfd, 0x78a: 0xfd, 0x78b: 0xfd, 0x78c: 0xfd, 0x78d: 0xfd, 0x78e: 0xfd, 0x78f: 0xfd, + 0x790: 0xfd, 0x791: 0xfd, 0x792: 0xfd, 0x793: 0xfd, 0x794: 0xfd, 0x795: 0xfd, 0x796: 0xfd, 0x797: 0xfd, + 0x798: 0xfd, 0x799: 0xfd, 0x79a: 0xfd, 0x79b: 0xfd, 0x79c: 0xfd, 0x79d: 0xfd, 0x79e: 0xfd, 0x79f: 0xfd, + 0x7a0: 0x75, 0x7a1: 0x76, 0x7a2: 0x77, 0x7a3: 0x78, 0x7a4: 0x79, 0x7a5: 0x7a, 0x7a6: 0x7b, 0x7a7: 0x7c, + 0x7a8: 0x7d, 0x7a9: 0xfd, 0x7aa: 0xfd, 0x7ab: 0xfd, 0x7ac: 0xfd, 0x7ad: 0xfd, 0x7ae: 0xfd, 0x7af: 0xfd, + 0x7b0: 0xfd, 0x7b1: 0xfd, 0x7b2: 0xfd, 0x7b3: 0xfd, 0x7b4: 0xfd, 0x7b5: 0xfd, 0x7b6: 0xfd, 0x7b7: 0xfd, + 0x7b8: 0xfd, 0x7b9: 0xfd, 0x7ba: 0xfd, 0x7bb: 0xfd, 0x7bc: 0xfd, 0x7bd: 0xfd, 0x7be: 0xfd, 0x7bf: 0xfd, // Block 0x1f, offset 0x7c0 0x7c0: 0xa0, 0x7c1: 0xa0, 0x7c2: 0xa0, 0x7c3: 0xa0, 0x7c4: 0xa0, 0x7c5: 0xa0, 0x7c6: 0xa0, 0x7c7: 0xa0, - 0x7c8: 0xa0, 0x7c9: 0xa0, 0x7ca: 0xa0, 0x7cb: 0xa0, 0x7cc: 0xa0, 0x7cd: 0x19d, 0x7ce: 0xfb, 0x7cf: 0xfb, - 0x7d0: 0xfb, 0x7d1: 0xfb, 0x7d2: 0xfb, 0x7d3: 0xfb, 0x7d4: 0xfb, 0x7d5: 0xfb, 0x7d6: 0xfb, 0x7d7: 0xfb, - 0x7d8: 0xfb, 0x7d9: 0xfb, 0x7da: 0xfb, 0x7db: 0xfb, 0x7dc: 0xfb, 0x7dd: 0xfb, 0x7de: 0xfb, 0x7df: 0xfb, - 0x7e0: 0xfb, 0x7e1: 0xfb, 0x7e2: 0xfb, 0x7e3: 0xfb, 0x7e4: 0xfb, 0x7e5: 0xfb, 0x7e6: 0xfb, 0x7e7: 0xfb, - 0x7e8: 0xfb, 0x7e9: 0xfb, 0x7ea: 0xfb, 0x7eb: 0xfb, 0x7ec: 0xfb, 0x7ed: 0xfb, 0x7ee: 0xfb, 0x7ef: 0xfb, - 0x7f0: 0xfb, 0x7f1: 0xfb, 0x7f2: 0xfb, 0x7f3: 0xfb, 0x7f4: 0xfb, 0x7f5: 0xfb, 0x7f6: 0xfb, 0x7f7: 0xfb, - 0x7f8: 0xfb, 0x7f9: 0xfb, 0x7fa: 0xfb, 0x7fb: 0xfb, 0x7fc: 0xfb, 0x7fd: 0xfb, 0x7fe: 0xfb, 0x7ff: 0xfb, + 0x7c8: 0xa0, 0x7c9: 0xa0, 0x7ca: 0xa0, 0x7cb: 0xa0, 0x7cc: 0xa0, 0x7cd: 0x19d, 0x7ce: 0xfd, 0x7cf: 0xfd, + 0x7d0: 0xfd, 0x7d1: 0xfd, 0x7d2: 0xfd, 0x7d3: 0xfd, 0x7d4: 0xfd, 0x7d5: 0xfd, 0x7d6: 0xfd, 0x7d7: 0xfd, + 0x7d8: 0xfd, 0x7d9: 0xfd, 0x7da: 0xfd, 0x7db: 0xfd, 0x7dc: 0xfd, 0x7dd: 0xfd, 0x7de: 0xfd, 0x7df: 0xfd, + 0x7e0: 0xfd, 0x7e1: 0xfd, 0x7e2: 0xfd, 0x7e3: 0xfd, 0x7e4: 0xfd, 0x7e5: 0xfd, 0x7e6: 0xfd, 0x7e7: 0xfd, + 0x7e8: 0xfd, 0x7e9: 0xfd, 0x7ea: 0xfd, 0x7eb: 0xfd, 0x7ec: 0xfd, 0x7ed: 0xfd, 0x7ee: 0xfd, 0x7ef: 0xfd, + 0x7f0: 0xfd, 0x7f1: 0xfd, 0x7f2: 0xfd, 0x7f3: 0xfd, 0x7f4: 0xfd, 0x7f5: 0xfd, 0x7f6: 0xfd, 0x7f7: 0xfd, + 0x7f8: 0xfd, 0x7f9: 0xfd, 0x7fa: 0xfd, 0x7fb: 0xfd, 0x7fc: 0xfd, 0x7fd: 0xfd, 0x7fe: 0xfd, 0x7ff: 0xfd, // Block 0x20, offset 0x800 0x810: 0x0d, 0x811: 0x0e, 0x812: 0x0f, 0x813: 0x10, 0x814: 0x11, 0x815: 0x0b, 0x816: 0x12, 0x817: 0x07, 0x818: 0x13, 0x819: 0x0b, 0x81a: 0x0b, 0x81b: 0x14, 0x81c: 0x0b, 0x81d: 0x15, 0x81e: 0x16, 0x81f: 0x17, @@ -2370,14 +2513,14 @@ var idnaIndex = [2368]uint16{ 0x870: 0x0b, 0x871: 0x0b, 0x872: 0x0b, 0x873: 0x0b, 0x874: 0x0b, 0x875: 0x0b, 0x876: 0x0b, 0x877: 0x0b, 0x878: 0x0b, 0x879: 0x0b, 0x87a: 0x0b, 0x87b: 0x0b, 0x87c: 0x0b, 0x87d: 0x0b, 0x87e: 0x0b, 0x87f: 0x0b, // Block 0x22, offset 0x880 - 0x880: 0x19e, 0x881: 0x19f, 0x882: 0xfb, 0x883: 0xfb, 0x884: 0x1a0, 0x885: 0x1a0, 0x886: 0x1a0, 0x887: 0x1a1, - 0x888: 0xfb, 0x889: 0xfb, 0x88a: 0xfb, 0x88b: 0xfb, 0x88c: 0xfb, 0x88d: 0xfb, 0x88e: 0xfb, 0x88f: 0xfb, - 0x890: 0xfb, 0x891: 0xfb, 0x892: 0xfb, 0x893: 0xfb, 0x894: 0xfb, 0x895: 0xfb, 0x896: 0xfb, 0x897: 0xfb, - 0x898: 0xfb, 0x899: 0xfb, 0x89a: 0xfb, 0x89b: 0xfb, 0x89c: 0xfb, 0x89d: 0xfb, 0x89e: 0xfb, 0x89f: 0xfb, - 0x8a0: 0xfb, 0x8a1: 0xfb, 0x8a2: 0xfb, 0x8a3: 0xfb, 0x8a4: 0xfb, 0x8a5: 0xfb, 0x8a6: 0xfb, 0x8a7: 0xfb, - 0x8a8: 0xfb, 0x8a9: 0xfb, 0x8aa: 0xfb, 0x8ab: 0xfb, 0x8ac: 0xfb, 0x8ad: 0xfb, 0x8ae: 0xfb, 0x8af: 0xfb, - 0x8b0: 0xfb, 0x8b1: 0xfb, 0x8b2: 0xfb, 0x8b3: 0xfb, 0x8b4: 0xfb, 0x8b5: 0xfb, 0x8b6: 0xfb, 0x8b7: 0xfb, - 0x8b8: 0xfb, 0x8b9: 0xfb, 0x8ba: 0xfb, 0x8bb: 0xfb, 0x8bc: 0xfb, 0x8bd: 0xfb, 0x8be: 0xfb, 0x8bf: 0xfb, + 0x880: 0x19e, 0x881: 0x19f, 0x882: 0xfd, 0x883: 0xfd, 0x884: 0x1a0, 0x885: 0x1a0, 0x886: 0x1a0, 0x887: 0x1a1, + 0x888: 0xfd, 0x889: 0xfd, 0x88a: 0xfd, 0x88b: 0xfd, 0x88c: 0xfd, 0x88d: 0xfd, 0x88e: 0xfd, 0x88f: 0xfd, + 0x890: 0xfd, 0x891: 0xfd, 0x892: 0xfd, 0x893: 0xfd, 0x894: 0xfd, 0x895: 0xfd, 0x896: 0xfd, 0x897: 0xfd, + 0x898: 0xfd, 0x899: 0xfd, 0x89a: 0xfd, 0x89b: 0xfd, 0x89c: 0xfd, 0x89d: 0xfd, 0x89e: 0xfd, 0x89f: 0xfd, + 0x8a0: 0xfd, 0x8a1: 0xfd, 0x8a2: 0xfd, 0x8a3: 0xfd, 0x8a4: 0xfd, 0x8a5: 0xfd, 0x8a6: 0xfd, 0x8a7: 0xfd, + 0x8a8: 0xfd, 0x8a9: 0xfd, 0x8aa: 0xfd, 0x8ab: 0xfd, 0x8ac: 0xfd, 0x8ad: 0xfd, 0x8ae: 0xfd, 0x8af: 0xfd, + 0x8b0: 0xfd, 0x8b1: 0xfd, 0x8b2: 0xfd, 0x8b3: 0xfd, 0x8b4: 0xfd, 0x8b5: 0xfd, 0x8b6: 0xfd, 0x8b7: 0xfd, + 0x8b8: 0xfd, 0x8b9: 0xfd, 0x8ba: 0xfd, 0x8bb: 0xfd, 0x8bc: 0xfd, 0x8bd: 0xfd, 0x8be: 0xfd, 0x8bf: 0xfd, // Block 0x23, offset 0x8c0 0x8c0: 0x0b, 0x8c1: 0x0b, 0x8c2: 0x0b, 0x8c3: 0x0b, 0x8c4: 0x0b, 0x8c5: 0x0b, 0x8c6: 0x0b, 0x8c7: 0x0b, 0x8c8: 0x0b, 0x8c9: 0x0b, 0x8ca: 0x0b, 0x8cb: 0x0b, 0x8cc: 0x0b, 0x8cd: 0x0b, 0x8ce: 0x0b, 0x8cf: 0x0b, @@ -2393,10 +2536,10 @@ var idnaIndex = [2368]uint16{ } // idnaSparseOffset: 292 entries, 584 bytes -var idnaSparseOffset = []uint16{0x0, 0x8, 0x19, 0x25, 0x27, 0x2c, 0x33, 0x3e, 0x4a, 0x4e, 0x5d, 0x62, 0x6c, 0x78, 0x85, 0x8b, 0x94, 0xa4, 0xb2, 0xbd, 0xca, 0xdb, 0xe5, 0xec, 0xf9, 0x10a, 0x111, 0x11c, 0x12b, 0x139, 0x143, 0x145, 0x14a, 0x14d, 0x150, 0x152, 0x15e, 0x169, 0x171, 0x177, 0x17d, 0x182, 0x187, 0x18a, 0x18e, 0x194, 0x199, 0x1a5, 0x1af, 0x1b5, 0x1c6, 0x1d0, 0x1d3, 0x1db, 0x1de, 0x1eb, 0x1f3, 0x1f7, 0x1fe, 0x206, 0x216, 0x222, 0x225, 0x22f, 0x23b, 0x247, 0x253, 0x25b, 0x260, 0x26d, 0x27e, 0x282, 0x28d, 0x291, 0x29a, 0x2a2, 0x2a8, 0x2ad, 0x2b0, 0x2b4, 0x2ba, 0x2be, 0x2c2, 0x2c6, 0x2cc, 0x2d4, 0x2db, 0x2e6, 0x2f0, 0x2f4, 0x2f7, 0x2fd, 0x301, 0x303, 0x306, 0x308, 0x30b, 0x315, 0x318, 0x327, 0x32b, 0x330, 0x333, 0x337, 0x33c, 0x341, 0x347, 0x358, 0x368, 0x36e, 0x372, 0x381, 0x386, 0x38e, 0x398, 0x3a3, 0x3ab, 0x3bc, 0x3c5, 0x3d5, 0x3e2, 0x3ee, 0x3f3, 0x400, 0x404, 0x409, 0x40b, 0x40d, 0x411, 0x413, 0x417, 0x420, 0x426, 0x42a, 0x43a, 0x444, 0x449, 0x44c, 0x452, 0x459, 0x45e, 0x462, 0x468, 0x46d, 0x476, 0x47b, 0x481, 0x488, 0x48f, 0x496, 0x49a, 0x49f, 0x4a2, 0x4a7, 0x4b3, 0x4b9, 0x4be, 0x4c5, 0x4cd, 0x4d2, 0x4d6, 0x4e6, 0x4ed, 0x4f1, 0x4f5, 0x4fc, 0x4fe, 0x501, 0x504, 0x508, 0x511, 0x515, 0x51d, 0x525, 0x52d, 0x539, 0x545, 0x54b, 0x554, 0x560, 0x567, 0x570, 0x57b, 0x582, 0x591, 0x59e, 0x5ab, 0x5b4, 0x5b8, 0x5c7, 0x5cf, 0x5da, 0x5e3, 0x5e9, 0x5f1, 0x5fa, 0x605, 0x608, 0x614, 0x61d, 0x620, 0x625, 0x62e, 0x633, 0x640, 0x64b, 0x654, 0x65e, 0x661, 0x66b, 0x674, 0x680, 0x68d, 0x69a, 0x6a8, 0x6af, 0x6b3, 0x6b7, 0x6ba, 0x6bf, 0x6c2, 0x6c7, 0x6ca, 0x6d1, 0x6d8, 0x6dc, 0x6e7, 0x6ea, 0x6ed, 0x6f0, 0x6f6, 0x6fc, 0x705, 0x708, 0x70b, 0x70e, 0x711, 0x718, 0x71b, 0x720, 0x72a, 0x72d, 0x731, 0x740, 0x74c, 0x750, 0x755, 0x759, 0x75e, 0x762, 0x767, 0x770, 0x77b, 0x781, 0x787, 0x78d, 0x793, 0x79c, 0x79f, 0x7a2, 0x7a6, 0x7aa, 0x7ae, 0x7b4, 0x7ba, 0x7bf, 0x7c2, 0x7d2, 0x7d9, 0x7dc, 0x7e1, 0x7e5, 0x7eb, 0x7f2, 0x7f6, 0x7fa, 0x803, 0x80a, 0x80f, 0x813, 0x821, 0x824, 0x827, 0x82b, 0x82f, 0x832, 0x842, 0x853, 0x856, 0x85b, 0x85d, 0x85f} +var idnaSparseOffset = []uint16{0x0, 0x8, 0x19, 0x25, 0x27, 0x2c, 0x33, 0x3e, 0x4a, 0x4e, 0x5d, 0x62, 0x6c, 0x78, 0x85, 0x8b, 0x94, 0xa4, 0xb2, 0xbd, 0xca, 0xdb, 0xe5, 0xec, 0xf9, 0x10a, 0x111, 0x11c, 0x12b, 0x139, 0x143, 0x145, 0x14a, 0x14d, 0x150, 0x152, 0x15e, 0x169, 0x171, 0x177, 0x17d, 0x182, 0x187, 0x18a, 0x18e, 0x194, 0x199, 0x1a5, 0x1af, 0x1b5, 0x1c6, 0x1d0, 0x1d3, 0x1db, 0x1de, 0x1eb, 0x1f3, 0x1f7, 0x1fe, 0x206, 0x216, 0x222, 0x225, 0x22f, 0x23b, 0x247, 0x253, 0x25b, 0x260, 0x26d, 0x27e, 0x282, 0x28d, 0x291, 0x29a, 0x2a2, 0x2a8, 0x2ad, 0x2b0, 0x2b4, 0x2ba, 0x2be, 0x2c2, 0x2c6, 0x2cc, 0x2d4, 0x2db, 0x2e6, 0x2f0, 0x2f4, 0x2f7, 0x2fd, 0x301, 0x303, 0x306, 0x308, 0x30b, 0x315, 0x318, 0x327, 0x32b, 0x32f, 0x331, 0x33a, 0x33d, 0x341, 0x346, 0x34b, 0x351, 0x362, 0x372, 0x378, 0x37c, 0x38b, 0x390, 0x398, 0x3a2, 0x3ad, 0x3b5, 0x3c6, 0x3cf, 0x3df, 0x3ec, 0x3f8, 0x3fd, 0x40a, 0x40e, 0x413, 0x415, 0x417, 0x41b, 0x41d, 0x421, 0x42a, 0x430, 0x434, 0x444, 0x44e, 0x453, 0x456, 0x45c, 0x463, 0x468, 0x46c, 0x472, 0x477, 0x480, 0x485, 0x48b, 0x492, 0x499, 0x4a0, 0x4a4, 0x4a9, 0x4ac, 0x4b1, 0x4bd, 0x4c3, 0x4c8, 0x4cf, 0x4d7, 0x4dc, 0x4e0, 0x4f0, 0x4f7, 0x4fb, 0x4ff, 0x506, 0x508, 0x50b, 0x50e, 0x512, 0x51b, 0x51f, 0x527, 0x52f, 0x537, 0x543, 0x54f, 0x555, 0x55e, 0x56a, 0x571, 0x57a, 0x585, 0x58c, 0x59b, 0x5a8, 0x5b5, 0x5be, 0x5c2, 0x5d1, 0x5d9, 0x5e4, 0x5ed, 0x5f3, 0x5fb, 0x604, 0x60f, 0x612, 0x61e, 0x627, 0x62a, 0x62f, 0x638, 0x63d, 0x64a, 0x655, 0x65e, 0x668, 0x66b, 0x675, 0x67e, 0x68a, 0x697, 0x6a4, 0x6b2, 0x6b9, 0x6bd, 0x6c1, 0x6c4, 0x6c9, 0x6cc, 0x6d1, 0x6d4, 0x6db, 0x6e2, 0x6e6, 0x6f1, 0x6f4, 0x6f7, 0x6fa, 0x700, 0x706, 0x70f, 0x712, 0x715, 0x718, 0x71b, 0x722, 0x725, 0x72a, 0x734, 0x737, 0x73b, 0x74a, 0x756, 0x75a, 0x75f, 0x763, 0x768, 0x76c, 0x771, 0x77a, 0x785, 0x78b, 0x791, 0x797, 0x79d, 0x7a6, 0x7a9, 0x7ac, 0x7b0, 0x7b4, 0x7b8, 0x7be, 0x7c4, 0x7c9, 0x7cc, 0x7dc, 0x7e3, 0x7e6, 0x7eb, 0x7ef, 0x7f5, 0x7fc, 0x800, 0x804, 0x80d, 0x814, 0x819, 0x81d, 0x82b, 0x82e, 0x831, 0x835, 0x839, 0x83c, 0x83f, 0x844, 0x846, 0x848} -// idnaSparseValues: 2146 entries, 8584 bytes -var idnaSparseValues = [2146]valueRange{ +// idnaSparseValues: 2123 entries, 8492 bytes +var idnaSparseValues = [2123]valueRange{ // Block 0x0, offset 0x0 {value: 0x0000, lo: 0x07}, {value: 0xe105, lo: 0x80, hi: 0x96}, @@ -2427,15 +2570,15 @@ var idnaSparseValues = [2146]valueRange{ // Block 0x2, offset 0x19 {value: 0x0000, lo: 0x0b}, {value: 0x0008, lo: 0x80, hi: 0xaf}, - {value: 0x0249, lo: 0xb0, hi: 0xb0}, + {value: 0x00a9, lo: 0xb0, hi: 0xb0}, {value: 0x037d, lo: 0xb1, hi: 0xb1}, - {value: 0x0259, lo: 0xb2, hi: 0xb2}, - {value: 0x0269, lo: 0xb3, hi: 0xb3}, + {value: 0x00b1, lo: 0xb2, hi: 0xb2}, + {value: 0x00b9, lo: 0xb3, hi: 0xb3}, {value: 0x034d, lo: 0xb4, hi: 0xb4}, {value: 0x0395, lo: 0xb5, hi: 0xb5}, {value: 0xe1bd, lo: 0xb6, hi: 0xb6}, - {value: 0x0279, lo: 0xb7, hi: 0xb7}, - {value: 0x0289, lo: 0xb8, hi: 0xb8}, + {value: 0x00c1, lo: 0xb7, hi: 0xb7}, + {value: 0x00c9, lo: 0xb8, hi: 0xb8}, {value: 0x0008, lo: 0xb9, hi: 0xbf}, // Block 0x3, offset 0x25 {value: 0x0000, lo: 0x01}, @@ -2457,7 +2600,7 @@ var idnaSparseValues = [2146]valueRange{ // Block 0x6, offset 0x33 {value: 0x0000, lo: 0x0a}, {value: 0x0008, lo: 0x80, hi: 0x86}, - {value: 0x0401, lo: 0x87, hi: 0x87}, + {value: 0x0131, lo: 0x87, hi: 0x87}, {value: 0x0008, lo: 0x88, hi: 0x88}, {value: 0x0018, lo: 0x89, hi: 0x8a}, {value: 0x0040, lo: 0x8b, hi: 0x8c}, @@ -2643,7 +2786,7 @@ var idnaSparseValues = [2146]valueRange{ {value: 0x0008, lo: 0x81, hi: 0xb0}, {value: 0x3308, lo: 0xb1, hi: 0xb1}, {value: 0x0008, lo: 0xb2, hi: 0xb2}, - {value: 0x08f1, lo: 0xb3, hi: 0xb3}, + {value: 0x01f1, lo: 0xb3, hi: 0xb3}, {value: 0x3308, lo: 0xb4, hi: 0xb9}, {value: 0x3b08, lo: 0xba, hi: 0xba}, {value: 0x0040, lo: 0xbb, hi: 0xbe}, @@ -2666,8 +2809,8 @@ var idnaSparseValues = [2146]valueRange{ {value: 0x0040, lo: 0x8e, hi: 0x8f}, {value: 0x0008, lo: 0x90, hi: 0x99}, {value: 0x0040, lo: 0x9a, hi: 0x9b}, - {value: 0x0961, lo: 0x9c, hi: 0x9c}, - {value: 0x0999, lo: 0x9d, hi: 0x9d}, + {value: 0x0201, lo: 0x9c, hi: 0x9c}, + {value: 0x0209, lo: 0x9d, hi: 0x9d}, {value: 0x0008, lo: 0x9e, hi: 0x9f}, {value: 0x0040, lo: 0xa0, hi: 0xbf}, // Block 0x18, offset 0xf9 @@ -3075,13 +3218,13 @@ var idnaSparseValues = [2146]valueRange{ {value: 0x0018, lo: 0xbe, hi: 0xbf}, // Block 0x44, offset 0x260 {value: 0x0000, lo: 0x0c}, - {value: 0x0e29, lo: 0x80, hi: 0x80}, - {value: 0x0e41, lo: 0x81, hi: 0x81}, - {value: 0x0e59, lo: 0x82, hi: 0x82}, - {value: 0x0e71, lo: 0x83, hi: 0x83}, - {value: 0x0e89, lo: 0x84, hi: 0x85}, - {value: 0x0ea1, lo: 0x86, hi: 0x86}, - {value: 0x0eb9, lo: 0x87, hi: 0x87}, + {value: 0x02a9, lo: 0x80, hi: 0x80}, + {value: 0x02b1, lo: 0x81, hi: 0x81}, + {value: 0x02b9, lo: 0x82, hi: 0x82}, + {value: 0x02c1, lo: 0x83, hi: 0x83}, + {value: 0x02c9, lo: 0x84, hi: 0x85}, + {value: 0x02d1, lo: 0x86, hi: 0x86}, + {value: 0x02d9, lo: 0x87, hi: 0x87}, {value: 0x057d, lo: 0x88, hi: 0x88}, {value: 0x0040, lo: 0x89, hi: 0x8f}, {value: 0x059d, lo: 0x90, hi: 0xba}, @@ -3133,18 +3276,18 @@ var idnaSparseValues = [2146]valueRange{ {value: 0x0040, lo: 0x83, hi: 0x83}, {value: 0x0008, lo: 0x84, hi: 0x84}, {value: 0x0018, lo: 0x85, hi: 0x88}, - {value: 0x24c1, lo: 0x89, hi: 0x89}, + {value: 0x0851, lo: 0x89, hi: 0x89}, {value: 0x0018, lo: 0x8a, hi: 0x8b}, {value: 0x0040, lo: 0x8c, hi: 0x8f}, {value: 0x0018, lo: 0x90, hi: 0xbf}, // Block 0x4a, offset 0x29a {value: 0x0000, lo: 0x07}, {value: 0x0018, lo: 0x80, hi: 0xab}, - {value: 0x24f1, lo: 0xac, hi: 0xac}, - {value: 0x2529, lo: 0xad, hi: 0xad}, + {value: 0x0859, lo: 0xac, hi: 0xac}, + {value: 0x0861, lo: 0xad, hi: 0xad}, {value: 0x0018, lo: 0xae, hi: 0xae}, - {value: 0x2579, lo: 0xaf, hi: 0xaf}, - {value: 0x25b1, lo: 0xb0, hi: 0xb0}, + {value: 0x0869, lo: 0xaf, hi: 0xaf}, + {value: 0x0871, lo: 0xb0, hi: 0xb0}, {value: 0x0018, lo: 0xb1, hi: 0xbf}, // Block 0x4b, offset 0x2a2 {value: 0x0000, lo: 0x05}, @@ -3166,19 +3309,19 @@ var idnaSparseValues = [2146]valueRange{ // Block 0x4e, offset 0x2b0 {value: 0x0000, lo: 0x03}, {value: 0x0018, lo: 0x80, hi: 0x8b}, - {value: 0x28c1, lo: 0x8c, hi: 0x8c}, + {value: 0x0929, lo: 0x8c, hi: 0x8c}, {value: 0x0018, lo: 0x8d, hi: 0xbf}, // Block 0x4f, offset 0x2b4 {value: 0x0000, lo: 0x05}, {value: 0x0018, lo: 0x80, hi: 0xb3}, {value: 0x0e7e, lo: 0xb4, hi: 0xb4}, - {value: 0x292a, lo: 0xb5, hi: 0xb5}, + {value: 0x0932, lo: 0xb5, hi: 0xb5}, {value: 0x0e9e, lo: 0xb6, hi: 0xb6}, {value: 0x0018, lo: 0xb7, hi: 0xbf}, // Block 0x50, offset 0x2ba {value: 0x0000, lo: 0x03}, {value: 0x0018, lo: 0x80, hi: 0x9b}, - {value: 0x2941, lo: 0x9c, hi: 0x9c}, + {value: 0x0939, lo: 0x9c, hi: 0x9c}, {value: 0x0018, lo: 0x9d, hi: 0xbf}, // Block 0x51, offset 0x2be {value: 0x0000, lo: 0x03}, @@ -3277,16 +3420,16 @@ var idnaSparseValues = [2146]valueRange{ {value: 0x0008, lo: 0x80, hi: 0x96}, {value: 0x0040, lo: 0x97, hi: 0x98}, {value: 0x3308, lo: 0x99, hi: 0x9a}, - {value: 0x29e2, lo: 0x9b, hi: 0x9b}, - {value: 0x2a0a, lo: 0x9c, hi: 0x9c}, + {value: 0x096a, lo: 0x9b, hi: 0x9b}, + {value: 0x0972, lo: 0x9c, hi: 0x9c}, {value: 0x0008, lo: 0x9d, hi: 0x9e}, - {value: 0x2a31, lo: 0x9f, hi: 0x9f}, + {value: 0x0979, lo: 0x9f, hi: 0x9f}, {value: 0x0018, lo: 0xa0, hi: 0xa0}, {value: 0x0008, lo: 0xa1, hi: 0xbf}, // Block 0x61, offset 0x315 {value: 0x0000, lo: 0x02}, {value: 0x0008, lo: 0x80, hi: 0xbe}, - {value: 0x2a69, lo: 0xbf, hi: 0xbf}, + {value: 0x0981, lo: 0xbf, hi: 0xbf}, // Block 0x62, offset 0x318 {value: 0x0000, lo: 0x0e}, {value: 0x0040, lo: 0x80, hi: 0x84}, @@ -3309,46 +3452,58 @@ var idnaSparseValues = [2146]valueRange{ {value: 0x0040, lo: 0xa4, hi: 0xaf}, {value: 0x0008, lo: 0xb0, hi: 0xbf}, // Block 0x64, offset 0x32b - {value: 0x0030, lo: 0x04}, - {value: 0x2aa2, lo: 0x80, hi: 0x9d}, - {value: 0x305a, lo: 0x9e, hi: 0x9e}, + {value: 0x0008, lo: 0x03}, + {value: 0x098a, lo: 0x80, hi: 0x9e}, {value: 0x0040, lo: 0x9f, hi: 0x9f}, - {value: 0x30a2, lo: 0xa0, hi: 0xbf}, - // Block 0x65, offset 0x330 + {value: 0x0a82, lo: 0xa0, hi: 0xbf}, + // Block 0x65, offset 0x32f + {value: 0x0008, lo: 0x01}, + {value: 0x0d19, lo: 0x80, hi: 0xbf}, + // Block 0x66, offset 0x331 + {value: 0x0008, lo: 0x08}, + {value: 0x0f19, lo: 0x80, hi: 0xb0}, + {value: 0x4045, lo: 0xb1, hi: 0xb1}, + {value: 0x10a1, lo: 0xb2, hi: 0xb3}, + {value: 0x4065, lo: 0xb4, hi: 0xb4}, + {value: 0x10b1, lo: 0xb5, hi: 0xb7}, + {value: 0x4085, lo: 0xb8, hi: 0xb8}, + {value: 0x4085, lo: 0xb9, hi: 0xb9}, + {value: 0x10c9, lo: 0xba, hi: 0xbf}, + // Block 0x67, offset 0x33a {value: 0x0000, lo: 0x02}, {value: 0x0008, lo: 0x80, hi: 0xbc}, {value: 0x0040, lo: 0xbd, hi: 0xbf}, - // Block 0x66, offset 0x333 + // Block 0x68, offset 0x33d {value: 0x0000, lo: 0x03}, {value: 0x0008, lo: 0x80, hi: 0x8c}, {value: 0x0040, lo: 0x8d, hi: 0x8f}, {value: 0x0018, lo: 0x90, hi: 0xbf}, - // Block 0x67, offset 0x337 + // Block 0x69, offset 0x341 {value: 0x0000, lo: 0x04}, {value: 0x0018, lo: 0x80, hi: 0x86}, {value: 0x0040, lo: 0x87, hi: 0x8f}, {value: 0x0008, lo: 0x90, hi: 0xbd}, {value: 0x0018, lo: 0xbe, hi: 0xbf}, - // Block 0x68, offset 0x33c + // Block 0x6a, offset 0x346 {value: 0x0000, lo: 0x04}, {value: 0x0008, lo: 0x80, hi: 0x8c}, {value: 0x0018, lo: 0x8d, hi: 0x8f}, {value: 0x0008, lo: 0x90, hi: 0xab}, {value: 0x0040, lo: 0xac, hi: 0xbf}, - // Block 0x69, offset 0x341 + // Block 0x6b, offset 0x34b {value: 0x0000, lo: 0x05}, {value: 0x0008, lo: 0x80, hi: 0xa5}, {value: 0x0018, lo: 0xa6, hi: 0xaf}, {value: 0x3308, lo: 0xb0, hi: 0xb1}, {value: 0x0018, lo: 0xb2, hi: 0xb7}, {value: 0x0040, lo: 0xb8, hi: 0xbf}, - // Block 0x6a, offset 0x347 + // Block 0x6c, offset 0x351 {value: 0x0000, lo: 0x10}, {value: 0x0040, lo: 0x80, hi: 0x81}, {value: 0xe00d, lo: 0x82, hi: 0x82}, {value: 0x0008, lo: 0x83, hi: 0x83}, {value: 0x03f5, lo: 0x84, hi: 0x84}, - {value: 0x1329, lo: 0x85, hi: 0x85}, + {value: 0x0479, lo: 0x85, hi: 0x85}, {value: 0x447d, lo: 0x86, hi: 0x86}, {value: 0xe07d, lo: 0x87, hi: 0x87}, {value: 0x0008, lo: 0x88, hi: 0x88}, @@ -3357,10 +3512,10 @@ var idnaSparseValues = [2146]valueRange{ {value: 0x0040, lo: 0x8b, hi: 0xb4}, {value: 0xe01d, lo: 0xb5, hi: 0xb5}, {value: 0x0008, lo: 0xb6, hi: 0xb7}, - {value: 0x2009, lo: 0xb8, hi: 0xb8}, - {value: 0x6ec1, lo: 0xb9, hi: 0xb9}, + {value: 0x0741, lo: 0xb8, hi: 0xb8}, + {value: 0x13f1, lo: 0xb9, hi: 0xb9}, {value: 0x0008, lo: 0xba, hi: 0xbf}, - // Block 0x6b, offset 0x358 + // Block 0x6d, offset 0x362 {value: 0x0000, lo: 0x0f}, {value: 0x0008, lo: 0x80, hi: 0x81}, {value: 0x3308, lo: 0x82, hi: 0x82}, @@ -3377,19 +3532,19 @@ var idnaSparseValues = [2146]valueRange{ {value: 0x0040, lo: 0xad, hi: 0xaf}, {value: 0x0018, lo: 0xb0, hi: 0xb9}, {value: 0x0040, lo: 0xba, hi: 0xbf}, - // Block 0x6c, offset 0x368 + // Block 0x6e, offset 0x372 {value: 0x0000, lo: 0x05}, {value: 0x0208, lo: 0x80, hi: 0xb1}, {value: 0x0108, lo: 0xb2, hi: 0xb2}, {value: 0x0008, lo: 0xb3, hi: 0xb3}, {value: 0x0018, lo: 0xb4, hi: 0xb7}, {value: 0x0040, lo: 0xb8, hi: 0xbf}, - // Block 0x6d, offset 0x36e + // Block 0x6f, offset 0x378 {value: 0x0000, lo: 0x03}, {value: 0x3008, lo: 0x80, hi: 0x81}, {value: 0x0008, lo: 0x82, hi: 0xb3}, {value: 0x3008, lo: 0xb4, hi: 0xbf}, - // Block 0x6e, offset 0x372 + // Block 0x70, offset 0x37c {value: 0x0000, lo: 0x0e}, {value: 0x3008, lo: 0x80, hi: 0x83}, {value: 0x3b08, lo: 0x84, hi: 0x84}, @@ -3405,13 +3560,13 @@ var idnaSparseValues = [2146]valueRange{ {value: 0x0018, lo: 0xbc, hi: 0xbc}, {value: 0x0008, lo: 0xbd, hi: 0xbe}, {value: 0x3308, lo: 0xbf, hi: 0xbf}, - // Block 0x6f, offset 0x381 + // Block 0x71, offset 0x38b {value: 0x0000, lo: 0x04}, {value: 0x0008, lo: 0x80, hi: 0xa5}, {value: 0x3308, lo: 0xa6, hi: 0xad}, {value: 0x0018, lo: 0xae, hi: 0xaf}, {value: 0x0008, lo: 0xb0, hi: 0xbf}, - // Block 0x70, offset 0x386 + // Block 0x72, offset 0x390 {value: 0x0000, lo: 0x07}, {value: 0x0008, lo: 0x80, hi: 0x86}, {value: 0x3308, lo: 0x87, hi: 0x91}, @@ -3420,7 +3575,7 @@ var idnaSparseValues = [2146]valueRange{ {value: 0x0040, lo: 0x94, hi: 0x9e}, {value: 0x0018, lo: 0x9f, hi: 0xbc}, {value: 0x0040, lo: 0xbd, hi: 0xbf}, - // Block 0x71, offset 0x38e + // Block 0x73, offset 0x398 {value: 0x0000, lo: 0x09}, {value: 0x3308, lo: 0x80, hi: 0x82}, {value: 0x3008, lo: 0x83, hi: 0x83}, @@ -3431,7 +3586,7 @@ var idnaSparseValues = [2146]valueRange{ {value: 0x3008, lo: 0xba, hi: 0xbb}, {value: 0x3308, lo: 0xbc, hi: 0xbd}, {value: 0x3008, lo: 0xbe, hi: 0xbf}, - // Block 0x72, offset 0x398 + // Block 0x74, offset 0x3a2 {value: 0x0000, lo: 0x0a}, {value: 0x3808, lo: 0x80, hi: 0x80}, {value: 0x0018, lo: 0x81, hi: 0x8d}, @@ -3443,7 +3598,7 @@ var idnaSparseValues = [2146]valueRange{ {value: 0x3308, lo: 0xa5, hi: 0xa5}, {value: 0x0008, lo: 0xa6, hi: 0xbe}, {value: 0x0040, lo: 0xbf, hi: 0xbf}, - // Block 0x73, offset 0x3a3 + // Block 0x75, offset 0x3ad {value: 0x0000, lo: 0x07}, {value: 0x0008, lo: 0x80, hi: 0xa8}, {value: 0x3308, lo: 0xa9, hi: 0xae}, @@ -3452,7 +3607,7 @@ var idnaSparseValues = [2146]valueRange{ {value: 0x3008, lo: 0xb3, hi: 0xb4}, {value: 0x3308, lo: 0xb5, hi: 0xb6}, {value: 0x0040, lo: 0xb7, hi: 0xbf}, - // Block 0x74, offset 0x3ab + // Block 0x76, offset 0x3b5 {value: 0x0000, lo: 0x10}, {value: 0x0008, lo: 0x80, hi: 0x82}, {value: 0x3308, lo: 0x83, hi: 0x83}, @@ -3470,7 +3625,7 @@ var idnaSparseValues = [2146]valueRange{ {value: 0x3308, lo: 0xbc, hi: 0xbc}, {value: 0x3008, lo: 0xbd, hi: 0xbd}, {value: 0x0008, lo: 0xbe, hi: 0xbf}, - // Block 0x75, offset 0x3bc + // Block 0x77, offset 0x3c6 {value: 0x0000, lo: 0x08}, {value: 0x0008, lo: 0x80, hi: 0xaf}, {value: 0x3308, lo: 0xb0, hi: 0xb0}, @@ -3480,7 +3635,7 @@ var idnaSparseValues = [2146]valueRange{ {value: 0x3308, lo: 0xb7, hi: 0xb8}, {value: 0x0008, lo: 0xb9, hi: 0xbd}, {value: 0x3308, lo: 0xbe, hi: 0xbf}, - // Block 0x76, offset 0x3c5 + // Block 0x78, offset 0x3cf {value: 0x0000, lo: 0x0f}, {value: 0x0008, lo: 0x80, hi: 0x80}, {value: 0x3308, lo: 0x81, hi: 0x81}, @@ -3497,7 +3652,7 @@ var idnaSparseValues = [2146]valueRange{ {value: 0x3008, lo: 0xb5, hi: 0xb5}, {value: 0x3b08, lo: 0xb6, hi: 0xb6}, {value: 0x0040, lo: 0xb7, hi: 0xbf}, - // Block 0x77, offset 0x3d5 + // Block 0x79, offset 0x3df {value: 0x0000, lo: 0x0c}, {value: 0x0040, lo: 0x80, hi: 0x80}, {value: 0x0008, lo: 0x81, hi: 0x86}, @@ -3511,26 +3666,26 @@ var idnaSparseValues = [2146]valueRange{ {value: 0x0008, lo: 0xa8, hi: 0xae}, {value: 0x0040, lo: 0xaf, hi: 0xaf}, {value: 0x0008, lo: 0xb0, hi: 0xbf}, - // Block 0x78, offset 0x3e2 + // Block 0x7a, offset 0x3ec {value: 0x0000, lo: 0x0b}, {value: 0x0008, lo: 0x80, hi: 0x9a}, {value: 0x0018, lo: 0x9b, hi: 0x9b}, {value: 0x449d, lo: 0x9c, hi: 0x9c}, {value: 0x44b5, lo: 0x9d, hi: 0x9d}, - {value: 0x2971, lo: 0x9e, hi: 0x9e}, + {value: 0x0941, lo: 0x9e, hi: 0x9e}, {value: 0xe06d, lo: 0x9f, hi: 0x9f}, {value: 0x0008, lo: 0xa0, hi: 0xa8}, - {value: 0x6ed9, lo: 0xa9, hi: 0xa9}, + {value: 0x13f9, lo: 0xa9, hi: 0xa9}, {value: 0x0018, lo: 0xaa, hi: 0xab}, {value: 0x0040, lo: 0xac, hi: 0xaf}, {value: 0x44cd, lo: 0xb0, hi: 0xbf}, - // Block 0x79, offset 0x3ee + // Block 0x7b, offset 0x3f8 {value: 0x0000, lo: 0x04}, {value: 0x44ed, lo: 0x80, hi: 0x8f}, {value: 0x450d, lo: 0x90, hi: 0x9f}, {value: 0x452d, lo: 0xa0, hi: 0xaf}, {value: 0x450d, lo: 0xb0, hi: 0xbf}, - // Block 0x7a, offset 0x3f3 + // Block 0x7c, offset 0x3fd {value: 0x0000, lo: 0x0c}, {value: 0x0008, lo: 0x80, hi: 0xa2}, {value: 0x3008, lo: 0xa3, hi: 0xa4}, @@ -3544,76 +3699,76 @@ var idnaSparseValues = [2146]valueRange{ {value: 0x0040, lo: 0xae, hi: 0xaf}, {value: 0x0008, lo: 0xb0, hi: 0xb9}, {value: 0x0040, lo: 0xba, hi: 0xbf}, - // Block 0x7b, offset 0x400 + // Block 0x7d, offset 0x40a {value: 0x0000, lo: 0x03}, {value: 0x0008, lo: 0x80, hi: 0xa3}, {value: 0x0040, lo: 0xa4, hi: 0xaf}, {value: 0x0018, lo: 0xb0, hi: 0xbf}, - // Block 0x7c, offset 0x404 + // Block 0x7e, offset 0x40e {value: 0x0000, lo: 0x04}, {value: 0x0018, lo: 0x80, hi: 0x86}, {value: 0x0040, lo: 0x87, hi: 0x8a}, {value: 0x0018, lo: 0x8b, hi: 0xbb}, {value: 0x0040, lo: 0xbc, hi: 0xbf}, - // Block 0x7d, offset 0x409 + // Block 0x7f, offset 0x413 {value: 0x0000, lo: 0x01}, {value: 0x0040, lo: 0x80, hi: 0xbf}, - // Block 0x7e, offset 0x40b + // Block 0x80, offset 0x415 {value: 0x0020, lo: 0x01}, {value: 0x454d, lo: 0x80, hi: 0xbf}, - // Block 0x7f, offset 0x40d + // Block 0x81, offset 0x417 {value: 0x0020, lo: 0x03}, {value: 0x4d4d, lo: 0x80, hi: 0x94}, {value: 0x4b0d, lo: 0x95, hi: 0x95}, {value: 0x4fed, lo: 0x96, hi: 0xbf}, - // Block 0x80, offset 0x411 + // Block 0x82, offset 0x41b {value: 0x0020, lo: 0x01}, {value: 0x552d, lo: 0x80, hi: 0xbf}, - // Block 0x81, offset 0x413 + // Block 0x83, offset 0x41d {value: 0x0020, lo: 0x03}, {value: 0x5d2d, lo: 0x80, hi: 0x84}, {value: 0x568d, lo: 0x85, hi: 0x85}, {value: 0x5dcd, lo: 0x86, hi: 0xbf}, - // Block 0x82, offset 0x417 + // Block 0x84, offset 0x421 {value: 0x0020, lo: 0x08}, {value: 0x6b8d, lo: 0x80, hi: 0x8f}, {value: 0x6d4d, lo: 0x90, hi: 0x90}, {value: 0x6d8d, lo: 0x91, hi: 0xab}, - {value: 0x6ef1, lo: 0xac, hi: 0xac}, + {value: 0x1401, lo: 0xac, hi: 0xac}, {value: 0x70ed, lo: 0xad, hi: 0xad}, {value: 0x0040, lo: 0xae, hi: 0xae}, {value: 0x0040, lo: 0xaf, hi: 0xaf}, {value: 0x710d, lo: 0xb0, hi: 0xbf}, - // Block 0x83, offset 0x420 + // Block 0x85, offset 0x42a {value: 0x0020, lo: 0x05}, {value: 0x730d, lo: 0x80, hi: 0xad}, {value: 0x656d, lo: 0xae, hi: 0xae}, {value: 0x78cd, lo: 0xaf, hi: 0xb5}, {value: 0x6f8d, lo: 0xb6, hi: 0xb6}, {value: 0x79ad, lo: 0xb7, hi: 0xbf}, - // Block 0x84, offset 0x426 - {value: 0x0028, lo: 0x03}, - {value: 0x7c71, lo: 0x80, hi: 0x82}, - {value: 0x7c31, lo: 0x83, hi: 0x83}, - {value: 0x7ce9, lo: 0x84, hi: 0xbf}, - // Block 0x85, offset 0x42a - {value: 0x0038, lo: 0x0f}, - {value: 0x9e01, lo: 0x80, hi: 0x83}, - {value: 0x9ea9, lo: 0x84, hi: 0x85}, - {value: 0x9ee1, lo: 0x86, hi: 0x87}, - {value: 0x9f19, lo: 0x88, hi: 0x8f}, + // Block 0x86, offset 0x430 + {value: 0x0008, lo: 0x03}, + {value: 0x1751, lo: 0x80, hi: 0x82}, + {value: 0x1741, lo: 0x83, hi: 0x83}, + {value: 0x1769, lo: 0x84, hi: 0xbf}, + // Block 0x87, offset 0x434 + {value: 0x0008, lo: 0x0f}, + {value: 0x1d81, lo: 0x80, hi: 0x83}, + {value: 0x1d99, lo: 0x84, hi: 0x85}, + {value: 0x1da1, lo: 0x86, hi: 0x87}, + {value: 0x1da9, lo: 0x88, hi: 0x8f}, {value: 0x0040, lo: 0x90, hi: 0x90}, {value: 0x0040, lo: 0x91, hi: 0x91}, - {value: 0xa0d9, lo: 0x92, hi: 0x97}, - {value: 0xa1f1, lo: 0x98, hi: 0x9c}, - {value: 0xa2d1, lo: 0x9d, hi: 0xb3}, - {value: 0x9d91, lo: 0xb4, hi: 0xb4}, - {value: 0x9e01, lo: 0xb5, hi: 0xb5}, - {value: 0xa7d9, lo: 0xb6, hi: 0xbb}, - {value: 0xa8b9, lo: 0xbc, hi: 0xbc}, - {value: 0xa849, lo: 0xbd, hi: 0xbd}, - {value: 0xa929, lo: 0xbe, hi: 0xbf}, - // Block 0x86, offset 0x43a + {value: 0x1de9, lo: 0x92, hi: 0x97}, + {value: 0x1e11, lo: 0x98, hi: 0x9c}, + {value: 0x1e31, lo: 0x9d, hi: 0xb3}, + {value: 0x1d71, lo: 0xb4, hi: 0xb4}, + {value: 0x1d81, lo: 0xb5, hi: 0xb5}, + {value: 0x1ee9, lo: 0xb6, hi: 0xbb}, + {value: 0x1f09, lo: 0xbc, hi: 0xbc}, + {value: 0x1ef9, lo: 0xbd, hi: 0xbd}, + {value: 0x1f19, lo: 0xbe, hi: 0xbf}, + // Block 0x88, offset 0x444 {value: 0x0000, lo: 0x09}, {value: 0x0008, lo: 0x80, hi: 0x8b}, {value: 0x0040, lo: 0x8c, hi: 0x8c}, @@ -3624,24 +3779,24 @@ var idnaSparseValues = [2146]valueRange{ {value: 0x0008, lo: 0xbc, hi: 0xbd}, {value: 0x0040, lo: 0xbe, hi: 0xbe}, {value: 0x0008, lo: 0xbf, hi: 0xbf}, - // Block 0x87, offset 0x444 + // Block 0x89, offset 0x44e {value: 0x0000, lo: 0x04}, {value: 0x0008, lo: 0x80, hi: 0x8d}, {value: 0x0040, lo: 0x8e, hi: 0x8f}, {value: 0x0008, lo: 0x90, hi: 0x9d}, {value: 0x0040, lo: 0x9e, hi: 0xbf}, - // Block 0x88, offset 0x449 + // Block 0x8a, offset 0x453 {value: 0x0000, lo: 0x02}, {value: 0x0008, lo: 0x80, hi: 0xba}, {value: 0x0040, lo: 0xbb, hi: 0xbf}, - // Block 0x89, offset 0x44c + // Block 0x8b, offset 0x456 {value: 0x0000, lo: 0x05}, {value: 0x0018, lo: 0x80, hi: 0x82}, {value: 0x0040, lo: 0x83, hi: 0x86}, {value: 0x0018, lo: 0x87, hi: 0xb3}, {value: 0x0040, lo: 0xb4, hi: 0xb6}, {value: 0x0018, lo: 0xb7, hi: 0xbf}, - // Block 0x8a, offset 0x452 + // Block 0x8c, offset 0x45c {value: 0x0000, lo: 0x06}, {value: 0x0018, lo: 0x80, hi: 0x8e}, {value: 0x0040, lo: 0x8f, hi: 0x8f}, @@ -3649,31 +3804,31 @@ var idnaSparseValues = [2146]valueRange{ {value: 0x0040, lo: 0x9d, hi: 0x9f}, {value: 0x0018, lo: 0xa0, hi: 0xa0}, {value: 0x0040, lo: 0xa1, hi: 0xbf}, - // Block 0x8b, offset 0x459 + // Block 0x8d, offset 0x463 {value: 0x0000, lo: 0x04}, {value: 0x0040, lo: 0x80, hi: 0x8f}, {value: 0x0018, lo: 0x90, hi: 0xbc}, {value: 0x3308, lo: 0xbd, hi: 0xbd}, {value: 0x0040, lo: 0xbe, hi: 0xbf}, - // Block 0x8c, offset 0x45e + // Block 0x8e, offset 0x468 {value: 0x0000, lo: 0x03}, {value: 0x0008, lo: 0x80, hi: 0x9c}, {value: 0x0040, lo: 0x9d, hi: 0x9f}, {value: 0x0008, lo: 0xa0, hi: 0xbf}, - // Block 0x8d, offset 0x462 + // Block 0x8f, offset 0x46c {value: 0x0000, lo: 0x05}, {value: 0x0008, lo: 0x80, hi: 0x90}, {value: 0x0040, lo: 0x91, hi: 0x9f}, {value: 0x3308, lo: 0xa0, hi: 0xa0}, {value: 0x0018, lo: 0xa1, hi: 0xbb}, {value: 0x0040, lo: 0xbc, hi: 0xbf}, - // Block 0x8e, offset 0x468 + // Block 0x90, offset 0x472 {value: 0x0000, lo: 0x04}, {value: 0x0008, lo: 0x80, hi: 0x9f}, {value: 0x0018, lo: 0xa0, hi: 0xa3}, {value: 0x0040, lo: 0xa4, hi: 0xac}, {value: 0x0008, lo: 0xad, hi: 0xbf}, - // Block 0x8f, offset 0x46d + // Block 0x91, offset 0x477 {value: 0x0000, lo: 0x08}, {value: 0x0008, lo: 0x80, hi: 0x80}, {value: 0x0018, lo: 0x81, hi: 0x81}, @@ -3683,20 +3838,20 @@ var idnaSparseValues = [2146]valueRange{ {value: 0x0008, lo: 0x90, hi: 0xb5}, {value: 0x3308, lo: 0xb6, hi: 0xba}, {value: 0x0040, lo: 0xbb, hi: 0xbf}, - // Block 0x90, offset 0x476 + // Block 0x92, offset 0x480 {value: 0x0000, lo: 0x04}, {value: 0x0008, lo: 0x80, hi: 0x9d}, {value: 0x0040, lo: 0x9e, hi: 0x9e}, {value: 0x0018, lo: 0x9f, hi: 0x9f}, {value: 0x0008, lo: 0xa0, hi: 0xbf}, - // Block 0x91, offset 0x47b + // Block 0x93, offset 0x485 {value: 0x0000, lo: 0x05}, {value: 0x0008, lo: 0x80, hi: 0x83}, {value: 0x0040, lo: 0x84, hi: 0x87}, {value: 0x0008, lo: 0x88, hi: 0x8f}, {value: 0x0018, lo: 0x90, hi: 0x95}, {value: 0x0040, lo: 0x96, hi: 0xbf}, - // Block 0x92, offset 0x481 + // Block 0x94, offset 0x48b {value: 0x0000, lo: 0x06}, {value: 0xe145, lo: 0x80, hi: 0x87}, {value: 0xe1c5, lo: 0x88, hi: 0x8f}, @@ -3704,7 +3859,7 @@ var idnaSparseValues = [2146]valueRange{ {value: 0x8b0d, lo: 0x98, hi: 0x9f}, {value: 0x8b25, lo: 0xa0, hi: 0xa7}, {value: 0x0008, lo: 0xa8, hi: 0xbf}, - // Block 0x93, offset 0x488 + // Block 0x95, offset 0x492 {value: 0x0000, lo: 0x06}, {value: 0x0008, lo: 0x80, hi: 0x9d}, {value: 0x0040, lo: 0x9e, hi: 0x9f}, @@ -3712,7 +3867,7 @@ var idnaSparseValues = [2146]valueRange{ {value: 0x0040, lo: 0xaa, hi: 0xaf}, {value: 0x8b25, lo: 0xb0, hi: 0xb7}, {value: 0x8b0d, lo: 0xb8, hi: 0xbf}, - // Block 0x94, offset 0x48f + // Block 0x96, offset 0x499 {value: 0x0000, lo: 0x06}, {value: 0xe145, lo: 0x80, hi: 0x87}, {value: 0xe1c5, lo: 0x88, hi: 0x8f}, @@ -3720,28 +3875,28 @@ var idnaSparseValues = [2146]valueRange{ {value: 0x0040, lo: 0x94, hi: 0x97}, {value: 0x0008, lo: 0x98, hi: 0xbb}, {value: 0x0040, lo: 0xbc, hi: 0xbf}, - // Block 0x95, offset 0x496 + // Block 0x97, offset 0x4a0 {value: 0x0000, lo: 0x03}, {value: 0x0008, lo: 0x80, hi: 0xa7}, {value: 0x0040, lo: 0xa8, hi: 0xaf}, {value: 0x0008, lo: 0xb0, hi: 0xbf}, - // Block 0x96, offset 0x49a + // Block 0x98, offset 0x4a4 {value: 0x0000, lo: 0x04}, {value: 0x0008, lo: 0x80, hi: 0xa3}, {value: 0x0040, lo: 0xa4, hi: 0xae}, {value: 0x0018, lo: 0xaf, hi: 0xaf}, {value: 0x0040, lo: 0xb0, hi: 0xbf}, - // Block 0x97, offset 0x49f + // Block 0x99, offset 0x4a9 {value: 0x0000, lo: 0x02}, {value: 0x0008, lo: 0x80, hi: 0xb6}, {value: 0x0040, lo: 0xb7, hi: 0xbf}, - // Block 0x98, offset 0x4a2 + // Block 0x9a, offset 0x4ac {value: 0x0000, lo: 0x04}, {value: 0x0008, lo: 0x80, hi: 0x95}, {value: 0x0040, lo: 0x96, hi: 0x9f}, {value: 0x0008, lo: 0xa0, hi: 0xa7}, {value: 0x0040, lo: 0xa8, hi: 0xbf}, - // Block 0x99, offset 0x4a7 + // Block 0x9b, offset 0x4b1 {value: 0x0000, lo: 0x0b}, {value: 0x0808, lo: 0x80, hi: 0x85}, {value: 0x0040, lo: 0x86, hi: 0x87}, @@ -3754,20 +3909,20 @@ var idnaSparseValues = [2146]valueRange{ {value: 0x0808, lo: 0xbc, hi: 0xbc}, {value: 0x0040, lo: 0xbd, hi: 0xbe}, {value: 0x0808, lo: 0xbf, hi: 0xbf}, - // Block 0x9a, offset 0x4b3 + // Block 0x9c, offset 0x4bd {value: 0x0000, lo: 0x05}, {value: 0x0808, lo: 0x80, hi: 0x95}, {value: 0x0040, lo: 0x96, hi: 0x96}, {value: 0x0818, lo: 0x97, hi: 0x9f}, {value: 0x0808, lo: 0xa0, hi: 0xb6}, {value: 0x0818, lo: 0xb7, hi: 0xbf}, - // Block 0x9b, offset 0x4b9 + // Block 0x9d, offset 0x4c3 {value: 0x0000, lo: 0x04}, {value: 0x0808, lo: 0x80, hi: 0x9e}, {value: 0x0040, lo: 0x9f, hi: 0xa6}, {value: 0x0818, lo: 0xa7, hi: 0xaf}, {value: 0x0040, lo: 0xb0, hi: 0xbf}, - // Block 0x9c, offset 0x4be + // Block 0x9e, offset 0x4c8 {value: 0x0000, lo: 0x06}, {value: 0x0040, lo: 0x80, hi: 0x9f}, {value: 0x0808, lo: 0xa0, hi: 0xb2}, @@ -3775,7 +3930,7 @@ var idnaSparseValues = [2146]valueRange{ {value: 0x0808, lo: 0xb4, hi: 0xb5}, {value: 0x0040, lo: 0xb6, hi: 0xba}, {value: 0x0818, lo: 0xbb, hi: 0xbf}, - // Block 0x9d, offset 0x4c5 + // Block 0x9f, offset 0x4cf {value: 0x0000, lo: 0x07}, {value: 0x0808, lo: 0x80, hi: 0x95}, {value: 0x0818, lo: 0x96, hi: 0x9b}, @@ -3784,18 +3939,18 @@ var idnaSparseValues = [2146]valueRange{ {value: 0x0808, lo: 0xa0, hi: 0xb9}, {value: 0x0040, lo: 0xba, hi: 0xbe}, {value: 0x0818, lo: 0xbf, hi: 0xbf}, - // Block 0x9e, offset 0x4cd + // Block 0xa0, offset 0x4d7 {value: 0x0000, lo: 0x04}, {value: 0x0808, lo: 0x80, hi: 0xb7}, {value: 0x0040, lo: 0xb8, hi: 0xbb}, {value: 0x0818, lo: 0xbc, hi: 0xbd}, {value: 0x0808, lo: 0xbe, hi: 0xbf}, - // Block 0x9f, offset 0x4d2 + // Block 0xa1, offset 0x4dc {value: 0x0000, lo: 0x03}, {value: 0x0818, lo: 0x80, hi: 0x8f}, {value: 0x0040, lo: 0x90, hi: 0x91}, {value: 0x0818, lo: 0x92, hi: 0xbf}, - // Block 0xa0, offset 0x4d6 + // Block 0xa2, offset 0x4e0 {value: 0x0000, lo: 0x0f}, {value: 0x0808, lo: 0x80, hi: 0x80}, {value: 0x3308, lo: 0x81, hi: 0x83}, @@ -3812,7 +3967,7 @@ var idnaSparseValues = [2146]valueRange{ {value: 0x3308, lo: 0xb8, hi: 0xba}, {value: 0x0040, lo: 0xbb, hi: 0xbe}, {value: 0x3b08, lo: 0xbf, hi: 0xbf}, - // Block 0xa1, offset 0x4e6 + // Block 0xa3, offset 0x4f0 {value: 0x0000, lo: 0x06}, {value: 0x0818, lo: 0x80, hi: 0x88}, {value: 0x0040, lo: 0x89, hi: 0x8f}, @@ -3820,17 +3975,17 @@ var idnaSparseValues = [2146]valueRange{ {value: 0x0040, lo: 0x99, hi: 0x9f}, {value: 0x0808, lo: 0xa0, hi: 0xbc}, {value: 0x0818, lo: 0xbd, hi: 0xbf}, - // Block 0xa2, offset 0x4ed + // Block 0xa4, offset 0x4f7 {value: 0x0000, lo: 0x03}, {value: 0x0808, lo: 0x80, hi: 0x9c}, {value: 0x0818, lo: 0x9d, hi: 0x9f}, {value: 0x0040, lo: 0xa0, hi: 0xbf}, - // Block 0xa3, offset 0x4f1 + // Block 0xa5, offset 0x4fb {value: 0x0000, lo: 0x03}, {value: 0x0808, lo: 0x80, hi: 0xb5}, {value: 0x0040, lo: 0xb6, hi: 0xb8}, {value: 0x0018, lo: 0xb9, hi: 0xbf}, - // Block 0xa4, offset 0x4f5 + // Block 0xa6, offset 0x4ff {value: 0x0000, lo: 0x06}, {value: 0x0808, lo: 0x80, hi: 0x95}, {value: 0x0040, lo: 0x96, hi: 0x97}, @@ -3838,23 +3993,23 @@ var idnaSparseValues = [2146]valueRange{ {value: 0x0808, lo: 0xa0, hi: 0xb2}, {value: 0x0040, lo: 0xb3, hi: 0xb7}, {value: 0x0818, lo: 0xb8, hi: 0xbf}, - // Block 0xa5, offset 0x4fc + // Block 0xa7, offset 0x506 {value: 0x0000, lo: 0x01}, {value: 0x0808, lo: 0x80, hi: 0xbf}, - // Block 0xa6, offset 0x4fe + // Block 0xa8, offset 0x508 {value: 0x0000, lo: 0x02}, {value: 0x0808, lo: 0x80, hi: 0x88}, {value: 0x0040, lo: 0x89, hi: 0xbf}, - // Block 0xa7, offset 0x501 + // Block 0xa9, offset 0x50b {value: 0x0000, lo: 0x02}, {value: 0x03dd, lo: 0x80, hi: 0xb2}, {value: 0x0040, lo: 0xb3, hi: 0xbf}, - // Block 0xa8, offset 0x504 + // Block 0xaa, offset 0x50e {value: 0x0000, lo: 0x03}, {value: 0x0808, lo: 0x80, hi: 0xb2}, {value: 0x0040, lo: 0xb3, hi: 0xb9}, {value: 0x0818, lo: 0xba, hi: 0xbf}, - // Block 0xa9, offset 0x508 + // Block 0xab, offset 0x512 {value: 0x0000, lo: 0x08}, {value: 0x0908, lo: 0x80, hi: 0x80}, {value: 0x0a08, lo: 0x81, hi: 0xa1}, @@ -3864,12 +4019,12 @@ var idnaSparseValues = [2146]valueRange{ {value: 0x0040, lo: 0xa8, hi: 0xaf}, {value: 0x0808, lo: 0xb0, hi: 0xb9}, {value: 0x0040, lo: 0xba, hi: 0xbf}, - // Block 0xaa, offset 0x511 + // Block 0xac, offset 0x51b {value: 0x0000, lo: 0x03}, {value: 0x0040, lo: 0x80, hi: 0x9f}, {value: 0x0818, lo: 0xa0, hi: 0xbe}, {value: 0x0040, lo: 0xbf, hi: 0xbf}, - // Block 0xab, offset 0x515 + // Block 0xad, offset 0x51f {value: 0x0000, lo: 0x07}, {value: 0x0808, lo: 0x80, hi: 0xa9}, {value: 0x0040, lo: 0xaa, hi: 0xaa}, @@ -3878,7 +4033,7 @@ var idnaSparseValues = [2146]valueRange{ {value: 0x0040, lo: 0xae, hi: 0xaf}, {value: 0x0808, lo: 0xb0, hi: 0xb1}, {value: 0x0040, lo: 0xb2, hi: 0xbf}, - // Block 0xac, offset 0x51d + // Block 0xae, offset 0x527 {value: 0x0000, lo: 0x07}, {value: 0x0808, lo: 0x80, hi: 0x9c}, {value: 0x0818, lo: 0x9d, hi: 0xa6}, @@ -3887,7 +4042,7 @@ var idnaSparseValues = [2146]valueRange{ {value: 0x0a08, lo: 0xb0, hi: 0xb2}, {value: 0x0c08, lo: 0xb3, hi: 0xb3}, {value: 0x0a08, lo: 0xb4, hi: 0xbf}, - // Block 0xad, offset 0x525 + // Block 0xaf, offset 0x52f {value: 0x0000, lo: 0x07}, {value: 0x0a08, lo: 0x80, hi: 0x84}, {value: 0x0808, lo: 0x85, hi: 0x85}, @@ -3896,7 +4051,7 @@ var idnaSparseValues = [2146]valueRange{ {value: 0x0c18, lo: 0x94, hi: 0x94}, {value: 0x0818, lo: 0x95, hi: 0x99}, {value: 0x0040, lo: 0x9a, hi: 0xbf}, - // Block 0xae, offset 0x52d + // Block 0xb0, offset 0x537 {value: 0x0000, lo: 0x0b}, {value: 0x0040, lo: 0x80, hi: 0xaf}, {value: 0x0a08, lo: 0xb0, hi: 0xb0}, @@ -3909,7 +4064,7 @@ var idnaSparseValues = [2146]valueRange{ {value: 0x0a08, lo: 0xbb, hi: 0xbc}, {value: 0x0c08, lo: 0xbd, hi: 0xbd}, {value: 0x0a08, lo: 0xbe, hi: 0xbf}, - // Block 0xaf, offset 0x539 + // Block 0xb1, offset 0x543 {value: 0x0000, lo: 0x0b}, {value: 0x0808, lo: 0x80, hi: 0x80}, {value: 0x0a08, lo: 0x81, hi: 0x81}, @@ -3922,14 +4077,14 @@ var idnaSparseValues = [2146]valueRange{ {value: 0x0040, lo: 0x8c, hi: 0x9f}, {value: 0x0808, lo: 0xa0, hi: 0xb6}, {value: 0x0040, lo: 0xb7, hi: 0xbf}, - // Block 0xb0, offset 0x545 + // Block 0xb2, offset 0x54f {value: 0x0000, lo: 0x05}, {value: 0x3008, lo: 0x80, hi: 0x80}, {value: 0x3308, lo: 0x81, hi: 0x81}, {value: 0x3008, lo: 0x82, hi: 0x82}, {value: 0x0008, lo: 0x83, hi: 0xb7}, {value: 0x3308, lo: 0xb8, hi: 0xbf}, - // Block 0xb1, offset 0x54b + // Block 0xb3, offset 0x555 {value: 0x0000, lo: 0x08}, {value: 0x3308, lo: 0x80, hi: 0x85}, {value: 0x3b08, lo: 0x86, hi: 0x86}, @@ -3939,7 +4094,7 @@ var idnaSparseValues = [2146]valueRange{ {value: 0x0008, lo: 0xa6, hi: 0xaf}, {value: 0x0040, lo: 0xb0, hi: 0xbe}, {value: 0x3b08, lo: 0xbf, hi: 0xbf}, - // Block 0xb2, offset 0x554 + // Block 0xb4, offset 0x55e {value: 0x0000, lo: 0x0b}, {value: 0x3308, lo: 0x80, hi: 0x81}, {value: 0x3008, lo: 0x82, hi: 0x82}, @@ -3952,7 +4107,7 @@ var idnaSparseValues = [2146]valueRange{ {value: 0x0018, lo: 0xbb, hi: 0xbc}, {value: 0x0040, lo: 0xbd, hi: 0xbd}, {value: 0x0018, lo: 0xbe, hi: 0xbf}, - // Block 0xb3, offset 0x560 + // Block 0xb5, offset 0x56a {value: 0x0000, lo: 0x06}, {value: 0x0018, lo: 0x80, hi: 0x81}, {value: 0x0040, lo: 0x82, hi: 0x8f}, @@ -3960,7 +4115,7 @@ var idnaSparseValues = [2146]valueRange{ {value: 0x0040, lo: 0xa9, hi: 0xaf}, {value: 0x0008, lo: 0xb0, hi: 0xb9}, {value: 0x0040, lo: 0xba, hi: 0xbf}, - // Block 0xb4, offset 0x567 + // Block 0xb6, offset 0x571 {value: 0x0000, lo: 0x08}, {value: 0x3308, lo: 0x80, hi: 0x82}, {value: 0x0008, lo: 0x83, hi: 0xa6}, @@ -3970,7 +4125,7 @@ var idnaSparseValues = [2146]valueRange{ {value: 0x3b08, lo: 0xb3, hi: 0xb4}, {value: 0x0040, lo: 0xb5, hi: 0xb5}, {value: 0x0008, lo: 0xb6, hi: 0xbf}, - // Block 0xb5, offset 0x570 + // Block 0xb7, offset 0x57a {value: 0x0000, lo: 0x0a}, {value: 0x0018, lo: 0x80, hi: 0x83}, {value: 0x0008, lo: 0x84, hi: 0x84}, @@ -3982,7 +4137,7 @@ var idnaSparseValues = [2146]valueRange{ {value: 0x0018, lo: 0xb4, hi: 0xb5}, {value: 0x0008, lo: 0xb6, hi: 0xb6}, {value: 0x0040, lo: 0xb7, hi: 0xbf}, - // Block 0xb6, offset 0x57b + // Block 0xb8, offset 0x585 {value: 0x0000, lo: 0x06}, {value: 0x3308, lo: 0x80, hi: 0x81}, {value: 0x3008, lo: 0x82, hi: 0x82}, @@ -3990,7 +4145,7 @@ var idnaSparseValues = [2146]valueRange{ {value: 0x3008, lo: 0xb3, hi: 0xb5}, {value: 0x3308, lo: 0xb6, hi: 0xbe}, {value: 0x3008, lo: 0xbf, hi: 0xbf}, - // Block 0xb7, offset 0x582 + // Block 0xb9, offset 0x58c {value: 0x0000, lo: 0x0e}, {value: 0x3808, lo: 0x80, hi: 0x80}, {value: 0x0008, lo: 0x81, hi: 0x84}, @@ -4006,7 +4161,7 @@ var idnaSparseValues = [2146]valueRange{ {value: 0x0040, lo: 0xa0, hi: 0xa0}, {value: 0x0018, lo: 0xa1, hi: 0xb4}, {value: 0x0040, lo: 0xb5, hi: 0xbf}, - // Block 0xb8, offset 0x591 + // Block 0xba, offset 0x59b {value: 0x0000, lo: 0x0c}, {value: 0x0008, lo: 0x80, hi: 0x91}, {value: 0x0040, lo: 0x92, hi: 0x92}, @@ -4020,7 +4175,7 @@ var idnaSparseValues = [2146]valueRange{ {value: 0x0018, lo: 0xb8, hi: 0xbd}, {value: 0x3308, lo: 0xbe, hi: 0xbe}, {value: 0x0040, lo: 0xbf, hi: 0xbf}, - // Block 0xb9, offset 0x59e + // Block 0xbb, offset 0x5a8 {value: 0x0000, lo: 0x0c}, {value: 0x0008, lo: 0x80, hi: 0x86}, {value: 0x0040, lo: 0x87, hi: 0x87}, @@ -4034,7 +4189,7 @@ var idnaSparseValues = [2146]valueRange{ {value: 0x0018, lo: 0xa9, hi: 0xa9}, {value: 0x0040, lo: 0xaa, hi: 0xaf}, {value: 0x0008, lo: 0xb0, hi: 0xbf}, - // Block 0xba, offset 0x5ab + // Block 0xbc, offset 0x5b5 {value: 0x0000, lo: 0x08}, {value: 0x0008, lo: 0x80, hi: 0x9e}, {value: 0x3308, lo: 0x9f, hi: 0x9f}, @@ -4044,12 +4199,12 @@ var idnaSparseValues = [2146]valueRange{ {value: 0x0040, lo: 0xab, hi: 0xaf}, {value: 0x0008, lo: 0xb0, hi: 0xb9}, {value: 0x0040, lo: 0xba, hi: 0xbf}, - // Block 0xbb, offset 0x5b4 + // Block 0xbd, offset 0x5be {value: 0x0000, lo: 0x03}, {value: 0x0008, lo: 0x80, hi: 0xb4}, {value: 0x3008, lo: 0xb5, hi: 0xb7}, {value: 0x3308, lo: 0xb8, hi: 0xbf}, - // Block 0xbc, offset 0x5b8 + // Block 0xbe, offset 0x5c2 {value: 0x0000, lo: 0x0e}, {value: 0x3008, lo: 0x80, hi: 0x81}, {value: 0x3b08, lo: 0x82, hi: 0x82}, @@ -4065,7 +4220,7 @@ var idnaSparseValues = [2146]valueRange{ {value: 0x3308, lo: 0x9e, hi: 0x9e}, {value: 0x0008, lo: 0x9f, hi: 0xa1}, {value: 0x0040, lo: 0xa2, hi: 0xbf}, - // Block 0xbd, offset 0x5c7 + // Block 0xbf, offset 0x5d1 {value: 0x0000, lo: 0x07}, {value: 0x0008, lo: 0x80, hi: 0xaf}, {value: 0x3008, lo: 0xb0, hi: 0xb2}, @@ -4074,7 +4229,7 @@ var idnaSparseValues = [2146]valueRange{ {value: 0x3308, lo: 0xba, hi: 0xba}, {value: 0x3008, lo: 0xbb, hi: 0xbe}, {value: 0x3308, lo: 0xbf, hi: 0xbf}, - // Block 0xbe, offset 0x5cf + // Block 0xc0, offset 0x5d9 {value: 0x0000, lo: 0x0a}, {value: 0x3308, lo: 0x80, hi: 0x80}, {value: 0x3008, lo: 0x81, hi: 0x81}, @@ -4086,7 +4241,7 @@ var idnaSparseValues = [2146]valueRange{ {value: 0x0040, lo: 0x88, hi: 0x8f}, {value: 0x0008, lo: 0x90, hi: 0x99}, {value: 0x0040, lo: 0x9a, hi: 0xbf}, - // Block 0xbf, offset 0x5da + // Block 0xc1, offset 0x5e4 {value: 0x0000, lo: 0x08}, {value: 0x0008, lo: 0x80, hi: 0xae}, {value: 0x3008, lo: 0xaf, hi: 0xb1}, @@ -4096,14 +4251,14 @@ var idnaSparseValues = [2146]valueRange{ {value: 0x3308, lo: 0xbc, hi: 0xbd}, {value: 0x3008, lo: 0xbe, hi: 0xbe}, {value: 0x3b08, lo: 0xbf, hi: 0xbf}, - // Block 0xc0, offset 0x5e3 + // Block 0xc2, offset 0x5ed {value: 0x0000, lo: 0x05}, {value: 0x3308, lo: 0x80, hi: 0x80}, {value: 0x0018, lo: 0x81, hi: 0x97}, {value: 0x0008, lo: 0x98, hi: 0x9b}, {value: 0x3308, lo: 0x9c, hi: 0x9d}, {value: 0x0040, lo: 0x9e, hi: 0xbf}, - // Block 0xc1, offset 0x5e9 + // Block 0xc3, offset 0x5f3 {value: 0x0000, lo: 0x07}, {value: 0x0008, lo: 0x80, hi: 0xaf}, {value: 0x3008, lo: 0xb0, hi: 0xb2}, @@ -4112,7 +4267,7 @@ var idnaSparseValues = [2146]valueRange{ {value: 0x3308, lo: 0xbd, hi: 0xbd}, {value: 0x3008, lo: 0xbe, hi: 0xbe}, {value: 0x3b08, lo: 0xbf, hi: 0xbf}, - // Block 0xc2, offset 0x5f1 + // Block 0xc4, offset 0x5fb {value: 0x0000, lo: 0x08}, {value: 0x3308, lo: 0x80, hi: 0x80}, {value: 0x0018, lo: 0x81, hi: 0x83}, @@ -4122,7 +4277,7 @@ var idnaSparseValues = [2146]valueRange{ {value: 0x0040, lo: 0x9a, hi: 0x9f}, {value: 0x0018, lo: 0xa0, hi: 0xac}, {value: 0x0040, lo: 0xad, hi: 0xbf}, - // Block 0xc3, offset 0x5fa + // Block 0xc5, offset 0x604 {value: 0x0000, lo: 0x0a}, {value: 0x0008, lo: 0x80, hi: 0xaa}, {value: 0x3308, lo: 0xab, hi: 0xab}, @@ -4134,11 +4289,11 @@ var idnaSparseValues = [2146]valueRange{ {value: 0x3308, lo: 0xb7, hi: 0xb7}, {value: 0x0008, lo: 0xb8, hi: 0xb8}, {value: 0x0040, lo: 0xb9, hi: 0xbf}, - // Block 0xc4, offset 0x605 + // Block 0xc6, offset 0x60f {value: 0x0000, lo: 0x02}, {value: 0x0008, lo: 0x80, hi: 0x89}, {value: 0x0040, lo: 0x8a, hi: 0xbf}, - // Block 0xc5, offset 0x608 + // Block 0xc7, offset 0x612 {value: 0x0000, lo: 0x0b}, {value: 0x0008, lo: 0x80, hi: 0x9a}, {value: 0x0040, lo: 0x9b, hi: 0x9c}, @@ -4151,7 +4306,7 @@ var idnaSparseValues = [2146]valueRange{ {value: 0x0040, lo: 0xac, hi: 0xaf}, {value: 0x0008, lo: 0xb0, hi: 0xb9}, {value: 0x0018, lo: 0xba, hi: 0xbf}, - // Block 0xc6, offset 0x614 + // Block 0xc8, offset 0x61e {value: 0x0000, lo: 0x08}, {value: 0x0008, lo: 0x80, hi: 0xab}, {value: 0x3008, lo: 0xac, hi: 0xae}, @@ -4161,17 +4316,17 @@ var idnaSparseValues = [2146]valueRange{ {value: 0x3308, lo: 0xba, hi: 0xba}, {value: 0x0018, lo: 0xbb, hi: 0xbb}, {value: 0x0040, lo: 0xbc, hi: 0xbf}, - // Block 0xc7, offset 0x61d + // Block 0xc9, offset 0x627 {value: 0x0000, lo: 0x02}, {value: 0x0040, lo: 0x80, hi: 0x9f}, {value: 0x049d, lo: 0xa0, hi: 0xbf}, - // Block 0xc8, offset 0x620 + // Block 0xca, offset 0x62a {value: 0x0000, lo: 0x04}, {value: 0x0008, lo: 0x80, hi: 0xa9}, {value: 0x0018, lo: 0xaa, hi: 0xb2}, {value: 0x0040, lo: 0xb3, hi: 0xbe}, {value: 0x0008, lo: 0xbf, hi: 0xbf}, - // Block 0xc9, offset 0x625 + // Block 0xcb, offset 0x62f {value: 0x0000, lo: 0x08}, {value: 0x3008, lo: 0x80, hi: 0x80}, {value: 0x0008, lo: 0x81, hi: 0x81}, @@ -4181,13 +4336,13 @@ var idnaSparseValues = [2146]valueRange{ {value: 0x0040, lo: 0x87, hi: 0x8f}, {value: 0x0008, lo: 0x90, hi: 0x99}, {value: 0x0040, lo: 0x9a, hi: 0xbf}, - // Block 0xca, offset 0x62e + // Block 0xcc, offset 0x638 {value: 0x0000, lo: 0x04}, {value: 0x0040, lo: 0x80, hi: 0x9f}, {value: 0x0008, lo: 0xa0, hi: 0xa7}, {value: 0x0040, lo: 0xa8, hi: 0xa9}, {value: 0x0008, lo: 0xaa, hi: 0xbf}, - // Block 0xcb, offset 0x633 + // Block 0xcd, offset 0x63d {value: 0x0000, lo: 0x0c}, {value: 0x0008, lo: 0x80, hi: 0x90}, {value: 0x3008, lo: 0x91, hi: 0x93}, @@ -4201,7 +4356,7 @@ var idnaSparseValues = [2146]valueRange{ {value: 0x0008, lo: 0xa3, hi: 0xa3}, {value: 0x3008, lo: 0xa4, hi: 0xa4}, {value: 0x0040, lo: 0xa5, hi: 0xbf}, - // Block 0xcc, offset 0x640 + // Block 0xce, offset 0x64a {value: 0x0000, lo: 0x0a}, {value: 0x0008, lo: 0x80, hi: 0x80}, {value: 0x3308, lo: 0x81, hi: 0x8a}, @@ -4213,7 +4368,7 @@ var idnaSparseValues = [2146]valueRange{ {value: 0x0008, lo: 0xba, hi: 0xba}, {value: 0x3308, lo: 0xbb, hi: 0xbe}, {value: 0x0018, lo: 0xbf, hi: 0xbf}, - // Block 0xcd, offset 0x64b + // Block 0xcf, offset 0x655 {value: 0x0000, lo: 0x08}, {value: 0x0018, lo: 0x80, hi: 0x86}, {value: 0x3b08, lo: 0x87, hi: 0x87}, @@ -4223,7 +4378,7 @@ var idnaSparseValues = [2146]valueRange{ {value: 0x3008, lo: 0x97, hi: 0x98}, {value: 0x3308, lo: 0x99, hi: 0x9b}, {value: 0x0008, lo: 0x9c, hi: 0xbf}, - // Block 0xce, offset 0x654 + // Block 0xd0, offset 0x65e {value: 0x0000, lo: 0x09}, {value: 0x0008, lo: 0x80, hi: 0x89}, {value: 0x3308, lo: 0x8a, hi: 0x96}, @@ -4234,11 +4389,11 @@ var idnaSparseValues = [2146]valueRange{ {value: 0x0008, lo: 0x9d, hi: 0x9d}, {value: 0x0018, lo: 0x9e, hi: 0xa2}, {value: 0x0040, lo: 0xa3, hi: 0xbf}, - // Block 0xcf, offset 0x65e + // Block 0xd1, offset 0x668 {value: 0x0000, lo: 0x02}, {value: 0x0008, lo: 0x80, hi: 0xb8}, {value: 0x0040, lo: 0xb9, hi: 0xbf}, - // Block 0xd0, offset 0x661 + // Block 0xd2, offset 0x66b {value: 0x0000, lo: 0x09}, {value: 0x0008, lo: 0x80, hi: 0x88}, {value: 0x0040, lo: 0x89, hi: 0x89}, @@ -4249,7 +4404,7 @@ var idnaSparseValues = [2146]valueRange{ {value: 0x3308, lo: 0xb8, hi: 0xbd}, {value: 0x3008, lo: 0xbe, hi: 0xbe}, {value: 0x3b08, lo: 0xbf, hi: 0xbf}, - // Block 0xd1, offset 0x66b + // Block 0xd3, offset 0x675 {value: 0x0000, lo: 0x08}, {value: 0x0008, lo: 0x80, hi: 0x80}, {value: 0x0018, lo: 0x81, hi: 0x85}, @@ -4259,7 +4414,7 @@ var idnaSparseValues = [2146]valueRange{ {value: 0x0040, lo: 0xad, hi: 0xaf}, {value: 0x0018, lo: 0xb0, hi: 0xb1}, {value: 0x0008, lo: 0xb2, hi: 0xbf}, - // Block 0xd2, offset 0x674 + // Block 0xd4, offset 0x67e {value: 0x0000, lo: 0x0b}, {value: 0x0008, lo: 0x80, hi: 0x8f}, {value: 0x0040, lo: 0x90, hi: 0x91}, @@ -4272,7 +4427,7 @@ var idnaSparseValues = [2146]valueRange{ {value: 0x3008, lo: 0xb4, hi: 0xb4}, {value: 0x3308, lo: 0xb5, hi: 0xb6}, {value: 0x0040, lo: 0xb7, hi: 0xbf}, - // Block 0xd3, offset 0x680 + // Block 0xd5, offset 0x68a {value: 0x0000, lo: 0x0c}, {value: 0x0008, lo: 0x80, hi: 0x86}, {value: 0x0040, lo: 0x87, hi: 0x87}, @@ -4286,7 +4441,7 @@ var idnaSparseValues = [2146]valueRange{ {value: 0x3308, lo: 0xbc, hi: 0xbd}, {value: 0x0040, lo: 0xbe, hi: 0xbe}, {value: 0x3308, lo: 0xbf, hi: 0xbf}, - // Block 0xd4, offset 0x68d + // Block 0xd6, offset 0x697 {value: 0x0000, lo: 0x0c}, {value: 0x3308, lo: 0x80, hi: 0x83}, {value: 0x3b08, lo: 0x84, hi: 0x85}, @@ -4300,7 +4455,7 @@ var idnaSparseValues = [2146]valueRange{ {value: 0x0008, lo: 0xa7, hi: 0xa8}, {value: 0x0040, lo: 0xa9, hi: 0xa9}, {value: 0x0008, lo: 0xaa, hi: 0xbf}, - // Block 0xd5, offset 0x69a + // Block 0xd7, offset 0x6a4 {value: 0x0000, lo: 0x0d}, {value: 0x0008, lo: 0x80, hi: 0x89}, {value: 0x3008, lo: 0x8a, hi: 0x8e}, @@ -4315,7 +4470,7 @@ var idnaSparseValues = [2146]valueRange{ {value: 0x0040, lo: 0x99, hi: 0x9f}, {value: 0x0008, lo: 0xa0, hi: 0xa9}, {value: 0x0040, lo: 0xaa, hi: 0xbf}, - // Block 0xd6, offset 0x6a8 + // Block 0xd8, offset 0x6b2 {value: 0x0000, lo: 0x06}, {value: 0x0040, lo: 0x80, hi: 0x9f}, {value: 0x0008, lo: 0xa0, hi: 0xb2}, @@ -4323,41 +4478,41 @@ var idnaSparseValues = [2146]valueRange{ {value: 0x3008, lo: 0xb5, hi: 0xb6}, {value: 0x0018, lo: 0xb7, hi: 0xb8}, {value: 0x0040, lo: 0xb9, hi: 0xbf}, - // Block 0xd7, offset 0x6af + // Block 0xd9, offset 0x6b9 {value: 0x0000, lo: 0x03}, {value: 0x0040, lo: 0x80, hi: 0xaf}, {value: 0x0008, lo: 0xb0, hi: 0xb0}, {value: 0x0040, lo: 0xb1, hi: 0xbf}, - // Block 0xd8, offset 0x6b3 + // Block 0xda, offset 0x6bd {value: 0x0000, lo: 0x03}, {value: 0x0018, lo: 0x80, hi: 0xb1}, {value: 0x0040, lo: 0xb2, hi: 0xbe}, {value: 0x0018, lo: 0xbf, hi: 0xbf}, - // Block 0xd9, offset 0x6b7 + // Block 0xdb, offset 0x6c1 {value: 0x0000, lo: 0x02}, {value: 0x0008, lo: 0x80, hi: 0x99}, {value: 0x0040, lo: 0x9a, hi: 0xbf}, - // Block 0xda, offset 0x6ba + // Block 0xdc, offset 0x6c4 {value: 0x0000, lo: 0x04}, {value: 0x0018, lo: 0x80, hi: 0xae}, {value: 0x0040, lo: 0xaf, hi: 0xaf}, {value: 0x0018, lo: 0xb0, hi: 0xb4}, {value: 0x0040, lo: 0xb5, hi: 0xbf}, - // Block 0xdb, offset 0x6bf + // Block 0xdd, offset 0x6c9 {value: 0x0000, lo: 0x02}, {value: 0x0008, lo: 0x80, hi: 0x83}, {value: 0x0040, lo: 0x84, hi: 0xbf}, - // Block 0xdc, offset 0x6c2 + // Block 0xde, offset 0x6cc {value: 0x0000, lo: 0x04}, {value: 0x0008, lo: 0x80, hi: 0xae}, {value: 0x0040, lo: 0xaf, hi: 0xaf}, {value: 0x0340, lo: 0xb0, hi: 0xb8}, {value: 0x0040, lo: 0xb9, hi: 0xbf}, - // Block 0xdd, offset 0x6c7 + // Block 0xdf, offset 0x6d1 {value: 0x0000, lo: 0x02}, {value: 0x0008, lo: 0x80, hi: 0x86}, {value: 0x0040, lo: 0x87, hi: 0xbf}, - // Block 0xde, offset 0x6ca + // Block 0xe0, offset 0x6d4 {value: 0x0000, lo: 0x06}, {value: 0x0008, lo: 0x80, hi: 0x9e}, {value: 0x0040, lo: 0x9f, hi: 0x9f}, @@ -4365,7 +4520,7 @@ var idnaSparseValues = [2146]valueRange{ {value: 0x0040, lo: 0xaa, hi: 0xad}, {value: 0x0018, lo: 0xae, hi: 0xaf}, {value: 0x0040, lo: 0xb0, hi: 0xbf}, - // Block 0xdf, offset 0x6d1 + // Block 0xe1, offset 0x6db {value: 0x0000, lo: 0x06}, {value: 0x0040, lo: 0x80, hi: 0x8f}, {value: 0x0008, lo: 0x90, hi: 0xad}, @@ -4373,12 +4528,12 @@ var idnaSparseValues = [2146]valueRange{ {value: 0x3308, lo: 0xb0, hi: 0xb4}, {value: 0x0018, lo: 0xb5, hi: 0xb5}, {value: 0x0040, lo: 0xb6, hi: 0xbf}, - // Block 0xe0, offset 0x6d8 + // Block 0xe2, offset 0x6e2 {value: 0x0000, lo: 0x03}, {value: 0x0008, lo: 0x80, hi: 0xaf}, {value: 0x3308, lo: 0xb0, hi: 0xb6}, {value: 0x0018, lo: 0xb7, hi: 0xbf}, - // Block 0xe1, offset 0x6dc + // Block 0xe3, offset 0x6e6 {value: 0x0000, lo: 0x0a}, {value: 0x0008, lo: 0x80, hi: 0x83}, {value: 0x0018, lo: 0x84, hi: 0x85}, @@ -4390,33 +4545,33 @@ var idnaSparseValues = [2146]valueRange{ {value: 0x0008, lo: 0xa3, hi: 0xb7}, {value: 0x0040, lo: 0xb8, hi: 0xbc}, {value: 0x0008, lo: 0xbd, hi: 0xbf}, - // Block 0xe2, offset 0x6e7 + // Block 0xe4, offset 0x6f1 {value: 0x0000, lo: 0x02}, {value: 0x0008, lo: 0x80, hi: 0x8f}, {value: 0x0040, lo: 0x90, hi: 0xbf}, - // Block 0xe3, offset 0x6ea + // Block 0xe5, offset 0x6f4 {value: 0x0000, lo: 0x02}, {value: 0xe105, lo: 0x80, hi: 0x9f}, {value: 0x0008, lo: 0xa0, hi: 0xbf}, - // Block 0xe4, offset 0x6ed + // Block 0xe6, offset 0x6f7 {value: 0x0000, lo: 0x02}, {value: 0x0018, lo: 0x80, hi: 0x9a}, {value: 0x0040, lo: 0x9b, hi: 0xbf}, - // Block 0xe5, offset 0x6f0 + // Block 0xe7, offset 0x6fa {value: 0x0000, lo: 0x05}, {value: 0x0008, lo: 0x80, hi: 0x8a}, {value: 0x0040, lo: 0x8b, hi: 0x8e}, {value: 0x3308, lo: 0x8f, hi: 0x8f}, {value: 0x0008, lo: 0x90, hi: 0x90}, {value: 0x3008, lo: 0x91, hi: 0xbf}, - // Block 0xe6, offset 0x6f6 + // Block 0xe8, offset 0x700 {value: 0x0000, lo: 0x05}, {value: 0x3008, lo: 0x80, hi: 0x87}, {value: 0x0040, lo: 0x88, hi: 0x8e}, {value: 0x3308, lo: 0x8f, hi: 0x92}, {value: 0x0008, lo: 0x93, hi: 0x9f}, {value: 0x0040, lo: 0xa0, hi: 0xbf}, - // Block 0xe7, offset 0x6fc + // Block 0xe9, offset 0x706 {value: 0x0000, lo: 0x08}, {value: 0x0040, lo: 0x80, hi: 0x9f}, {value: 0x0008, lo: 0xa0, hi: 0xa1}, @@ -4426,23 +4581,23 @@ var idnaSparseValues = [2146]valueRange{ {value: 0x0040, lo: 0xa5, hi: 0xaf}, {value: 0x3008, lo: 0xb0, hi: 0xb1}, {value: 0x0040, lo: 0xb2, hi: 0xbf}, - // Block 0xe8, offset 0x705 + // Block 0xea, offset 0x70f {value: 0x0000, lo: 0x02}, {value: 0x0008, lo: 0x80, hi: 0xb7}, {value: 0x0040, lo: 0xb8, hi: 0xbf}, - // Block 0xe9, offset 0x708 + // Block 0xeb, offset 0x712 {value: 0x0000, lo: 0x02}, {value: 0x0008, lo: 0x80, hi: 0x95}, {value: 0x0040, lo: 0x96, hi: 0xbf}, - // Block 0xea, offset 0x70b + // Block 0xec, offset 0x715 {value: 0x0000, lo: 0x02}, {value: 0x0008, lo: 0x80, hi: 0x88}, {value: 0x0040, lo: 0x89, hi: 0xbf}, - // Block 0xeb, offset 0x70e + // Block 0xed, offset 0x718 {value: 0x0000, lo: 0x02}, {value: 0x0008, lo: 0x80, hi: 0x9e}, {value: 0x0040, lo: 0x9f, hi: 0xbf}, - // Block 0xec, offset 0x711 + // Block 0xee, offset 0x71b {value: 0x0000, lo: 0x06}, {value: 0x0040, lo: 0x80, hi: 0x8f}, {value: 0x0008, lo: 0x90, hi: 0x92}, @@ -4450,17 +4605,17 @@ var idnaSparseValues = [2146]valueRange{ {value: 0x0008, lo: 0xa4, hi: 0xa7}, {value: 0x0040, lo: 0xa8, hi: 0xaf}, {value: 0x0008, lo: 0xb0, hi: 0xbf}, - // Block 0xed, offset 0x718 + // Block 0xef, offset 0x722 {value: 0x0000, lo: 0x02}, {value: 0x0008, lo: 0x80, hi: 0xbb}, {value: 0x0040, lo: 0xbc, hi: 0xbf}, - // Block 0xee, offset 0x71b + // Block 0xf0, offset 0x725 {value: 0x0000, lo: 0x04}, {value: 0x0008, lo: 0x80, hi: 0xaa}, {value: 0x0040, lo: 0xab, hi: 0xaf}, {value: 0x0008, lo: 0xb0, hi: 0xbc}, {value: 0x0040, lo: 0xbd, hi: 0xbf}, - // Block 0xef, offset 0x720 + // Block 0xf1, offset 0x72a {value: 0x0000, lo: 0x09}, {value: 0x0008, lo: 0x80, hi: 0x88}, {value: 0x0040, lo: 0x89, hi: 0x8f}, @@ -4471,32 +4626,32 @@ var idnaSparseValues = [2146]valueRange{ {value: 0x0018, lo: 0x9f, hi: 0x9f}, {value: 0x03c0, lo: 0xa0, hi: 0xa3}, {value: 0x0040, lo: 0xa4, hi: 0xbf}, - // Block 0xf0, offset 0x72a + // Block 0xf2, offset 0x734 {value: 0x0000, lo: 0x02}, {value: 0x0018, lo: 0x80, hi: 0xb5}, {value: 0x0040, lo: 0xb6, hi: 0xbf}, - // Block 0xf1, offset 0x72d + // Block 0xf3, offset 0x737 {value: 0x0000, lo: 0x03}, {value: 0x0018, lo: 0x80, hi: 0xa6}, {value: 0x0040, lo: 0xa7, hi: 0xa8}, {value: 0x0018, lo: 0xa9, hi: 0xbf}, - // Block 0xf2, offset 0x731 + // Block 0xf4, offset 0x73b {value: 0x0000, lo: 0x0e}, {value: 0x0018, lo: 0x80, hi: 0x9d}, - {value: 0xb609, lo: 0x9e, hi: 0x9e}, - {value: 0xb651, lo: 0x9f, hi: 0x9f}, - {value: 0xb699, lo: 0xa0, hi: 0xa0}, - {value: 0xb701, lo: 0xa1, hi: 0xa1}, - {value: 0xb769, lo: 0xa2, hi: 0xa2}, - {value: 0xb7d1, lo: 0xa3, hi: 0xa3}, - {value: 0xb839, lo: 0xa4, hi: 0xa4}, + {value: 0x2211, lo: 0x9e, hi: 0x9e}, + {value: 0x2219, lo: 0x9f, hi: 0x9f}, + {value: 0x2221, lo: 0xa0, hi: 0xa0}, + {value: 0x2229, lo: 0xa1, hi: 0xa1}, + {value: 0x2231, lo: 0xa2, hi: 0xa2}, + {value: 0x2239, lo: 0xa3, hi: 0xa3}, + {value: 0x2241, lo: 0xa4, hi: 0xa4}, {value: 0x3018, lo: 0xa5, hi: 0xa6}, {value: 0x3318, lo: 0xa7, hi: 0xa9}, {value: 0x0018, lo: 0xaa, hi: 0xac}, {value: 0x3018, lo: 0xad, hi: 0xb2}, {value: 0x0340, lo: 0xb3, hi: 0xba}, {value: 0x3318, lo: 0xbb, hi: 0xbf}, - // Block 0xf3, offset 0x740 + // Block 0xf5, offset 0x74a {value: 0x0000, lo: 0x0b}, {value: 0x3318, lo: 0x80, hi: 0x82}, {value: 0x0018, lo: 0x83, hi: 0x84}, @@ -4504,45 +4659,45 @@ var idnaSparseValues = [2146]valueRange{ {value: 0x0018, lo: 0x8c, hi: 0xa9}, {value: 0x3318, lo: 0xaa, hi: 0xad}, {value: 0x0018, lo: 0xae, hi: 0xba}, - {value: 0xb8a1, lo: 0xbb, hi: 0xbb}, - {value: 0xb8e9, lo: 0xbc, hi: 0xbc}, - {value: 0xb931, lo: 0xbd, hi: 0xbd}, - {value: 0xb999, lo: 0xbe, hi: 0xbe}, - {value: 0xba01, lo: 0xbf, hi: 0xbf}, - // Block 0xf4, offset 0x74c + {value: 0x2249, lo: 0xbb, hi: 0xbb}, + {value: 0x2251, lo: 0xbc, hi: 0xbc}, + {value: 0x2259, lo: 0xbd, hi: 0xbd}, + {value: 0x2261, lo: 0xbe, hi: 0xbe}, + {value: 0x2269, lo: 0xbf, hi: 0xbf}, + // Block 0xf6, offset 0x756 {value: 0x0000, lo: 0x03}, - {value: 0xba69, lo: 0x80, hi: 0x80}, + {value: 0x2271, lo: 0x80, hi: 0x80}, {value: 0x0018, lo: 0x81, hi: 0xa8}, {value: 0x0040, lo: 0xa9, hi: 0xbf}, - // Block 0xf5, offset 0x750 + // Block 0xf7, offset 0x75a {value: 0x0000, lo: 0x04}, {value: 0x0018, lo: 0x80, hi: 0x81}, {value: 0x3318, lo: 0x82, hi: 0x84}, {value: 0x0018, lo: 0x85, hi: 0x85}, {value: 0x0040, lo: 0x86, hi: 0xbf}, - // Block 0xf6, offset 0x755 + // Block 0xf8, offset 0x75f {value: 0x0000, lo: 0x03}, {value: 0x0040, lo: 0x80, hi: 0x9f}, {value: 0x0018, lo: 0xa0, hi: 0xb3}, {value: 0x0040, lo: 0xb4, hi: 0xbf}, - // Block 0xf7, offset 0x759 + // Block 0xf9, offset 0x763 {value: 0x0000, lo: 0x04}, {value: 0x0018, lo: 0x80, hi: 0x96}, {value: 0x0040, lo: 0x97, hi: 0x9f}, {value: 0x0018, lo: 0xa0, hi: 0xb8}, {value: 0x0040, lo: 0xb9, hi: 0xbf}, - // Block 0xf8, offset 0x75e + // Block 0xfa, offset 0x768 {value: 0x0000, lo: 0x03}, {value: 0x3308, lo: 0x80, hi: 0xb6}, {value: 0x0018, lo: 0xb7, hi: 0xba}, {value: 0x3308, lo: 0xbb, hi: 0xbf}, - // Block 0xf9, offset 0x762 + // Block 0xfb, offset 0x76c {value: 0x0000, lo: 0x04}, {value: 0x3308, lo: 0x80, hi: 0xac}, {value: 0x0018, lo: 0xad, hi: 0xb4}, {value: 0x3308, lo: 0xb5, hi: 0xb5}, {value: 0x0018, lo: 0xb6, hi: 0xbf}, - // Block 0xfa, offset 0x767 + // Block 0xfc, offset 0x771 {value: 0x0000, lo: 0x08}, {value: 0x0018, lo: 0x80, hi: 0x83}, {value: 0x3308, lo: 0x84, hi: 0x84}, @@ -4552,7 +4707,7 @@ var idnaSparseValues = [2146]valueRange{ {value: 0x0040, lo: 0xa0, hi: 0xa0}, {value: 0x3308, lo: 0xa1, hi: 0xaf}, {value: 0x0040, lo: 0xb0, hi: 0xbf}, - // Block 0xfb, offset 0x770 + // Block 0xfd, offset 0x77a {value: 0x0000, lo: 0x0a}, {value: 0x3308, lo: 0x80, hi: 0x86}, {value: 0x0040, lo: 0x87, hi: 0x87}, @@ -4564,35 +4719,35 @@ var idnaSparseValues = [2146]valueRange{ {value: 0x0040, lo: 0xa5, hi: 0xa5}, {value: 0x3308, lo: 0xa6, hi: 0xaa}, {value: 0x0040, lo: 0xab, hi: 0xbf}, - // Block 0xfc, offset 0x77b + // Block 0xfe, offset 0x785 {value: 0x0000, lo: 0x05}, {value: 0x0008, lo: 0x80, hi: 0xac}, {value: 0x0040, lo: 0xad, hi: 0xaf}, {value: 0x3308, lo: 0xb0, hi: 0xb6}, {value: 0x0008, lo: 0xb7, hi: 0xbd}, {value: 0x0040, lo: 0xbe, hi: 0xbf}, - // Block 0xfd, offset 0x781 + // Block 0xff, offset 0x78b {value: 0x0000, lo: 0x05}, {value: 0x0008, lo: 0x80, hi: 0x89}, {value: 0x0040, lo: 0x8a, hi: 0x8d}, {value: 0x0008, lo: 0x8e, hi: 0x8e}, {value: 0x0018, lo: 0x8f, hi: 0x8f}, {value: 0x0040, lo: 0x90, hi: 0xbf}, - // Block 0xfe, offset 0x787 + // Block 0x100, offset 0x791 {value: 0x0000, lo: 0x05}, {value: 0x0008, lo: 0x80, hi: 0xab}, {value: 0x3308, lo: 0xac, hi: 0xaf}, {value: 0x0008, lo: 0xb0, hi: 0xb9}, {value: 0x0040, lo: 0xba, hi: 0xbe}, {value: 0x0018, lo: 0xbf, hi: 0xbf}, - // Block 0xff, offset 0x78d + // Block 0x101, offset 0x797 {value: 0x0000, lo: 0x05}, {value: 0x0808, lo: 0x80, hi: 0x84}, {value: 0x0040, lo: 0x85, hi: 0x86}, {value: 0x0818, lo: 0x87, hi: 0x8f}, {value: 0x3308, lo: 0x90, hi: 0x96}, {value: 0x0040, lo: 0x97, hi: 0xbf}, - // Block 0x100, offset 0x793 + // Block 0x102, offset 0x79d {value: 0x0000, lo: 0x08}, {value: 0x0a08, lo: 0x80, hi: 0x83}, {value: 0x3308, lo: 0x84, hi: 0x8a}, @@ -4602,71 +4757,71 @@ var idnaSparseValues = [2146]valueRange{ {value: 0x0040, lo: 0x9a, hi: 0x9d}, {value: 0x0818, lo: 0x9e, hi: 0x9f}, {value: 0x0040, lo: 0xa0, hi: 0xbf}, - // Block 0x101, offset 0x79c + // Block 0x103, offset 0x7a6 {value: 0x0000, lo: 0x02}, {value: 0x0040, lo: 0x80, hi: 0xb0}, {value: 0x0818, lo: 0xb1, hi: 0xbf}, - // Block 0x102, offset 0x79f + // Block 0x104, offset 0x7a9 {value: 0x0000, lo: 0x02}, {value: 0x0818, lo: 0x80, hi: 0xb4}, {value: 0x0040, lo: 0xb5, hi: 0xbf}, - // Block 0x103, offset 0x7a2 + // Block 0x105, offset 0x7ac {value: 0x0000, lo: 0x03}, {value: 0x0040, lo: 0x80, hi: 0x80}, {value: 0x0818, lo: 0x81, hi: 0xbd}, {value: 0x0040, lo: 0xbe, hi: 0xbf}, - // Block 0x104, offset 0x7a6 + // Block 0x106, offset 0x7b0 {value: 0x0000, lo: 0x03}, {value: 0x0040, lo: 0x80, hi: 0xaf}, {value: 0x0018, lo: 0xb0, hi: 0xb1}, {value: 0x0040, lo: 0xb2, hi: 0xbf}, - // Block 0x105, offset 0x7aa + // Block 0x107, offset 0x7b4 {value: 0x0000, lo: 0x03}, {value: 0x0018, lo: 0x80, hi: 0xab}, {value: 0x0040, lo: 0xac, hi: 0xaf}, {value: 0x0018, lo: 0xb0, hi: 0xbf}, - // Block 0x106, offset 0x7ae + // Block 0x108, offset 0x7b8 {value: 0x0000, lo: 0x05}, {value: 0x0018, lo: 0x80, hi: 0x93}, {value: 0x0040, lo: 0x94, hi: 0x9f}, {value: 0x0018, lo: 0xa0, hi: 0xae}, {value: 0x0040, lo: 0xaf, hi: 0xb0}, {value: 0x0018, lo: 0xb1, hi: 0xbf}, - // Block 0x107, offset 0x7b4 + // Block 0x109, offset 0x7be {value: 0x0000, lo: 0x05}, {value: 0x0040, lo: 0x80, hi: 0x80}, {value: 0x0018, lo: 0x81, hi: 0x8f}, {value: 0x0040, lo: 0x90, hi: 0x90}, {value: 0x0018, lo: 0x91, hi: 0xb5}, {value: 0x0040, lo: 0xb6, hi: 0xbf}, - // Block 0x108, offset 0x7ba + // Block 0x10a, offset 0x7c4 {value: 0x0000, lo: 0x04}, {value: 0x0018, lo: 0x80, hi: 0x8f}, - {value: 0xc229, lo: 0x90, hi: 0x90}, + {value: 0x2491, lo: 0x90, hi: 0x90}, {value: 0x0018, lo: 0x91, hi: 0xad}, {value: 0x0040, lo: 0xae, hi: 0xbf}, - // Block 0x109, offset 0x7bf + // Block 0x10b, offset 0x7c9 {value: 0x0000, lo: 0x02}, {value: 0x0040, lo: 0x80, hi: 0xa5}, {value: 0x0018, lo: 0xa6, hi: 0xbf}, - // Block 0x10a, offset 0x7c2 + // Block 0x10c, offset 0x7cc {value: 0x0000, lo: 0x0f}, - {value: 0xc851, lo: 0x80, hi: 0x80}, - {value: 0xc8a1, lo: 0x81, hi: 0x81}, - {value: 0xc8f1, lo: 0x82, hi: 0x82}, - {value: 0xc941, lo: 0x83, hi: 0x83}, - {value: 0xc991, lo: 0x84, hi: 0x84}, - {value: 0xc9e1, lo: 0x85, hi: 0x85}, - {value: 0xca31, lo: 0x86, hi: 0x86}, - {value: 0xca81, lo: 0x87, hi: 0x87}, - {value: 0xcad1, lo: 0x88, hi: 0x88}, + {value: 0x2611, lo: 0x80, hi: 0x80}, + {value: 0x2619, lo: 0x81, hi: 0x81}, + {value: 0x2621, lo: 0x82, hi: 0x82}, + {value: 0x2629, lo: 0x83, hi: 0x83}, + {value: 0x2631, lo: 0x84, hi: 0x84}, + {value: 0x2639, lo: 0x85, hi: 0x85}, + {value: 0x2641, lo: 0x86, hi: 0x86}, + {value: 0x2649, lo: 0x87, hi: 0x87}, + {value: 0x2651, lo: 0x88, hi: 0x88}, {value: 0x0040, lo: 0x89, hi: 0x8f}, - {value: 0xcb21, lo: 0x90, hi: 0x90}, - {value: 0xcb41, lo: 0x91, hi: 0x91}, + {value: 0x2659, lo: 0x90, hi: 0x90}, + {value: 0x2661, lo: 0x91, hi: 0x91}, {value: 0x0040, lo: 0x92, hi: 0x9f}, {value: 0x0018, lo: 0xa0, hi: 0xa5}, {value: 0x0040, lo: 0xa6, hi: 0xbf}, - // Block 0x10b, offset 0x7d2 + // Block 0x10d, offset 0x7dc {value: 0x0000, lo: 0x06}, {value: 0x0018, lo: 0x80, hi: 0x97}, {value: 0x0040, lo: 0x98, hi: 0x9f}, @@ -4674,29 +4829,29 @@ var idnaSparseValues = [2146]valueRange{ {value: 0x0040, lo: 0xad, hi: 0xaf}, {value: 0x0018, lo: 0xb0, hi: 0xbc}, {value: 0x0040, lo: 0xbd, hi: 0xbf}, - // Block 0x10c, offset 0x7d9 + // Block 0x10e, offset 0x7e3 {value: 0x0000, lo: 0x02}, {value: 0x0018, lo: 0x80, hi: 0xb3}, {value: 0x0040, lo: 0xb4, hi: 0xbf}, - // Block 0x10d, offset 0x7dc + // Block 0x10f, offset 0x7e6 {value: 0x0000, lo: 0x04}, {value: 0x0018, lo: 0x80, hi: 0x98}, {value: 0x0040, lo: 0x99, hi: 0x9f}, {value: 0x0018, lo: 0xa0, hi: 0xab}, {value: 0x0040, lo: 0xac, hi: 0xbf}, - // Block 0x10e, offset 0x7e1 + // Block 0x110, offset 0x7eb {value: 0x0000, lo: 0x03}, {value: 0x0018, lo: 0x80, hi: 0x8b}, {value: 0x0040, lo: 0x8c, hi: 0x8f}, {value: 0x0018, lo: 0x90, hi: 0xbf}, - // Block 0x10f, offset 0x7e5 + // Block 0x111, offset 0x7ef {value: 0x0000, lo: 0x05}, {value: 0x0018, lo: 0x80, hi: 0x87}, {value: 0x0040, lo: 0x88, hi: 0x8f}, {value: 0x0018, lo: 0x90, hi: 0x99}, {value: 0x0040, lo: 0x9a, hi: 0x9f}, {value: 0x0018, lo: 0xa0, hi: 0xbf}, - // Block 0x110, offset 0x7eb + // Block 0x112, offset 0x7f5 {value: 0x0000, lo: 0x06}, {value: 0x0018, lo: 0x80, hi: 0x87}, {value: 0x0040, lo: 0x88, hi: 0x8f}, @@ -4704,17 +4859,17 @@ var idnaSparseValues = [2146]valueRange{ {value: 0x0040, lo: 0xae, hi: 0xaf}, {value: 0x0018, lo: 0xb0, hi: 0xb1}, {value: 0x0040, lo: 0xb2, hi: 0xbf}, - // Block 0x111, offset 0x7f2 + // Block 0x113, offset 0x7fc {value: 0x0000, lo: 0x03}, {value: 0x0018, lo: 0x80, hi: 0xb8}, {value: 0x0040, lo: 0xb9, hi: 0xb9}, {value: 0x0018, lo: 0xba, hi: 0xbf}, - // Block 0x112, offset 0x7f6 + // Block 0x114, offset 0x800 {value: 0x0000, lo: 0x03}, {value: 0x0018, lo: 0x80, hi: 0x8b}, {value: 0x0040, lo: 0x8c, hi: 0x8c}, {value: 0x0018, lo: 0x8d, hi: 0xbf}, - // Block 0x113, offset 0x7fa + // Block 0x115, offset 0x804 {value: 0x0000, lo: 0x08}, {value: 0x0018, lo: 0x80, hi: 0x93}, {value: 0x0040, lo: 0x94, hi: 0x9f}, @@ -4724,7 +4879,7 @@ var idnaSparseValues = [2146]valueRange{ {value: 0x0040, lo: 0xb5, hi: 0xb7}, {value: 0x0018, lo: 0xb8, hi: 0xba}, {value: 0x0040, lo: 0xbb, hi: 0xbf}, - // Block 0x114, offset 0x803 + // Block 0x116, offset 0x80d {value: 0x0000, lo: 0x06}, {value: 0x0018, lo: 0x80, hi: 0x86}, {value: 0x0040, lo: 0x87, hi: 0x8f}, @@ -4732,109 +4887,74 @@ var idnaSparseValues = [2146]valueRange{ {value: 0x0040, lo: 0xa9, hi: 0xaf}, {value: 0x0018, lo: 0xb0, hi: 0xb6}, {value: 0x0040, lo: 0xb7, hi: 0xbf}, - // Block 0x115, offset 0x80a + // Block 0x117, offset 0x814 {value: 0x0000, lo: 0x04}, {value: 0x0018, lo: 0x80, hi: 0x82}, {value: 0x0040, lo: 0x83, hi: 0x8f}, {value: 0x0018, lo: 0x90, hi: 0x96}, {value: 0x0040, lo: 0x97, hi: 0xbf}, - // Block 0x116, offset 0x80f + // Block 0x118, offset 0x819 {value: 0x0000, lo: 0x03}, {value: 0x0018, lo: 0x80, hi: 0x92}, {value: 0x0040, lo: 0x93, hi: 0x93}, {value: 0x0018, lo: 0x94, hi: 0xbf}, - // Block 0x117, offset 0x813 + // Block 0x119, offset 0x81d {value: 0x0000, lo: 0x0d}, {value: 0x0018, lo: 0x80, hi: 0x8a}, {value: 0x0040, lo: 0x8b, hi: 0xaf}, - {value: 0x1f41, lo: 0xb0, hi: 0xb0}, - {value: 0x00c9, lo: 0xb1, hi: 0xb1}, - {value: 0x0069, lo: 0xb2, hi: 0xb2}, - {value: 0x0079, lo: 0xb3, hi: 0xb3}, - {value: 0x1f51, lo: 0xb4, hi: 0xb4}, - {value: 0x1f61, lo: 0xb5, hi: 0xb5}, - {value: 0x1f71, lo: 0xb6, hi: 0xb6}, - {value: 0x1f81, lo: 0xb7, hi: 0xb7}, - {value: 0x1f91, lo: 0xb8, hi: 0xb8}, - {value: 0x1fa1, lo: 0xb9, hi: 0xb9}, + {value: 0x06e1, lo: 0xb0, hi: 0xb0}, + {value: 0x0049, lo: 0xb1, hi: 0xb1}, + {value: 0x0029, lo: 0xb2, hi: 0xb2}, + {value: 0x0031, lo: 0xb3, hi: 0xb3}, + {value: 0x06e9, lo: 0xb4, hi: 0xb4}, + {value: 0x06f1, lo: 0xb5, hi: 0xb5}, + {value: 0x06f9, lo: 0xb6, hi: 0xb6}, + {value: 0x0701, lo: 0xb7, hi: 0xb7}, + {value: 0x0709, lo: 0xb8, hi: 0xb8}, + {value: 0x0711, lo: 0xb9, hi: 0xb9}, {value: 0x0040, lo: 0xba, hi: 0xbf}, - // Block 0x118, offset 0x821 + // Block 0x11a, offset 0x82b {value: 0x0000, lo: 0x02}, {value: 0x0008, lo: 0x80, hi: 0x9d}, {value: 0x0040, lo: 0x9e, hi: 0xbf}, - // Block 0x119, offset 0x824 + // Block 0x11b, offset 0x82e {value: 0x0000, lo: 0x02}, {value: 0x0008, lo: 0x80, hi: 0xb4}, {value: 0x0040, lo: 0xb5, hi: 0xbf}, - // Block 0x11a, offset 0x827 + // Block 0x11c, offset 0x831 {value: 0x0000, lo: 0x03}, {value: 0x0008, lo: 0x80, hi: 0x9d}, {value: 0x0040, lo: 0x9e, hi: 0x9f}, {value: 0x0008, lo: 0xa0, hi: 0xbf}, - // Block 0x11b, offset 0x82b + // Block 0x11d, offset 0x835 {value: 0x0000, lo: 0x03}, {value: 0x0008, lo: 0x80, hi: 0xa1}, {value: 0x0040, lo: 0xa2, hi: 0xaf}, {value: 0x0008, lo: 0xb0, hi: 0xbf}, - // Block 0x11c, offset 0x82f + // Block 0x11e, offset 0x839 {value: 0x0000, lo: 0x02}, {value: 0x0008, lo: 0x80, hi: 0xa0}, {value: 0x0040, lo: 0xa1, hi: 0xbf}, - // Block 0x11d, offset 0x832 - {value: 0x0020, lo: 0x0f}, - {value: 0xdf21, lo: 0x80, hi: 0x89}, - {value: 0x8e35, lo: 0x8a, hi: 0x8a}, - {value: 0xe061, lo: 0x8b, hi: 0x9c}, - {value: 0x8e55, lo: 0x9d, hi: 0x9d}, - {value: 0xe2a1, lo: 0x9e, hi: 0xa2}, - {value: 0x8e75, lo: 0xa3, hi: 0xa3}, - {value: 0xe341, lo: 0xa4, hi: 0xab}, - {value: 0x7f0d, lo: 0xac, hi: 0xac}, - {value: 0xe441, lo: 0xad, hi: 0xaf}, - {value: 0x8e95, lo: 0xb0, hi: 0xb0}, - {value: 0xe4a1, lo: 0xb1, hi: 0xb6}, - {value: 0x8eb5, lo: 0xb7, hi: 0xb9}, - {value: 0xe561, lo: 0xba, hi: 0xba}, - {value: 0x8f15, lo: 0xbb, hi: 0xbb}, - {value: 0xe581, lo: 0xbc, hi: 0xbf}, - // Block 0x11e, offset 0x842 - {value: 0x0020, lo: 0x10}, - {value: 0x93b5, lo: 0x80, hi: 0x80}, - {value: 0xf101, lo: 0x81, hi: 0x86}, - {value: 0x93d5, lo: 0x87, hi: 0x8a}, - {value: 0xda61, lo: 0x8b, hi: 0x8b}, - {value: 0xf1c1, lo: 0x8c, hi: 0x96}, - {value: 0x9455, lo: 0x97, hi: 0x97}, - {value: 0xf321, lo: 0x98, hi: 0xa3}, - {value: 0x9475, lo: 0xa4, hi: 0xa6}, - {value: 0xf4a1, lo: 0xa7, hi: 0xaa}, - {value: 0x94d5, lo: 0xab, hi: 0xab}, - {value: 0xf521, lo: 0xac, hi: 0xac}, - {value: 0x94f5, lo: 0xad, hi: 0xad}, - {value: 0xf541, lo: 0xae, hi: 0xaf}, - {value: 0x9515, lo: 0xb0, hi: 0xb1}, - {value: 0xf581, lo: 0xb2, hi: 0xbe}, - {value: 0x2040, lo: 0xbf, hi: 0xbf}, - // Block 0x11f, offset 0x853 + // Block 0x11f, offset 0x83c {value: 0x0000, lo: 0x02}, {value: 0x0008, lo: 0x80, hi: 0x8a}, {value: 0x0040, lo: 0x8b, hi: 0xbf}, - // Block 0x120, offset 0x856 + // Block 0x120, offset 0x83f {value: 0x0000, lo: 0x04}, {value: 0x0040, lo: 0x80, hi: 0x80}, {value: 0x0340, lo: 0x81, hi: 0x81}, {value: 0x0040, lo: 0x82, hi: 0x9f}, {value: 0x0340, lo: 0xa0, hi: 0xbf}, - // Block 0x121, offset 0x85b + // Block 0x121, offset 0x844 {value: 0x0000, lo: 0x01}, {value: 0x0340, lo: 0x80, hi: 0xbf}, - // Block 0x122, offset 0x85d + // Block 0x122, offset 0x846 {value: 0x0000, lo: 0x01}, {value: 0x33c0, lo: 0x80, hi: 0xbf}, - // Block 0x123, offset 0x85f + // Block 0x123, offset 0x848 {value: 0x0000, lo: 0x02}, {value: 0x33c0, lo: 0x80, hi: 0xaf}, {value: 0x0040, lo: 0xb0, hi: 0xbf}, } -// Total table size 43370 bytes (42KiB); checksum: EBD909C0 +// Total table size 44953 bytes (43KiB); checksum: D51909DD diff --git a/vendor/golang.org/x/net/idna/tables15.0.0.go b/vendor/golang.org/x/net/idna/tables15.0.0.go new file mode 100644 index 00000000..40033778 --- /dev/null +++ b/vendor/golang.org/x/net/idna/tables15.0.0.go @@ -0,0 +1,5145 @@ +// Code generated by running "go generate" in golang.org/x/text. DO NOT EDIT. + +//go:build go1.21 +// +build go1.21 + +package idna + +// UnicodeVersion is the Unicode version from which the tables in this package are derived. +const UnicodeVersion = "15.0.0" + +var mappings string = "" + // Size: 6704 bytes + " ̈a ̄23 ́ ̧1o1⁄41⁄23⁄4i̇l·ʼnsdžⱥⱦhjrwy ̆ ̇ ̊ ̨ ̃ ̋lẍ́ ι; ̈́եւاٴوٴۇٴيٴक" + + "़ख़ग़ज़ड़ढ़फ़य़ড়ঢ়য়ਲ਼ਸ਼ਖ਼ਗ਼ਜ਼ਫ਼ଡ଼ଢ଼ําໍາຫນຫມགྷཌྷདྷབྷཛྷཀྵཱཱིུྲྀྲཱྀླྀླཱ" + + "ཱྀྀྒྷྜྷྡྷྦྷྫྷྐྵвдостъѣæbdeǝgikmnȣptuɐɑəɛɜŋɔɯvβγδφχρнɒcɕðfɟɡɥɨɩɪʝɭʟɱɰɲɳ" + + "ɴɵɸʂʃƫʉʊʋʌzʐʑʒθssάέήίόύώἀιἁιἂιἃιἄιἅιἆιἇιἠιἡιἢιἣιἤιἥιἦιἧιὠιὡιὢιὣιὤιὥιὦιὧ" + + "ιὰιαιάιᾶιι ̈͂ὴιηιήιῆι ̓̀ ̓́ ̓͂ΐ ̔̀ ̔́ ̔͂ΰ ̈̀`ὼιωιώιῶι′′′′′‵‵‵‵‵!!???!!?" + + "′′′′0456789+=()rsħnoqsmtmωåאבגדπ1⁄71⁄91⁄101⁄32⁄31⁄52⁄53⁄54⁄51⁄65⁄61⁄83" + + "⁄85⁄87⁄81⁄iiivviviiiixxi0⁄3∫∫∫∫∫∮∮∮∮∮1011121314151617181920(10)(11)(12" + + ")(13)(14)(15)(16)(17)(18)(19)(20)∫∫∫∫==⫝̸ɫɽȿɀ. ゙ ゚よりコト(ᄀ)(ᄂ)(ᄃ)(ᄅ)(ᄆ)(ᄇ)" + + "(ᄉ)(ᄋ)(ᄌ)(ᄎ)(ᄏ)(ᄐ)(ᄑ)(ᄒ)(가)(나)(다)(라)(마)(바)(사)(아)(자)(차)(카)(타)(파)(하)(주)(오전" + + ")(오후)(一)(二)(三)(四)(五)(六)(七)(八)(九)(十)(月)(火)(水)(木)(金)(土)(日)(株)(有)(社)(名)(特)(" + + "財)(祝)(労)(代)(呼)(学)(監)(企)(資)(協)(祭)(休)(自)(至)21222324252627282930313233343" + + "5참고주의3637383940414243444546474849501月2月3月4月5月6月7月8月9月10月11月12月hgev令和アパート" + + "アルファアンペアアールイニングインチウォンエスクードエーカーオンスオームカイリカラットカロリーガロンガンマギガギニーキュリーギルダーキロキロ" + + "グラムキロメートルキロワットグラムグラムトンクルゼイロクローネケースコルナコーポサイクルサンチームシリングセンチセントダースデシドルトンナノ" + + "ノットハイツパーセントパーツバーレルピアストルピクルピコビルファラッドフィートブッシェルフランヘクタールペソペニヒヘルツペンスページベータポ" + + "イントボルトホンポンドホールホーンマイクロマイルマッハマルクマンションミクロンミリミリバールメガメガトンメートルヤードヤールユアンリットルリ" + + "ラルピールーブルレムレントゲンワット0点1点2点3点4点5点6点7点8点9点10点11点12点13点14点15点16点17点18点19点20" + + "点21点22点23点24点daauovpcdmiu平成昭和大正明治株式会社panamakakbmbgbkcalpfnfmgkghzmldlk" + + "lfmnmmmcmkmm2m3m∕sm∕s2rad∕srad∕s2psnsmspvnvmvkvpwnwmwkwbqcccdc∕kgdbgyhah" + + "pinkkktlmlnlxphprsrsvwbv∕ma∕m1日2日3日4日5日6日7日8日9日10日11日12日13日14日15日16日17日1" + + "8日19日20日21日22日23日24日25日26日27日28日29日30日31日ьɦɬʞʇœʍ𤋮𢡊𢡄𣏕𥉉𥳐𧻓fffiflstմնմեմիվնմ" + + "խיִײַעהכלםרתשׁשׂשּׁשּׂאַאָאּבּגּדּהּוּזּטּיּךּכּלּמּנּסּףּפּצּקּרּשּתּו" + + "ֹבֿכֿפֿאלٱٻپڀٺٿٹڤڦڄڃچڇڍڌڎڈژڑکگڳڱںڻۀہھےۓڭۇۆۈۋۅۉېىئائەئوئۇئۆئۈئېئىیئجئحئم" + + "ئيبجبحبخبمبىبيتجتحتختمتىتيثجثمثىثيجحجمحجحمخجخحخمسجسحسخسمصحصمضجضحضخضمطحط" + + "مظمعجعمغجغمفجفحفخفمفىفيقحقمقىقيكاكجكحكخكلكمكىكيلجلحلخلملىليمجمحمخمممىمي" + + "نجنحنخنمنىنيهجهمهىهييجيحيخيميىييذٰرٰىٰ ٌّ ٍّ َّ ُّ ِّ ّٰئرئزئنبربزبنترت" + + "زتنثرثزثنمانرنزننيريزينئخئهبهتهصخلهنههٰيهثهسهشمشهـَّـُّـِّطىطيعىعيغىغيس" + + "ىسيشىشيحىحيجىجيخىخيصىصيضىضيشجشحشخشرسرصرضراًتجمتحجتحمتخمتمجتمحتمخجمححميح" + + "مىسحجسجحسجىسمحسمجسممصححصممشحمشجيشمخشممضحىضخمطمحطممطميعجمعممعمىغممغميغمى" + + "فخمقمحقمملحملحيلحىلججلخملمحمحجمحممحيمجحمجممخجمخممجخهمجهممنحمنحىنجمنجىنم" + + "ينمىيممبخيتجيتجىتخيتخىتميتمىجميجحىجمىسخىصحيشحيضحيلجيلمييحييجييميمميقمين" + + "حيعميكمينجحمخيلجمكممجحيحجيمجيفميبحيسخينجيصلےقلےاللهاكبرمحمدصلعمرسولعليه" + + "وسلمصلىصلى الله عليه وسلمجل جلالهریال,:!?_{}[]#&*-<>\\$%@ـًـَـُـِـّـْءآ" + + "أؤإئابةتثجحخدذرزسشصضطظعغفقكلمنهويلآلألإلا\x22'/^|~¢£¬¦¥ːˑʙɓʣꭦʥʤɖɗᶑɘɞʩɤɢ" + + "ɠʛʜɧʄʪʫꞎɮʎøɶɷɺɾʀʨʦꭧʧʈⱱʏʡʢʘǀǁǂ𝅗𝅥𝅘𝅥𝅘𝅥𝅮𝅘𝅥𝅯𝅘𝅥𝅰𝅘𝅥𝅱𝅘𝅥𝅲𝆹𝅥𝆺𝅥𝆹𝅥𝅮𝆺𝅥𝅮𝆹𝅥𝅯𝆺𝅥𝅯ıȷαεζηκ" + + "λμνξοστυψ∇∂ϝабгежзиклмпруфхцчшыэюꚉәіјөүӏґѕџҫꙑұٮڡٯ0,1,2,3,4,5,6,7,8,9,(a" + + ")(b)(c)(d)(e)(f)(g)(h)(i)(j)(k)(l)(m)(n)(o)(p)(q)(r)(s)(t)(u)(v)(w)(x)(y" + + ")(z)〔s〕wzhvsdppvwcmcmdmrdjほかココサ手字双デ二多解天交映無料前後再新初終生販声吹演投捕一三遊左中右指走打禁空合満有月申" + + "割営配〔本〕〔三〕〔二〕〔安〕〔点〕〔打〕〔盗〕〔勝〕〔敗〕得可丽丸乁你侮侻倂偺備僧像㒞免兔兤具㒹內冗冤仌冬况凵刃㓟刻剆剷㔕勇勉勤勺包匆北卉" + + "卑博即卽卿灰及叟叫叱吆咞吸呈周咢哶唐啓啣善喙喫喳嗂圖嘆圗噑噴切壮城埴堍型堲報墬売壷夆夢奢姬娛娧姘婦㛮嬈嬾寃寘寧寳寿将尢㞁屠屮峀岍嵃嵮嵫嵼巡巢" + + "㠯巽帨帽幩㡢㡼庰庳庶廊廾舁弢㣇形彫㣣徚忍志忹悁㤺㤜悔惇慈慌慎慺憎憲憤憯懞懲懶成戛扝抱拔捐挽拼捨掃揤搢揅掩㨮摩摾撝摷㩬敏敬旣書晉㬙暑㬈㫤冒冕最" + + "暜肭䏙朗望朡杞杓㭉柺枅桒梅梎栟椔㮝楂榣槪檨櫛㰘次歔㱎歲殟殺殻汎沿泍汧洖派海流浩浸涅洴港湮㴳滋滇淹潮濆瀹瀞瀛㶖灊災灷炭煅熜爨爵牐犀犕獺王㺬玥㺸" + + "瑇瑜瑱璅瓊㼛甤甾異瘐㿼䀈直眞真睊䀹瞋䁆䂖硎碌磌䃣祖福秫䄯穀穊穏䈂篆築䈧糒䊠糨糣紀絣䌁緇縂繅䌴䍙罺羕翺者聠聰䏕育脃䐋脾媵舄辞䑫芑芋芝劳花芳芽苦" + + "若茝荣莭茣莽菧著荓菊菌菜䔫蓱蓳蔖蕤䕝䕡䕫虐虜虧虩蚩蚈蜎蛢蝹蜨蝫螆蟡蠁䗹衠衣裗裞䘵裺㒻䚾䛇誠諭變豕貫賁贛起跋趼跰軔輸邔郱鄑鄛鈸鋗鋘鉼鏹鐕開䦕閷" + + "䧦雃嶲霣䩮䩶韠䪲頋頩飢䬳餩馧駂駾䯎鬒鱀鳽䳎䳭鵧䳸麻䵖黹黾鼅鼏鼖鼻" + +var mappingIndex = []uint16{ // 1729 elements + // Entry 0 - 3F + 0x0000, 0x0000, 0x0001, 0x0004, 0x0005, 0x0008, 0x0009, 0x000a, + 0x000d, 0x0010, 0x0011, 0x0012, 0x0017, 0x001c, 0x0021, 0x0024, + 0x0027, 0x002a, 0x002b, 0x002e, 0x0031, 0x0034, 0x0035, 0x0036, + 0x0037, 0x0038, 0x0039, 0x003c, 0x003f, 0x0042, 0x0045, 0x0048, + 0x004b, 0x004c, 0x004d, 0x0051, 0x0054, 0x0055, 0x005a, 0x005e, + 0x0062, 0x0066, 0x006a, 0x006e, 0x0074, 0x007a, 0x0080, 0x0086, + 0x008c, 0x0092, 0x0098, 0x009e, 0x00a4, 0x00aa, 0x00b0, 0x00b6, + 0x00bc, 0x00c2, 0x00c8, 0x00ce, 0x00d4, 0x00da, 0x00e0, 0x00e6, + // Entry 40 - 7F + 0x00ec, 0x00f2, 0x00f8, 0x00fe, 0x0104, 0x010a, 0x0110, 0x0116, + 0x011c, 0x0122, 0x0128, 0x012e, 0x0137, 0x013d, 0x0146, 0x014c, + 0x0152, 0x0158, 0x015e, 0x0164, 0x016a, 0x0170, 0x0172, 0x0174, + 0x0176, 0x0178, 0x017a, 0x017c, 0x017e, 0x0180, 0x0181, 0x0182, + 0x0183, 0x0185, 0x0186, 0x0187, 0x0188, 0x0189, 0x018a, 0x018c, + 0x018d, 0x018e, 0x018f, 0x0191, 0x0193, 0x0195, 0x0197, 0x0199, + 0x019b, 0x019d, 0x019f, 0x01a0, 0x01a2, 0x01a4, 0x01a6, 0x01a8, + 0x01aa, 0x01ac, 0x01ae, 0x01b0, 0x01b1, 0x01b3, 0x01b5, 0x01b6, + // Entry 80 - BF + 0x01b8, 0x01ba, 0x01bc, 0x01be, 0x01c0, 0x01c2, 0x01c4, 0x01c6, + 0x01c8, 0x01ca, 0x01cc, 0x01ce, 0x01d0, 0x01d2, 0x01d4, 0x01d6, + 0x01d8, 0x01da, 0x01dc, 0x01de, 0x01e0, 0x01e2, 0x01e4, 0x01e5, + 0x01e7, 0x01e9, 0x01eb, 0x01ed, 0x01ef, 0x01f1, 0x01f3, 0x01f5, + 0x01f7, 0x01f9, 0x01fb, 0x01fd, 0x0202, 0x0207, 0x020c, 0x0211, + 0x0216, 0x021b, 0x0220, 0x0225, 0x022a, 0x022f, 0x0234, 0x0239, + 0x023e, 0x0243, 0x0248, 0x024d, 0x0252, 0x0257, 0x025c, 0x0261, + 0x0266, 0x026b, 0x0270, 0x0275, 0x027a, 0x027e, 0x0282, 0x0287, + // Entry C0 - FF + 0x0289, 0x028e, 0x0293, 0x0297, 0x029b, 0x02a0, 0x02a5, 0x02aa, + 0x02af, 0x02b1, 0x02b6, 0x02bb, 0x02c0, 0x02c2, 0x02c7, 0x02c8, + 0x02cd, 0x02d1, 0x02d5, 0x02da, 0x02e0, 0x02e9, 0x02ef, 0x02f8, + 0x02fa, 0x02fc, 0x02fe, 0x0300, 0x030c, 0x030d, 0x030e, 0x030f, + 0x0310, 0x0311, 0x0312, 0x0313, 0x0314, 0x0315, 0x0316, 0x0317, + 0x0319, 0x031b, 0x031d, 0x031e, 0x0320, 0x0322, 0x0324, 0x0326, + 0x0328, 0x032a, 0x032c, 0x032e, 0x0330, 0x0335, 0x033a, 0x0340, + 0x0345, 0x034a, 0x034f, 0x0354, 0x0359, 0x035e, 0x0363, 0x0368, + // Entry 100 - 13F + 0x036d, 0x0372, 0x0377, 0x037c, 0x0380, 0x0382, 0x0384, 0x0386, + 0x038a, 0x038c, 0x038e, 0x0393, 0x0399, 0x03a2, 0x03a8, 0x03b1, + 0x03b3, 0x03b5, 0x03b7, 0x03b9, 0x03bb, 0x03bd, 0x03bf, 0x03c1, + 0x03c3, 0x03c5, 0x03c7, 0x03cb, 0x03cf, 0x03d3, 0x03d7, 0x03db, + 0x03df, 0x03e3, 0x03e7, 0x03eb, 0x03ef, 0x03f3, 0x03ff, 0x0401, + 0x0406, 0x0408, 0x040a, 0x040c, 0x040e, 0x040f, 0x0413, 0x0417, + 0x041d, 0x0423, 0x0428, 0x042d, 0x0432, 0x0437, 0x043c, 0x0441, + 0x0446, 0x044b, 0x0450, 0x0455, 0x045a, 0x045f, 0x0464, 0x0469, + // Entry 140 - 17F + 0x046e, 0x0473, 0x0478, 0x047d, 0x0482, 0x0487, 0x048c, 0x0491, + 0x0496, 0x049b, 0x04a0, 0x04a5, 0x04aa, 0x04af, 0x04b4, 0x04bc, + 0x04c4, 0x04c9, 0x04ce, 0x04d3, 0x04d8, 0x04dd, 0x04e2, 0x04e7, + 0x04ec, 0x04f1, 0x04f6, 0x04fb, 0x0500, 0x0505, 0x050a, 0x050f, + 0x0514, 0x0519, 0x051e, 0x0523, 0x0528, 0x052d, 0x0532, 0x0537, + 0x053c, 0x0541, 0x0546, 0x054b, 0x0550, 0x0555, 0x055a, 0x055f, + 0x0564, 0x0569, 0x056e, 0x0573, 0x0578, 0x057a, 0x057c, 0x057e, + 0x0580, 0x0582, 0x0584, 0x0586, 0x0588, 0x058a, 0x058c, 0x058e, + // Entry 180 - 1BF + 0x0590, 0x0592, 0x0594, 0x0596, 0x059c, 0x05a2, 0x05a4, 0x05a6, + 0x05a8, 0x05aa, 0x05ac, 0x05ae, 0x05b0, 0x05b2, 0x05b4, 0x05b6, + 0x05b8, 0x05ba, 0x05bc, 0x05be, 0x05c0, 0x05c4, 0x05c8, 0x05cc, + 0x05d0, 0x05d4, 0x05d8, 0x05dc, 0x05e0, 0x05e4, 0x05e9, 0x05ee, + 0x05f3, 0x05f5, 0x05f7, 0x05fd, 0x0609, 0x0615, 0x0621, 0x062a, + 0x0636, 0x063f, 0x0648, 0x0657, 0x0663, 0x066c, 0x0675, 0x067e, + 0x068a, 0x0696, 0x069f, 0x06a8, 0x06ae, 0x06b7, 0x06c3, 0x06cf, + 0x06d5, 0x06e4, 0x06f6, 0x0705, 0x070e, 0x071d, 0x072c, 0x0738, + // Entry 1C0 - 1FF + 0x0741, 0x074a, 0x0753, 0x075f, 0x076e, 0x077a, 0x0783, 0x078c, + 0x0795, 0x079b, 0x07a1, 0x07a7, 0x07ad, 0x07b6, 0x07bf, 0x07ce, + 0x07d7, 0x07e3, 0x07f2, 0x07fb, 0x0801, 0x0807, 0x0816, 0x0822, + 0x0831, 0x083a, 0x0849, 0x084f, 0x0858, 0x0861, 0x086a, 0x0873, + 0x087c, 0x0888, 0x0891, 0x0897, 0x08a0, 0x08a9, 0x08b2, 0x08be, + 0x08c7, 0x08d0, 0x08d9, 0x08e8, 0x08f4, 0x08fa, 0x0909, 0x090f, + 0x091b, 0x0927, 0x0930, 0x0939, 0x0942, 0x094e, 0x0954, 0x095d, + 0x0969, 0x096f, 0x097e, 0x0987, 0x098b, 0x098f, 0x0993, 0x0997, + // Entry 200 - 23F + 0x099b, 0x099f, 0x09a3, 0x09a7, 0x09ab, 0x09af, 0x09b4, 0x09b9, + 0x09be, 0x09c3, 0x09c8, 0x09cd, 0x09d2, 0x09d7, 0x09dc, 0x09e1, + 0x09e6, 0x09eb, 0x09f0, 0x09f5, 0x09fa, 0x09fc, 0x09fe, 0x0a00, + 0x0a02, 0x0a04, 0x0a06, 0x0a0c, 0x0a12, 0x0a18, 0x0a1e, 0x0a2a, + 0x0a2c, 0x0a2e, 0x0a30, 0x0a32, 0x0a34, 0x0a36, 0x0a38, 0x0a3c, + 0x0a3e, 0x0a40, 0x0a42, 0x0a44, 0x0a46, 0x0a48, 0x0a4a, 0x0a4c, + 0x0a4e, 0x0a50, 0x0a52, 0x0a54, 0x0a56, 0x0a58, 0x0a5a, 0x0a5f, + 0x0a65, 0x0a6c, 0x0a74, 0x0a76, 0x0a78, 0x0a7a, 0x0a7c, 0x0a7e, + // Entry 240 - 27F + 0x0a80, 0x0a82, 0x0a84, 0x0a86, 0x0a88, 0x0a8a, 0x0a8c, 0x0a8e, + 0x0a90, 0x0a96, 0x0a98, 0x0a9a, 0x0a9c, 0x0a9e, 0x0aa0, 0x0aa2, + 0x0aa4, 0x0aa6, 0x0aa8, 0x0aaa, 0x0aac, 0x0aae, 0x0ab0, 0x0ab2, + 0x0ab4, 0x0ab9, 0x0abe, 0x0ac2, 0x0ac6, 0x0aca, 0x0ace, 0x0ad2, + 0x0ad6, 0x0ada, 0x0ade, 0x0ae2, 0x0ae7, 0x0aec, 0x0af1, 0x0af6, + 0x0afb, 0x0b00, 0x0b05, 0x0b0a, 0x0b0f, 0x0b14, 0x0b19, 0x0b1e, + 0x0b23, 0x0b28, 0x0b2d, 0x0b32, 0x0b37, 0x0b3c, 0x0b41, 0x0b46, + 0x0b4b, 0x0b50, 0x0b52, 0x0b54, 0x0b56, 0x0b58, 0x0b5a, 0x0b5c, + // Entry 280 - 2BF + 0x0b5e, 0x0b62, 0x0b66, 0x0b6a, 0x0b6e, 0x0b72, 0x0b76, 0x0b7a, + 0x0b7c, 0x0b7e, 0x0b80, 0x0b82, 0x0b86, 0x0b8a, 0x0b8e, 0x0b92, + 0x0b96, 0x0b9a, 0x0b9e, 0x0ba0, 0x0ba2, 0x0ba4, 0x0ba6, 0x0ba8, + 0x0baa, 0x0bac, 0x0bb0, 0x0bb4, 0x0bba, 0x0bc0, 0x0bc4, 0x0bc8, + 0x0bcc, 0x0bd0, 0x0bd4, 0x0bd8, 0x0bdc, 0x0be0, 0x0be4, 0x0be8, + 0x0bec, 0x0bf0, 0x0bf4, 0x0bf8, 0x0bfc, 0x0c00, 0x0c04, 0x0c08, + 0x0c0c, 0x0c10, 0x0c14, 0x0c18, 0x0c1c, 0x0c20, 0x0c24, 0x0c28, + 0x0c2c, 0x0c30, 0x0c34, 0x0c36, 0x0c38, 0x0c3a, 0x0c3c, 0x0c3e, + // Entry 2C0 - 2FF + 0x0c40, 0x0c42, 0x0c44, 0x0c46, 0x0c48, 0x0c4a, 0x0c4c, 0x0c4e, + 0x0c50, 0x0c52, 0x0c54, 0x0c56, 0x0c58, 0x0c5a, 0x0c5c, 0x0c5e, + 0x0c60, 0x0c62, 0x0c64, 0x0c66, 0x0c68, 0x0c6a, 0x0c6c, 0x0c6e, + 0x0c70, 0x0c72, 0x0c74, 0x0c76, 0x0c78, 0x0c7a, 0x0c7c, 0x0c7e, + 0x0c80, 0x0c82, 0x0c86, 0x0c8a, 0x0c8e, 0x0c92, 0x0c96, 0x0c9a, + 0x0c9e, 0x0ca2, 0x0ca4, 0x0ca8, 0x0cac, 0x0cb0, 0x0cb4, 0x0cb8, + 0x0cbc, 0x0cc0, 0x0cc4, 0x0cc8, 0x0ccc, 0x0cd0, 0x0cd4, 0x0cd8, + 0x0cdc, 0x0ce0, 0x0ce4, 0x0ce8, 0x0cec, 0x0cf0, 0x0cf4, 0x0cf8, + // Entry 300 - 33F + 0x0cfc, 0x0d00, 0x0d04, 0x0d08, 0x0d0c, 0x0d10, 0x0d14, 0x0d18, + 0x0d1c, 0x0d20, 0x0d24, 0x0d28, 0x0d2c, 0x0d30, 0x0d34, 0x0d38, + 0x0d3c, 0x0d40, 0x0d44, 0x0d48, 0x0d4c, 0x0d50, 0x0d54, 0x0d58, + 0x0d5c, 0x0d60, 0x0d64, 0x0d68, 0x0d6c, 0x0d70, 0x0d74, 0x0d78, + 0x0d7c, 0x0d80, 0x0d84, 0x0d88, 0x0d8c, 0x0d90, 0x0d94, 0x0d98, + 0x0d9c, 0x0da0, 0x0da4, 0x0da8, 0x0dac, 0x0db0, 0x0db4, 0x0db8, + 0x0dbc, 0x0dc0, 0x0dc4, 0x0dc8, 0x0dcc, 0x0dd0, 0x0dd4, 0x0dd8, + 0x0ddc, 0x0de0, 0x0de4, 0x0de8, 0x0dec, 0x0df0, 0x0df4, 0x0df8, + // Entry 340 - 37F + 0x0dfc, 0x0e00, 0x0e04, 0x0e08, 0x0e0c, 0x0e10, 0x0e14, 0x0e18, + 0x0e1d, 0x0e22, 0x0e27, 0x0e2c, 0x0e31, 0x0e36, 0x0e3a, 0x0e3e, + 0x0e42, 0x0e46, 0x0e4a, 0x0e4e, 0x0e52, 0x0e56, 0x0e5a, 0x0e5e, + 0x0e62, 0x0e66, 0x0e6a, 0x0e6e, 0x0e72, 0x0e76, 0x0e7a, 0x0e7e, + 0x0e82, 0x0e86, 0x0e8a, 0x0e8e, 0x0e92, 0x0e96, 0x0e9a, 0x0e9e, + 0x0ea2, 0x0ea6, 0x0eaa, 0x0eae, 0x0eb2, 0x0eb6, 0x0ebc, 0x0ec2, + 0x0ec8, 0x0ecc, 0x0ed0, 0x0ed4, 0x0ed8, 0x0edc, 0x0ee0, 0x0ee4, + 0x0ee8, 0x0eec, 0x0ef0, 0x0ef4, 0x0ef8, 0x0efc, 0x0f00, 0x0f04, + // Entry 380 - 3BF + 0x0f08, 0x0f0c, 0x0f10, 0x0f14, 0x0f18, 0x0f1c, 0x0f20, 0x0f24, + 0x0f28, 0x0f2c, 0x0f30, 0x0f34, 0x0f38, 0x0f3e, 0x0f44, 0x0f4a, + 0x0f50, 0x0f56, 0x0f5c, 0x0f62, 0x0f68, 0x0f6e, 0x0f74, 0x0f7a, + 0x0f80, 0x0f86, 0x0f8c, 0x0f92, 0x0f98, 0x0f9e, 0x0fa4, 0x0faa, + 0x0fb0, 0x0fb6, 0x0fbc, 0x0fc2, 0x0fc8, 0x0fce, 0x0fd4, 0x0fda, + 0x0fe0, 0x0fe6, 0x0fec, 0x0ff2, 0x0ff8, 0x0ffe, 0x1004, 0x100a, + 0x1010, 0x1016, 0x101c, 0x1022, 0x1028, 0x102e, 0x1034, 0x103a, + 0x1040, 0x1046, 0x104c, 0x1052, 0x1058, 0x105e, 0x1064, 0x106a, + // Entry 3C0 - 3FF + 0x1070, 0x1076, 0x107c, 0x1082, 0x1088, 0x108e, 0x1094, 0x109a, + 0x10a0, 0x10a6, 0x10ac, 0x10b2, 0x10b8, 0x10be, 0x10c4, 0x10ca, + 0x10d0, 0x10d6, 0x10dc, 0x10e2, 0x10e8, 0x10ee, 0x10f4, 0x10fa, + 0x1100, 0x1106, 0x110c, 0x1112, 0x1118, 0x111e, 0x1124, 0x112a, + 0x1130, 0x1136, 0x113c, 0x1142, 0x1148, 0x114e, 0x1154, 0x115a, + 0x1160, 0x1166, 0x116c, 0x1172, 0x1178, 0x1180, 0x1188, 0x1190, + 0x1198, 0x11a0, 0x11a8, 0x11b0, 0x11b6, 0x11d7, 0x11e6, 0x11ee, + 0x11ef, 0x11f0, 0x11f1, 0x11f2, 0x11f3, 0x11f4, 0x11f5, 0x11f6, + // Entry 400 - 43F + 0x11f7, 0x11f8, 0x11f9, 0x11fa, 0x11fb, 0x11fc, 0x11fd, 0x11fe, + 0x11ff, 0x1200, 0x1201, 0x1205, 0x1209, 0x120d, 0x1211, 0x1215, + 0x1219, 0x121b, 0x121d, 0x121f, 0x1221, 0x1223, 0x1225, 0x1227, + 0x1229, 0x122b, 0x122d, 0x122f, 0x1231, 0x1233, 0x1235, 0x1237, + 0x1239, 0x123b, 0x123d, 0x123f, 0x1241, 0x1243, 0x1245, 0x1247, + 0x1249, 0x124b, 0x124d, 0x124f, 0x1251, 0x1253, 0x1255, 0x1257, + 0x1259, 0x125b, 0x125d, 0x125f, 0x1263, 0x1267, 0x126b, 0x126f, + 0x1270, 0x1271, 0x1272, 0x1273, 0x1274, 0x1275, 0x1277, 0x1279, + // Entry 440 - 47F + 0x127b, 0x127d, 0x127f, 0x1281, 0x1283, 0x1285, 0x1287, 0x1289, + 0x128c, 0x128e, 0x1290, 0x1292, 0x1294, 0x1297, 0x1299, 0x129b, + 0x129d, 0x129f, 0x12a1, 0x12a3, 0x12a5, 0x12a7, 0x12a9, 0x12ab, + 0x12ad, 0x12af, 0x12b2, 0x12b4, 0x12b6, 0x12b8, 0x12ba, 0x12bc, + 0x12be, 0x12c0, 0x12c2, 0x12c4, 0x12c6, 0x12c9, 0x12cb, 0x12cd, + 0x12d0, 0x12d2, 0x12d4, 0x12d6, 0x12d8, 0x12da, 0x12dc, 0x12de, + 0x12e6, 0x12ee, 0x12fa, 0x1306, 0x1312, 0x131e, 0x132a, 0x1332, + 0x133a, 0x1346, 0x1352, 0x135e, 0x136a, 0x136c, 0x136e, 0x1370, + // Entry 480 - 4BF + 0x1372, 0x1374, 0x1376, 0x1378, 0x137a, 0x137c, 0x137e, 0x1380, + 0x1382, 0x1384, 0x1386, 0x1388, 0x138a, 0x138d, 0x1390, 0x1392, + 0x1394, 0x1396, 0x1398, 0x139a, 0x139c, 0x139e, 0x13a0, 0x13a2, + 0x13a4, 0x13a6, 0x13a8, 0x13aa, 0x13ac, 0x13ae, 0x13b0, 0x13b2, + 0x13b4, 0x13b6, 0x13b8, 0x13ba, 0x13bc, 0x13bf, 0x13c1, 0x13c3, + 0x13c5, 0x13c7, 0x13c9, 0x13cb, 0x13cd, 0x13cf, 0x13d1, 0x13d3, + 0x13d6, 0x13d8, 0x13da, 0x13dc, 0x13de, 0x13e0, 0x13e2, 0x13e4, + 0x13e6, 0x13e8, 0x13ea, 0x13ec, 0x13ee, 0x13f0, 0x13f2, 0x13f5, + // Entry 4C0 - 4FF + 0x13f8, 0x13fb, 0x13fe, 0x1401, 0x1404, 0x1407, 0x140a, 0x140d, + 0x1410, 0x1413, 0x1416, 0x1419, 0x141c, 0x141f, 0x1422, 0x1425, + 0x1428, 0x142b, 0x142e, 0x1431, 0x1434, 0x1437, 0x143a, 0x143d, + 0x1440, 0x1447, 0x1449, 0x144b, 0x144d, 0x1450, 0x1452, 0x1454, + 0x1456, 0x1458, 0x145a, 0x1460, 0x1466, 0x1469, 0x146c, 0x146f, + 0x1472, 0x1475, 0x1478, 0x147b, 0x147e, 0x1481, 0x1484, 0x1487, + 0x148a, 0x148d, 0x1490, 0x1493, 0x1496, 0x1499, 0x149c, 0x149f, + 0x14a2, 0x14a5, 0x14a8, 0x14ab, 0x14ae, 0x14b1, 0x14b4, 0x14b7, + // Entry 500 - 53F + 0x14ba, 0x14bd, 0x14c0, 0x14c3, 0x14c6, 0x14c9, 0x14cc, 0x14cf, + 0x14d2, 0x14d5, 0x14d8, 0x14db, 0x14de, 0x14e1, 0x14e4, 0x14e7, + 0x14ea, 0x14ed, 0x14f6, 0x14ff, 0x1508, 0x1511, 0x151a, 0x1523, + 0x152c, 0x1535, 0x153e, 0x1541, 0x1544, 0x1547, 0x154a, 0x154d, + 0x1550, 0x1553, 0x1556, 0x1559, 0x155c, 0x155f, 0x1562, 0x1565, + 0x1568, 0x156b, 0x156e, 0x1571, 0x1574, 0x1577, 0x157a, 0x157d, + 0x1580, 0x1583, 0x1586, 0x1589, 0x158c, 0x158f, 0x1592, 0x1595, + 0x1598, 0x159b, 0x159e, 0x15a1, 0x15a4, 0x15a7, 0x15aa, 0x15ad, + // Entry 540 - 57F + 0x15b0, 0x15b3, 0x15b6, 0x15b9, 0x15bc, 0x15bf, 0x15c2, 0x15c5, + 0x15c8, 0x15cb, 0x15ce, 0x15d1, 0x15d4, 0x15d7, 0x15da, 0x15dd, + 0x15e0, 0x15e3, 0x15e6, 0x15e9, 0x15ec, 0x15ef, 0x15f2, 0x15f5, + 0x15f8, 0x15fb, 0x15fe, 0x1601, 0x1604, 0x1607, 0x160a, 0x160d, + 0x1610, 0x1613, 0x1616, 0x1619, 0x161c, 0x161f, 0x1622, 0x1625, + 0x1628, 0x162b, 0x162e, 0x1631, 0x1634, 0x1637, 0x163a, 0x163d, + 0x1640, 0x1643, 0x1646, 0x1649, 0x164c, 0x164f, 0x1652, 0x1655, + 0x1658, 0x165b, 0x165e, 0x1661, 0x1664, 0x1667, 0x166a, 0x166d, + // Entry 580 - 5BF + 0x1670, 0x1673, 0x1676, 0x1679, 0x167c, 0x167f, 0x1682, 0x1685, + 0x1688, 0x168b, 0x168e, 0x1691, 0x1694, 0x1697, 0x169a, 0x169d, + 0x16a0, 0x16a3, 0x16a6, 0x16a9, 0x16ac, 0x16af, 0x16b2, 0x16b5, + 0x16b8, 0x16bb, 0x16be, 0x16c1, 0x16c4, 0x16c7, 0x16ca, 0x16cd, + 0x16d0, 0x16d3, 0x16d6, 0x16d9, 0x16dc, 0x16df, 0x16e2, 0x16e5, + 0x16e8, 0x16eb, 0x16ee, 0x16f1, 0x16f4, 0x16f7, 0x16fa, 0x16fd, + 0x1700, 0x1703, 0x1706, 0x1709, 0x170c, 0x170f, 0x1712, 0x1715, + 0x1718, 0x171b, 0x171e, 0x1721, 0x1724, 0x1727, 0x172a, 0x172d, + // Entry 5C0 - 5FF + 0x1730, 0x1733, 0x1736, 0x1739, 0x173c, 0x173f, 0x1742, 0x1745, + 0x1748, 0x174b, 0x174e, 0x1751, 0x1754, 0x1757, 0x175a, 0x175d, + 0x1760, 0x1763, 0x1766, 0x1769, 0x176c, 0x176f, 0x1772, 0x1775, + 0x1778, 0x177b, 0x177e, 0x1781, 0x1784, 0x1787, 0x178a, 0x178d, + 0x1790, 0x1793, 0x1796, 0x1799, 0x179c, 0x179f, 0x17a2, 0x17a5, + 0x17a8, 0x17ab, 0x17ae, 0x17b1, 0x17b4, 0x17b7, 0x17ba, 0x17bd, + 0x17c0, 0x17c3, 0x17c6, 0x17c9, 0x17cc, 0x17cf, 0x17d2, 0x17d5, + 0x17d8, 0x17db, 0x17de, 0x17e1, 0x17e4, 0x17e7, 0x17ea, 0x17ed, + // Entry 600 - 63F + 0x17f0, 0x17f3, 0x17f6, 0x17f9, 0x17fc, 0x17ff, 0x1802, 0x1805, + 0x1808, 0x180b, 0x180e, 0x1811, 0x1814, 0x1817, 0x181a, 0x181d, + 0x1820, 0x1823, 0x1826, 0x1829, 0x182c, 0x182f, 0x1832, 0x1835, + 0x1838, 0x183b, 0x183e, 0x1841, 0x1844, 0x1847, 0x184a, 0x184d, + 0x1850, 0x1853, 0x1856, 0x1859, 0x185c, 0x185f, 0x1862, 0x1865, + 0x1868, 0x186b, 0x186e, 0x1871, 0x1874, 0x1877, 0x187a, 0x187d, + 0x1880, 0x1883, 0x1886, 0x1889, 0x188c, 0x188f, 0x1892, 0x1895, + 0x1898, 0x189b, 0x189e, 0x18a1, 0x18a4, 0x18a7, 0x18aa, 0x18ad, + // Entry 640 - 67F + 0x18b0, 0x18b3, 0x18b6, 0x18b9, 0x18bc, 0x18bf, 0x18c2, 0x18c5, + 0x18c8, 0x18cb, 0x18ce, 0x18d1, 0x18d4, 0x18d7, 0x18da, 0x18dd, + 0x18e0, 0x18e3, 0x18e6, 0x18e9, 0x18ec, 0x18ef, 0x18f2, 0x18f5, + 0x18f8, 0x18fb, 0x18fe, 0x1901, 0x1904, 0x1907, 0x190a, 0x190d, + 0x1910, 0x1913, 0x1916, 0x1919, 0x191c, 0x191f, 0x1922, 0x1925, + 0x1928, 0x192b, 0x192e, 0x1931, 0x1934, 0x1937, 0x193a, 0x193d, + 0x1940, 0x1943, 0x1946, 0x1949, 0x194c, 0x194f, 0x1952, 0x1955, + 0x1958, 0x195b, 0x195e, 0x1961, 0x1964, 0x1967, 0x196a, 0x196d, + // Entry 680 - 6BF + 0x1970, 0x1973, 0x1976, 0x1979, 0x197c, 0x197f, 0x1982, 0x1985, + 0x1988, 0x198b, 0x198e, 0x1991, 0x1994, 0x1997, 0x199a, 0x199d, + 0x19a0, 0x19a3, 0x19a6, 0x19a9, 0x19ac, 0x19af, 0x19b2, 0x19b5, + 0x19b8, 0x19bb, 0x19be, 0x19c1, 0x19c4, 0x19c7, 0x19ca, 0x19cd, + 0x19d0, 0x19d3, 0x19d6, 0x19d9, 0x19dc, 0x19df, 0x19e2, 0x19e5, + 0x19e8, 0x19eb, 0x19ee, 0x19f1, 0x19f4, 0x19f7, 0x19fa, 0x19fd, + 0x1a00, 0x1a03, 0x1a06, 0x1a09, 0x1a0c, 0x1a0f, 0x1a12, 0x1a15, + 0x1a18, 0x1a1b, 0x1a1e, 0x1a21, 0x1a24, 0x1a27, 0x1a2a, 0x1a2d, + // Entry 6C0 - 6FF + 0x1a30, +} // Size: 3482 bytes + +var xorData string = "" + // Size: 4907 bytes + "\x02\x0c\x09\x02\xb0\xec\x02\xad\xd8\x02\xad\xd9\x02\x06\x07\x02\x0f\x12" + + "\x02\x0f\x1f\x02\x0f\x1d\x02\x01\x13\x02\x0f\x16\x02\x0f\x0b\x02\x0f3" + + "\x02\x0f7\x02\x0f?\x02\x0f/\x02\x0f*\x02\x0c&\x02\x0c*\x02\x0c;\x02\x0c9" + + "\x02\x0c%\x02\xab\xed\x02\xab\xe2\x02\xab\xe3\x02\xa9\xe0\x02\xa9\xe1" + + "\x02\xa9\xe6\x02\xa3\xcb\x02\xa3\xc8\x02\xa3\xc9\x02\x01#\x02\x01\x08" + + "\x02\x0e>\x02\x0e'\x02\x0f\x03\x02\x03\x0d\x02\x03\x09\x02\x03\x17\x02" + + "\x03\x0e\x02\x02\x03\x02\x011\x02\x01\x00\x02\x01\x10\x02\x03<\x02\x07" + + "\x0d\x02\x02\x0c\x02\x0c0\x02\x01\x03\x02\x01\x01\x02\x01 \x02\x01\x22" + + "\x02\x01)\x02\x01\x0a\x02\x01\x0c\x02\x02\x06\x02\x02\x02\x02\x03\x10" + + "\x03\x037 \x03\x0b+\x03\x021\x00\x02\x01\x04\x02\x01\x02\x02\x019\x02" + + "\x03\x1c\x02\x02$\x03\x80p$\x02\x03:\x02\x03\x0a\x03\xc1r.\x03\xc1r,\x03" + + "\xc1r\x02\x02\x02:\x02\x02>\x02\x02,\x02\x02\x10\x02\x02\x00\x03\xc1s<" + + "\x03\xc1s*\x03\xc2L$\x03\xc2L;\x02\x09)\x02\x0a\x19\x03\x83\xab\xe3\x03" + + "\x83\xab\xf2\x03 4\xe0\x03\x81\xab\xea\x03\x81\xab\xf3\x03 4\xef\x03\x96" + + "\xe1\xcd\x03\x84\xe5\xc3\x02\x0d\x11\x03\x8b\xec\xcb\x03\x94\xec\xcf\x03" + + "\x9a\xec\xc2\x03\x8b\xec\xdb\x03\x94\xec\xdf\x03\x9a\xec\xd2\x03\x01\x0c" + + "!\x03\x01\x0c#\x03ʠ\x9d\x03ʣ\x9c\x03ʢ\x9f\x03ʥ\x9e\x03ʤ\x91\x03ʧ\x90\x03" + + "ʦ\x93\x03ʩ\x92\x03ʨ\x95\x03\xca\xf3\xb5\x03\xca\xf0\xb4\x03\xca\xf1\xb7" + + "\x03\xca\xf6\xb6\x03\xca\xf7\x89\x03\xca\xf4\x88\x03\xca\xf5\x8b\x03\xca" + + "\xfa\x8a\x03\xca\xfb\x8d\x03\xca\xf8\x8c\x03\xca\xf9\x8f\x03\xca\xfe\x8e" + + "\x03\xca\xff\x81\x03\xca\xfc\x80\x03\xca\xfd\x83\x03\xca\xe2\x82\x03\xca" + + "\xe3\x85\x03\xca\xe0\x84\x03\xca\xe1\x87\x03\xca\xe6\x86\x03\xca\xe7\x99" + + "\x03\xca\xe4\x98\x03\xca\xe5\x9b\x03\xca\xea\x9a\x03\xca\xeb\x9d\x03\xca" + + "\xe8\x9c\x03ؓ\x89\x03ߔ\x8b\x02\x010\x03\x03\x04\x1e\x03\x04\x15\x12\x03" + + "\x0b\x05,\x03\x06\x04\x00\x03\x06\x04)\x03\x06\x044\x03\x06\x04<\x03\x06" + + "\x05\x1d\x03\x06\x06\x00\x03\x06\x06\x0a\x03\x06\x06'\x03\x06\x062\x03" + + "\x0786\x03\x079/\x03\x079 \x03\x07:\x0e\x03\x07:\x1b\x03\x07:%\x03\x07;/" + + "\x03\x07;%\x03\x074\x11\x03\x076\x09\x03\x077*\x03\x070\x01\x03\x070\x0f" + + "\x03\x070.\x03\x071\x16\x03\x071\x04\x03\x0710\x03\x072\x18\x03\x072-" + + "\x03\x073\x14\x03\x073>\x03\x07'\x09\x03\x07 \x00\x03\x07\x1f\x0b\x03" + + "\x07\x18#\x03\x07\x18(\x03\x07\x186\x03\x07\x18\x03\x03\x07\x19\x16\x03" + + "\x07\x116\x03\x07\x12'\x03\x07\x13\x10\x03\x07\x0c&\x03\x07\x0c\x08\x03" + + "\x07\x0c\x13\x03\x07\x0d\x02\x03\x07\x0d\x1c\x03\x07\x0b5\x03\x07\x0b" + + "\x0a\x03\x07\x0b\x01\x03\x07\x0b\x0f\x03\x07\x05\x00\x03\x07\x05\x09\x03" + + "\x07\x05\x0b\x03\x07\x07\x01\x03\x07\x07\x08\x03\x07\x00<\x03\x07\x00+" + + "\x03\x07\x01)\x03\x07\x01\x1b\x03\x07\x01\x08\x03\x07\x03?\x03\x0445\x03" + + "\x044\x08\x03\x0454\x03\x04)/\x03\x04)5\x03\x04+\x05\x03\x04+\x14\x03" + + "\x04+ \x03\x04+<\x03\x04*&\x03\x04*\x22\x03\x04&8\x03\x04!\x01\x03\x04!" + + "\x22\x03\x04\x11+\x03\x04\x10.\x03\x04\x104\x03\x04\x13=\x03\x04\x12\x04" + + "\x03\x04\x12\x0a\x03\x04\x0d\x1d\x03\x04\x0d\x07\x03\x04\x0d \x03\x05<>" + + "\x03\x055<\x03\x055!\x03\x055#\x03\x055&\x03\x054\x1d\x03\x054\x02\x03" + + "\x054\x07\x03\x0571\x03\x053\x1a\x03\x053\x16\x03\x05.<\x03\x05.\x07\x03" + + "\x05):\x03\x05)<\x03\x05)\x0c\x03\x05)\x15\x03\x05+-\x03\x05+5\x03\x05$" + + "\x1e\x03\x05$\x14\x03\x05'\x04\x03\x05'\x14\x03\x05&\x02\x03\x05\x226" + + "\x03\x05\x22\x0c\x03\x05\x22\x1c\x03\x05\x19\x0a\x03\x05\x1b\x09\x03\x05" + + "\x1b\x0c\x03\x05\x14\x07\x03\x05\x16?\x03\x05\x16\x0c\x03\x05\x0c\x05" + + "\x03\x05\x0e\x0f\x03\x05\x01\x0e\x03\x05\x00(\x03\x05\x030\x03\x05\x03" + + "\x06\x03\x0a==\x03\x0a=1\x03\x0a=,\x03\x0a=\x0c\x03\x0a??\x03\x0a<\x08" + + "\x03\x0a9!\x03\x0a9)\x03\x0a97\x03\x0a99\x03\x0a6\x0a\x03\x0a6\x1c\x03" + + "\x0a6\x17\x03\x0a7'\x03\x0a78\x03\x0a73\x03\x0a'\x01\x03\x0a'&\x03\x0a" + + "\x1f\x0e\x03\x0a\x1f\x03\x03\x0a\x1f3\x03\x0a\x1b/\x03\x0a\x18\x19\x03" + + "\x0a\x19\x01\x03\x0a\x16\x14\x03\x0a\x0e\x22\x03\x0a\x0f\x10\x03\x0a\x0f" + + "\x02\x03\x0a\x0f \x03\x0a\x0c\x04\x03\x0a\x0b>\x03\x0a\x0b+\x03\x0a\x08/" + + "\x03\x0a\x046\x03\x0a\x05\x14\x03\x0a\x00\x04\x03\x0a\x00\x10\x03\x0a" + + "\x00\x14\x03\x0b<3\x03\x0b;*\x03\x0b9\x22\x03\x0b9)\x03\x0b97\x03\x0b+" + + "\x10\x03\x0b((\x03\x0b&5\x03\x0b$\x1c\x03\x0b$\x12\x03\x0b%\x04\x03\x0b#" + + "<\x03\x0b#0\x03\x0b#\x0d\x03\x0b#\x19\x03\x0b!:\x03\x0b!\x1f\x03\x0b!" + + "\x00\x03\x0b\x1e5\x03\x0b\x1c\x1d\x03\x0b\x1d-\x03\x0b\x1d(\x03\x0b\x18." + + "\x03\x0b\x18 \x03\x0b\x18\x16\x03\x0b\x14\x13\x03\x0b\x15$\x03\x0b\x15" + + "\x22\x03\x0b\x12\x1b\x03\x0b\x12\x10\x03\x0b\x132\x03\x0b\x13=\x03\x0b" + + "\x12\x18\x03\x0b\x0c&\x03\x0b\x061\x03\x0b\x06:\x03\x0b\x05#\x03\x0b\x05" + + "<\x03\x0b\x04\x0b\x03\x0b\x04\x04\x03\x0b\x04\x1b\x03\x0b\x042\x03\x0b" + + "\x041\x03\x0b\x03\x03\x03\x0b\x03\x1d\x03\x0b\x03/\x03\x0b\x03+\x03\x0b" + + "\x02\x1b\x03\x0b\x02\x00\x03\x0b\x01\x1e\x03\x0b\x01\x08\x03\x0b\x015" + + "\x03\x06\x0d9\x03\x06\x0d=\x03\x06\x0d?\x03\x02\x001\x03\x02\x003\x03" + + "\x02\x02\x19\x03\x02\x006\x03\x02\x02\x1b\x03\x02\x004\x03\x02\x00<\x03" + + "\x02\x02\x0a\x03\x02\x02\x0e\x03\x02\x01\x1a\x03\x02\x01\x07\x03\x02\x01" + + "\x05\x03\x02\x01\x0b\x03\x02\x01%\x03\x02\x01\x0c\x03\x02\x01\x04\x03" + + "\x02\x01\x1c\x03\x02\x00.\x03\x02\x002\x03\x02\x00>\x03\x02\x00\x12\x03" + + "\x02\x00\x16\x03\x02\x011\x03\x02\x013\x03\x02\x02 \x03\x02\x02%\x03\x02" + + "\x02$\x03\x02\x028\x03\x02\x02;\x03\x02\x024\x03\x02\x012\x03\x02\x022" + + "\x03\x02\x02/\x03\x02\x01,\x03\x02\x01\x13\x03\x02\x01\x16\x03\x02\x01" + + "\x11\x03\x02\x01\x1e\x03\x02\x01\x15\x03\x02\x01\x17\x03\x02\x01\x0f\x03" + + "\x02\x01\x08\x03\x02\x00?\x03\x02\x03\x07\x03\x02\x03\x0d\x03\x02\x03" + + "\x13\x03\x02\x03\x1d\x03\x02\x03\x1f\x03\x02\x00\x03\x03\x02\x00\x0d\x03" + + "\x02\x00\x01\x03\x02\x00\x1b\x03\x02\x00\x19\x03\x02\x00\x18\x03\x02\x00" + + "\x13\x03\x02\x00/\x03\x07>\x12\x03\x07<\x1f\x03\x07>\x1d\x03\x06\x1d\x0e" + + "\x03\x07>\x1c\x03\x07>:\x03\x07>\x13\x03\x04\x12+\x03\x07?\x03\x03\x07>" + + "\x02\x03\x06\x224\x03\x06\x1a.\x03\x07<%\x03\x06\x1c\x0b\x03\x0609\x03" + + "\x05\x1f\x01\x03\x04'\x08\x03\x93\xfd\xf5\x03\x02\x0d \x03\x02\x0d#\x03" + + "\x02\x0d!\x03\x02\x0d&\x03\x02\x0d\x22\x03\x02\x0d/\x03\x02\x0d,\x03\x02" + + "\x0d$\x03\x02\x0d'\x03\x02\x0d%\x03\x02\x0d;\x03\x02\x0d=\x03\x02\x0d?" + + "\x03\x099.\x03\x08\x0b7\x03\x08\x02\x14\x03\x08\x14\x0d\x03\x08.:\x03" + + "\x089'\x03\x0f\x0b\x18\x03\x0f\x1c1\x03\x0f\x17&\x03\x0f9\x1f\x03\x0f0" + + "\x0c\x03\x0e\x0a9\x03\x0e\x056\x03\x0e\x1c#\x03\x0f\x13\x0e\x03\x072\x00" + + "\x03\x070\x0d\x03\x072\x0b\x03\x06\x11\x18\x03\x070\x10\x03\x06\x0f(\x03" + + "\x072\x05\x03\x06\x0f,\x03\x073\x15\x03\x06\x07\x08\x03\x05\x16\x02\x03" + + "\x04\x0b \x03\x05:8\x03\x05\x16%\x03\x0a\x0d\x1f\x03\x06\x16\x10\x03\x05" + + "\x1d5\x03\x05*;\x03\x05\x16\x1b\x03\x04.-\x03\x06\x1a\x19\x03\x04\x03," + + "\x03\x0b87\x03\x04/\x0a\x03\x06\x00,\x03\x04-\x01\x03\x04\x1e-\x03\x06/(" + + "\x03\x0a\x0b5\x03\x06\x0e7\x03\x06\x07.\x03\x0597\x03\x0a*%\x03\x0760" + + "\x03\x06\x0c;\x03\x05'\x00\x03\x072.\x03\x072\x08\x03\x06=\x01\x03\x06" + + "\x05\x1b\x03\x06\x06\x12\x03\x06$=\x03\x06'\x0d\x03\x04\x11\x0f\x03\x076" + + ",\x03\x06\x07;\x03\x06.,\x03\x86\xf9\xea\x03\x8f\xff\xeb\x02\x092\x02" + + "\x095\x02\x094\x02\x09;\x02\x09>\x02\x098\x02\x09*\x02\x09/\x02\x09,\x02" + + "\x09%\x02\x09&\x02\x09#\x02\x09 \x02\x08!\x02\x08%\x02\x08$\x02\x08+\x02" + + "\x08.\x02\x08*\x02\x08&\x02\x088\x02\x08>\x02\x084\x02\x086\x02\x080\x02" + + "\x08\x10\x02\x08\x17\x02\x08\x12\x02\x08\x1d\x02\x08\x1f\x02\x08\x13\x02" + + "\x08\x15\x02\x08\x14\x02\x08\x0c\x03\x8b\xfd\xd0\x03\x81\xec\xc6\x03\x87" + + "\xe0\x8a\x03-2\xe3\x03\x80\xef\xe4\x03-2\xea\x03\x88\xe6\xeb\x03\x8e\xe6" + + "\xe8\x03\x84\xe6\xe9\x03\x97\xe6\xee\x03-2\xf9\x03-2\xf6\x03\x8e\xe3\xad" + + "\x03\x80\xe3\x92\x03\x88\xe3\x90\x03\x8e\xe3\x90\x03\x80\xe3\x97\x03\x88" + + "\xe3\x95\x03\x88\xfe\xcb\x03\x8e\xfe\xca\x03\x84\xfe\xcd\x03\x91\xef\xc9" + + "\x03-2\xc1\x03-2\xc0\x03-2\xcb\x03\x88@\x09\x03\x8e@\x08\x03\x8f\xe0\xf5" + + "\x03\x8e\xe6\xf9\x03\x8e\xe0\xfa\x03\x93\xff\xf4\x03\x84\xee\xd3\x03\x0b" + + "(\x04\x023 \x03\x0b)\x08\x021;\x02\x01*\x03\x0b#\x10\x03\x0b 0\x03\x0b!" + + "\x10\x03\x0b!0\x03\x07\x15\x08\x03\x09?5\x03\x07\x1f\x08\x03\x07\x17\x0b" + + "\x03\x09\x1f\x15\x03\x0b\x1c7\x03\x0a+#\x03\x06\x1a\x1b\x03\x06\x1a\x14" + + "\x03\x0a\x01\x18\x03\x06#\x1b\x03\x0a2\x0c\x03\x0a\x01\x04\x03\x09#;\x03" + + "\x08='\x03\x08\x1a\x0a\x03\x07\x03\x0a\x111\x03\x09\x1b\x09\x03\x073.\x03\x07" + + "\x01\x00\x03\x09/,\x03\x07#>\x03\x07\x048\x03\x0a\x1f\x22\x03\x098>\x03" + + "\x09\x11\x00\x03\x08/\x17\x03\x06'\x22\x03\x0b\x1a+\x03\x0a\x22\x19\x03" + + "\x0a/1\x03\x0974\x03\x09\x0f\x22\x03\x08,\x22\x03\x08?\x14\x03\x07$5\x03" + + "\x07<3\x03\x07=*\x03\x07\x13\x18\x03\x068\x0a\x03\x06\x09\x16\x03\x06" + + "\x13\x00\x03\x08\x067\x03\x08\x01\x03\x03\x08\x12\x1d\x03\x07+7\x03\x06(" + + ";\x03\x06\x1c?\x03\x07\x0e\x17\x03\x0a\x06\x1d\x03\x0a\x19\x07\x03\x08" + + "\x14$\x03\x07$;\x03\x08,$\x03\x08\x06\x0d\x03\x07\x16\x0a\x03\x06>>\x03" + + "\x0a\x06\x12\x03\x0a\x14)\x03\x09\x0d\x1f\x03\x09\x12\x17\x03\x09\x19" + + "\x01\x03\x08\x11 \x03\x08\x1d'\x03\x06<\x1a\x03\x0a.\x00\x03\x07'\x18" + + "\x03\x0a\x22\x08\x03\x08\x0d\x0a\x03\x08\x13)\x03\x07*)\x03\x06<,\x03" + + "\x07\x0b\x1a\x03\x09.\x14\x03\x09\x0d\x1e\x03\x07\x0e#\x03\x0b\x1d'\x03" + + "\x0a\x0a8\x03\x09%2\x03\x08+&\x03\x080\x12\x03\x0a)4\x03\x08\x06\x1f\x03" + + "\x0b\x1b\x1a\x03\x0a\x1b\x0f\x03\x0b\x1d*\x03\x09\x16$\x03\x090\x11\x03" + + "\x08\x11\x08\x03\x0a*(\x03\x0a\x042\x03\x089,\x03\x074'\x03\x07\x0f\x05" + + "\x03\x09\x0b\x0a\x03\x07\x1b\x01\x03\x09\x17:\x03\x09.\x0d\x03\x07.\x11" + + "\x03\x09+\x15\x03\x080\x13\x03\x0b\x1f\x19\x03\x0a \x11\x03\x0a\x220\x03" + + "\x09\x07;\x03\x08\x16\x1c\x03\x07,\x13\x03\x07\x0e/\x03\x06\x221\x03\x0a" + + ".\x0a\x03\x0a7\x02\x03\x0a\x032\x03\x0a\x1d.\x03\x091\x06\x03\x09\x19:" + + "\x03\x08\x02/\x03\x060+\x03\x06\x0f-\x03\x06\x1c\x1f\x03\x06\x1d\x07\x03" + + "\x0a,\x11\x03\x09=\x0d\x03\x09\x0b;\x03\x07\x1b/\x03\x0a\x1f:\x03\x09 " + + "\x1f\x03\x09.\x10\x03\x094\x0b\x03\x09\x1a1\x03\x08#\x1a\x03\x084\x1d" + + "\x03\x08\x01\x1f\x03\x08\x11\x22\x03\x07'8\x03\x07\x1a>\x03\x0757\x03" + + "\x06&9\x03\x06+\x11\x03\x0a.\x0b\x03\x0a,>\x03\x0a4#\x03\x08%\x17\x03" + + "\x07\x05\x22\x03\x07\x0c\x0b\x03\x0a\x1d+\x03\x0a\x19\x16\x03\x09+\x1f" + + "\x03\x09\x08\x0b\x03\x08\x16\x18\x03\x08+\x12\x03\x0b\x1d\x0c\x03\x0a=" + + "\x10\x03\x0a\x09\x0d\x03\x0a\x10\x11\x03\x09&0\x03\x08(\x1f\x03\x087\x07" + + "\x03\x08\x185\x03\x07'6\x03\x06.\x05\x03\x06=\x04\x03\x06;;\x03\x06\x06," + + "\x03\x0b\x18>\x03\x08\x00\x18\x03\x06 \x03\x03\x06<\x00\x03\x09%\x18\x03" + + "\x0b\x1c<\x03\x0a%!\x03\x0a\x09\x12\x03\x0a\x16\x02\x03\x090'\x03\x09" + + "\x0e=\x03\x08 \x0e\x03\x08>\x03\x03\x074>\x03\x06&?\x03\x06\x19\x09\x03" + + "\x06?(\x03\x0a-\x0e\x03\x09:3\x03\x098:\x03\x09\x12\x0b\x03\x09\x1d\x17" + + "\x03\x087\x05\x03\x082\x14\x03\x08\x06%\x03\x08\x13\x1f\x03\x06\x06\x0e" + + "\x03\x0a\x22<\x03\x09/<\x03\x06>+\x03\x0a'?\x03\x0a\x13\x0c\x03\x09\x10<" + + "\x03\x07\x1b=\x03\x0a\x19\x13\x03\x09\x22\x1d\x03\x09\x07\x0d\x03\x08)" + + "\x1c\x03\x06=\x1a\x03\x0a/4\x03\x0a7\x11\x03\x0a\x16:\x03\x09?3\x03\x09:" + + "/\x03\x09\x05\x0a\x03\x09\x14\x06\x03\x087\x22\x03\x080\x07\x03\x08\x1a" + + "\x1f\x03\x07\x04(\x03\x07\x04\x09\x03\x06 %\x03\x06<\x08\x03\x0a+\x14" + + "\x03\x09\x1d\x16\x03\x0a70\x03\x08 >\x03\x0857\x03\x070\x0a\x03\x06=\x12" + + "\x03\x06\x16%\x03\x06\x1d,\x03\x099#\x03\x09\x10>\x03\x07 \x1e\x03\x08" + + "\x0c<\x03\x08\x0b\x18\x03\x08\x15+\x03\x08,:\x03\x08%\x22\x03\x07\x0a$" + + "\x03\x0b\x1c=\x03\x07+\x08\x03\x0a/\x05\x03\x0a \x07\x03\x0a\x12'\x03" + + "\x09#\x11\x03\x08\x1b\x15\x03\x0a\x06\x01\x03\x09\x1c\x1b\x03\x0922\x03" + + "\x07\x14<\x03\x07\x09\x04\x03\x061\x04\x03\x07\x0e\x01\x03\x0a\x13\x18" + + "\x03\x0a-\x0c\x03\x0a?\x0d\x03\x0a\x09\x0a\x03\x091&\x03\x0a/\x0b\x03" + + "\x08$<\x03\x083\x1d\x03\x08\x0c$\x03\x08\x0d\x07\x03\x08\x0d?\x03\x08" + + "\x0e\x14\x03\x065\x0a\x03\x08\x1a#\x03\x08\x16#\x03\x0702\x03\x07\x03" + + "\x1a\x03\x06(\x1d\x03\x06+\x1b\x03\x06\x0b\x05\x03\x06\x0b\x17\x03\x06" + + "\x0c\x04\x03\x06\x1e\x19\x03\x06+0\x03\x062\x18\x03\x0b\x16\x1e\x03\x0a+" + + "\x16\x03\x0a-?\x03\x0a#:\x03\x0a#\x10\x03\x0a%$\x03\x0a>+\x03\x0a01\x03" + + "\x0a1\x10\x03\x0a\x099\x03\x0a\x0a\x12\x03\x0a\x19\x1f\x03\x0a\x19\x12" + + "\x03\x09*)\x03\x09-\x16\x03\x09.1\x03\x09.2\x03\x09<\x0e\x03\x09> \x03" + + "\x093\x12\x03\x09\x0b\x01\x03\x09\x1c2\x03\x09\x11\x1c\x03\x09\x15%\x03" + + "\x08,&\x03\x08!\x22\x03\x089(\x03\x08\x0b\x1a\x03\x08\x0d2\x03\x08\x0c" + + "\x04\x03\x08\x0c\x06\x03\x08\x0c\x1f\x03\x08\x0c\x0c\x03\x08\x0f\x1f\x03" + + "\x08\x0f\x1d\x03\x08\x00\x14\x03\x08\x03\x14\x03\x08\x06\x16\x03\x08\x1e" + + "#\x03\x08\x11\x11\x03\x08\x10\x18\x03\x08\x14(\x03\x07)\x1e\x03\x07.1" + + "\x03\x07 $\x03\x07 '\x03\x078\x08\x03\x07\x0d0\x03\x07\x0f7\x03\x07\x05#" + + "\x03\x07\x05\x1a\x03\x07\x1a7\x03\x07\x1d-\x03\x07\x17\x10\x03\x06)\x1f" + + "\x03\x062\x0b\x03\x066\x16\x03\x06\x09\x11\x03\x09(\x1e\x03\x07!5\x03" + + "\x0b\x11\x16\x03\x0a/\x04\x03\x0a,\x1a\x03\x0b\x173\x03\x0a,1\x03\x0a/5" + + "\x03\x0a\x221\x03\x0a\x22\x0d\x03\x0a?%\x03\x0a<,\x03\x0a?#\x03\x0a>\x19" + + "\x03\x0a\x08&\x03\x0a\x0b\x0e\x03\x0a\x0c:\x03\x0a\x0c+\x03\x0a\x03\x22" + + "\x03\x0a\x06)\x03\x0a\x11\x10\x03\x0a\x11\x1a\x03\x0a\x17-\x03\x0a\x14(" + + "\x03\x09)\x1e\x03\x09/\x09\x03\x09.\x00\x03\x09,\x07\x03\x09/*\x03\x09-9" + + "\x03\x09\x228\x03\x09%\x09\x03\x09:\x12\x03\x09;\x1d\x03\x09?\x06\x03" + + "\x093%\x03\x096\x05\x03\x096\x08\x03\x097\x02\x03\x09\x07,\x03\x09\x04," + + "\x03\x09\x1f\x16\x03\x09\x11\x03\x03\x09\x11\x12\x03\x09\x168\x03\x08*" + + "\x05\x03\x08/2\x03\x084:\x03\x08\x22+\x03\x08 0\x03\x08&\x0a\x03\x08;" + + "\x10\x03\x08>$\x03\x08>\x18\x03\x0829\x03\x082:\x03\x081,\x03\x081<\x03" + + "\x081\x1c\x03\x087#\x03\x087*\x03\x08\x09'\x03\x08\x00\x1d\x03\x08\x05-" + + "\x03\x08\x1f4\x03\x08\x1d\x04\x03\x08\x16\x0f\x03\x07*7\x03\x07'!\x03" + + "\x07%\x1b\x03\x077\x0c\x03\x07\x0c1\x03\x07\x0c.\x03\x07\x00\x06\x03\x07" + + "\x01\x02\x03\x07\x010\x03\x07\x06=\x03\x07\x01\x03\x03\x07\x01\x13\x03" + + "\x07\x06\x06\x03\x07\x05\x0a\x03\x07\x1f\x09\x03\x07\x17:\x03\x06*1\x03" + + "\x06-\x1d\x03\x06\x223\x03\x062:\x03\x060$\x03\x066\x1e\x03\x064\x12\x03" + + "\x0645\x03\x06\x0b\x00\x03\x06\x0b7\x03\x06\x07\x1f\x03\x06\x15\x12\x03" + + "\x0c\x05\x0f\x03\x0b+\x0b\x03\x0b+-\x03\x06\x16\x1b\x03\x06\x15\x17\x03" + + "\x89\xca\xea\x03\x89\xca\xe8\x03\x0c8\x10\x03\x0c8\x01\x03\x0c8\x0f\x03" + + "\x0d8%\x03\x0d8!\x03\x0c8-\x03\x0c8/\x03\x0c8+\x03\x0c87\x03\x0c85\x03" + + "\x0c9\x09\x03\x0c9\x0d\x03\x0c9\x0f\x03\x0c9\x0b\x03\xcfu\x0c\x03\xcfu" + + "\x0f\x03\xcfu\x0e\x03\xcfu\x09\x03\x0c9\x10\x03\x0d9\x0c\x03\xcf`;\x03" + + "\xcf`>\x03\xcf`9\x03\xcf`8\x03\xcf`7\x03\xcf`*\x03\xcf`-\x03\xcf`,\x03" + + "\x0d\x1b\x1a\x03\x0d\x1b&\x03\x0c=.\x03\x0c=%\x03\x0c>\x1e\x03\x0c>\x14" + + "\x03\x0c?\x06\x03\x0c?\x0b\x03\x0c?\x0c\x03\x0c?\x0d\x03\x0c?\x02\x03" + + "\x0c>\x0f\x03\x0c>\x08\x03\x0c>\x09\x03\x0c>,\x03\x0c>\x0c\x03\x0c?\x13" + + "\x03\x0c?\x16\x03\x0c?\x15\x03\x0c?\x1c\x03\x0c?\x1f\x03\x0c?\x1d\x03" + + "\x0c?\x1a\x03\x0c?\x17\x03\x0c?\x08\x03\x0c?\x09\x03\x0c?\x0e\x03\x0c?" + + "\x04\x03\x0c?\x05\x03\x0c" + + "\x03\x0c=2\x03\x0c=6\x03\x0c<\x07\x03\x0c<\x05\x03\x0e:!\x03\x0e:#\x03" + + "\x0e8\x09\x03\x0e:&\x03\x0e8\x0b\x03\x0e:$\x03\x0e:,\x03\x0e8\x1a\x03" + + "\x0e8\x1e\x03\x0e:*\x03\x0e:7\x03\x0e:5\x03\x0e:;\x03\x0e:\x15\x03\x0e:<" + + "\x03\x0e:4\x03\x0e:'\x03\x0e:-\x03\x0e:%\x03\x0e:?\x03\x0e:=\x03\x0e:)" + + "\x03\x0e:/\x03\xcfs'\x03\x0d=\x0f\x03\x0d+*\x03\x0d99\x03\x0d9;\x03\x0d9" + + "?\x03\x0d)\x0d\x03\x0d(%\x02\x01\x18\x02\x01(\x02\x03'\x02\x03)\x02\x03+" + + "\x02\x03/\x02\x03\x19\x02\x03\x1b\x02\x03\x1f\x03\x0d\x22\x18\x03\x0d" + + "\x22\x1a\x03\x0d\x22'\x03\x0d\x22/\x03\x0d\x223\x03\x0d\x22$\x02\x01\x1e" + + "\x03\x0f$!\x03\x0f87\x03\x0f4\x0e\x03\x0f5\x1d\x03\x06'\x03\x03\x0f\x08" + + "\x18\x03\x0f\x0d\x1b\x03\x0e2=\x03\x0e;\x08\x03\x0e:\x0b\x03\x0e\x06$" + + "\x03\x0e\x0d)\x03\x0e\x16\x1f\x03\x0e\x16\x1b\x03\x0d$\x0a\x03\x05,\x1d" + + "\x03\x0d. \x03\x0d.#\x03\x0c(/\x03\x09%\x02\x03\x0d90\x03\x0d\x0e4\x03" + + "\x0d\x0d\x0f\x03\x0c#\x00\x03\x0c,\x1e\x03\x0c2\x0e\x03\x0c\x01\x17\x03" + + "\x0c\x09:\x03\x0e\x173\x03\x0c\x08\x03\x03\x0c\x11\x07\x03\x0c\x10\x18" + + "\x03\x0c\x1f\x1c\x03\x0c\x19\x0e\x03\x0c\x1a\x1f\x03\x0f0>\x03\x0b->\x03" + + "\x0b<+\x03\x0b8\x13\x03\x0b\x043\x03\x0b\x14\x03\x03\x0b\x16%\x03\x0d" + + "\x22&\x03\x0b\x1a\x1a\x03\x0b\x1a\x04\x03\x0a%9\x03\x0a&2\x03\x0a&0\x03" + + "\x0a!\x1a\x03\x0a!7\x03\x0a5\x10\x03\x0a=4\x03\x0a?\x0e\x03\x0a>\x10\x03" + + "\x0a\x00 \x03\x0a\x0f:\x03\x0a\x0f9\x03\x0a\x0b\x0a\x03\x0a\x17%\x03\x0a" + + "\x1b-\x03\x09-\x1a\x03\x09,4\x03\x09.,\x03\x09)\x09\x03\x096!\x03\x091" + + "\x1f\x03\x093\x16\x03\x0c+\x1f\x03\x098 \x03\x098=\x03\x0c(\x1a\x03\x0c(" + + "\x16\x03\x09\x0a+\x03\x09\x16\x12\x03\x09\x13\x0e\x03\x09\x153\x03\x08)!" + + "\x03\x09\x1a\x01\x03\x09\x18\x01\x03\x08%#\x03\x08>\x22\x03\x08\x05%\x03" + + "\x08\x02*\x03\x08\x15;\x03\x08\x1b7\x03\x0f\x07\x1d\x03\x0f\x04\x03\x03" + + "\x070\x0c\x03\x07;\x0b\x03\x07\x08\x17\x03\x07\x12\x06\x03\x06/-\x03\x06" + + "71\x03\x065+\x03\x06>7\x03\x06\x049\x03\x05+\x1e\x03\x05,\x17\x03\x05 " + + "\x1d\x03\x05\x22\x05\x03\x050\x1d" + +// lookup returns the trie value for the first UTF-8 encoding in s and +// the width in bytes of this encoding. The size will be 0 if s does not +// hold enough bytes to complete the encoding. len(s) must be greater than 0. +func (t *idnaTrie) lookup(s []byte) (v uint16, sz int) { + c0 := s[0] + switch { + case c0 < 0x80: // is ASCII + return idnaValues[c0], 1 + case c0 < 0xC2: + return 0, 1 // Illegal UTF-8: not a starter, not ASCII. + case c0 < 0xE0: // 2-byte UTF-8 + if len(s) < 2 { + return 0, 0 + } + i := idnaIndex[c0] + c1 := s[1] + if c1 < 0x80 || 0xC0 <= c1 { + return 0, 1 // Illegal UTF-8: not a continuation byte. + } + return t.lookupValue(uint32(i), c1), 2 + case c0 < 0xF0: // 3-byte UTF-8 + if len(s) < 3 { + return 0, 0 + } + i := idnaIndex[c0] + c1 := s[1] + if c1 < 0x80 || 0xC0 <= c1 { + return 0, 1 // Illegal UTF-8: not a continuation byte. + } + o := uint32(i)<<6 + uint32(c1) + i = idnaIndex[o] + c2 := s[2] + if c2 < 0x80 || 0xC0 <= c2 { + return 0, 2 // Illegal UTF-8: not a continuation byte. + } + return t.lookupValue(uint32(i), c2), 3 + case c0 < 0xF8: // 4-byte UTF-8 + if len(s) < 4 { + return 0, 0 + } + i := idnaIndex[c0] + c1 := s[1] + if c1 < 0x80 || 0xC0 <= c1 { + return 0, 1 // Illegal UTF-8: not a continuation byte. + } + o := uint32(i)<<6 + uint32(c1) + i = idnaIndex[o] + c2 := s[2] + if c2 < 0x80 || 0xC0 <= c2 { + return 0, 2 // Illegal UTF-8: not a continuation byte. + } + o = uint32(i)<<6 + uint32(c2) + i = idnaIndex[o] + c3 := s[3] + if c3 < 0x80 || 0xC0 <= c3 { + return 0, 3 // Illegal UTF-8: not a continuation byte. + } + return t.lookupValue(uint32(i), c3), 4 + } + // Illegal rune + return 0, 1 +} + +// lookupUnsafe returns the trie value for the first UTF-8 encoding in s. +// s must start with a full and valid UTF-8 encoded rune. +func (t *idnaTrie) lookupUnsafe(s []byte) uint16 { + c0 := s[0] + if c0 < 0x80 { // is ASCII + return idnaValues[c0] + } + i := idnaIndex[c0] + if c0 < 0xE0 { // 2-byte UTF-8 + return t.lookupValue(uint32(i), s[1]) + } + i = idnaIndex[uint32(i)<<6+uint32(s[1])] + if c0 < 0xF0 { // 3-byte UTF-8 + return t.lookupValue(uint32(i), s[2]) + } + i = idnaIndex[uint32(i)<<6+uint32(s[2])] + if c0 < 0xF8 { // 4-byte UTF-8 + return t.lookupValue(uint32(i), s[3]) + } + return 0 +} + +// lookupString returns the trie value for the first UTF-8 encoding in s and +// the width in bytes of this encoding. The size will be 0 if s does not +// hold enough bytes to complete the encoding. len(s) must be greater than 0. +func (t *idnaTrie) lookupString(s string) (v uint16, sz int) { + c0 := s[0] + switch { + case c0 < 0x80: // is ASCII + return idnaValues[c0], 1 + case c0 < 0xC2: + return 0, 1 // Illegal UTF-8: not a starter, not ASCII. + case c0 < 0xE0: // 2-byte UTF-8 + if len(s) < 2 { + return 0, 0 + } + i := idnaIndex[c0] + c1 := s[1] + if c1 < 0x80 || 0xC0 <= c1 { + return 0, 1 // Illegal UTF-8: not a continuation byte. + } + return t.lookupValue(uint32(i), c1), 2 + case c0 < 0xF0: // 3-byte UTF-8 + if len(s) < 3 { + return 0, 0 + } + i := idnaIndex[c0] + c1 := s[1] + if c1 < 0x80 || 0xC0 <= c1 { + return 0, 1 // Illegal UTF-8: not a continuation byte. + } + o := uint32(i)<<6 + uint32(c1) + i = idnaIndex[o] + c2 := s[2] + if c2 < 0x80 || 0xC0 <= c2 { + return 0, 2 // Illegal UTF-8: not a continuation byte. + } + return t.lookupValue(uint32(i), c2), 3 + case c0 < 0xF8: // 4-byte UTF-8 + if len(s) < 4 { + return 0, 0 + } + i := idnaIndex[c0] + c1 := s[1] + if c1 < 0x80 || 0xC0 <= c1 { + return 0, 1 // Illegal UTF-8: not a continuation byte. + } + o := uint32(i)<<6 + uint32(c1) + i = idnaIndex[o] + c2 := s[2] + if c2 < 0x80 || 0xC0 <= c2 { + return 0, 2 // Illegal UTF-8: not a continuation byte. + } + o = uint32(i)<<6 + uint32(c2) + i = idnaIndex[o] + c3 := s[3] + if c3 < 0x80 || 0xC0 <= c3 { + return 0, 3 // Illegal UTF-8: not a continuation byte. + } + return t.lookupValue(uint32(i), c3), 4 + } + // Illegal rune + return 0, 1 +} + +// lookupStringUnsafe returns the trie value for the first UTF-8 encoding in s. +// s must start with a full and valid UTF-8 encoded rune. +func (t *idnaTrie) lookupStringUnsafe(s string) uint16 { + c0 := s[0] + if c0 < 0x80 { // is ASCII + return idnaValues[c0] + } + i := idnaIndex[c0] + if c0 < 0xE0 { // 2-byte UTF-8 + return t.lookupValue(uint32(i), s[1]) + } + i = idnaIndex[uint32(i)<<6+uint32(s[1])] + if c0 < 0xF0 { // 3-byte UTF-8 + return t.lookupValue(uint32(i), s[2]) + } + i = idnaIndex[uint32(i)<<6+uint32(s[2])] + if c0 < 0xF8 { // 4-byte UTF-8 + return t.lookupValue(uint32(i), s[3]) + } + return 0 +} + +// idnaTrie. Total size: 31598 bytes (30.86 KiB). Checksum: d3118eda0d6b5360. +type idnaTrie struct{} + +func newIdnaTrie(i int) *idnaTrie { + return &idnaTrie{} +} + +// lookupValue determines the type of block n and looks up the value for b. +func (t *idnaTrie) lookupValue(n uint32, b byte) uint16 { + switch { + case n < 133: + return uint16(idnaValues[n<<6+uint32(b)]) + default: + n -= 133 + return uint16(idnaSparse.lookup(n, b)) + } +} + +// idnaValues: 135 blocks, 8640 entries, 17280 bytes +// The third block is the zero block. +var idnaValues = [8640]uint16{ + // Block 0x0, offset 0x0 + 0x00: 0x0080, 0x01: 0x0080, 0x02: 0x0080, 0x03: 0x0080, 0x04: 0x0080, 0x05: 0x0080, + 0x06: 0x0080, 0x07: 0x0080, 0x08: 0x0080, 0x09: 0x0080, 0x0a: 0x0080, 0x0b: 0x0080, + 0x0c: 0x0080, 0x0d: 0x0080, 0x0e: 0x0080, 0x0f: 0x0080, 0x10: 0x0080, 0x11: 0x0080, + 0x12: 0x0080, 0x13: 0x0080, 0x14: 0x0080, 0x15: 0x0080, 0x16: 0x0080, 0x17: 0x0080, + 0x18: 0x0080, 0x19: 0x0080, 0x1a: 0x0080, 0x1b: 0x0080, 0x1c: 0x0080, 0x1d: 0x0080, + 0x1e: 0x0080, 0x1f: 0x0080, 0x20: 0x0080, 0x21: 0x0080, 0x22: 0x0080, 0x23: 0x0080, + 0x24: 0x0080, 0x25: 0x0080, 0x26: 0x0080, 0x27: 0x0080, 0x28: 0x0080, 0x29: 0x0080, + 0x2a: 0x0080, 0x2b: 0x0080, 0x2c: 0x0080, 0x2d: 0x0008, 0x2e: 0x0008, 0x2f: 0x0080, + 0x30: 0x0008, 0x31: 0x0008, 0x32: 0x0008, 0x33: 0x0008, 0x34: 0x0008, 0x35: 0x0008, + 0x36: 0x0008, 0x37: 0x0008, 0x38: 0x0008, 0x39: 0x0008, 0x3a: 0x0080, 0x3b: 0x0080, + 0x3c: 0x0080, 0x3d: 0x0080, 0x3e: 0x0080, 0x3f: 0x0080, + // Block 0x1, offset 0x40 + 0x40: 0x0080, 0x41: 0xe105, 0x42: 0xe105, 0x43: 0xe105, 0x44: 0xe105, 0x45: 0xe105, + 0x46: 0xe105, 0x47: 0xe105, 0x48: 0xe105, 0x49: 0xe105, 0x4a: 0xe105, 0x4b: 0xe105, + 0x4c: 0xe105, 0x4d: 0xe105, 0x4e: 0xe105, 0x4f: 0xe105, 0x50: 0xe105, 0x51: 0xe105, + 0x52: 0xe105, 0x53: 0xe105, 0x54: 0xe105, 0x55: 0xe105, 0x56: 0xe105, 0x57: 0xe105, + 0x58: 0xe105, 0x59: 0xe105, 0x5a: 0xe105, 0x5b: 0x0080, 0x5c: 0x0080, 0x5d: 0x0080, + 0x5e: 0x0080, 0x5f: 0x0080, 0x60: 0x0080, 0x61: 0x0008, 0x62: 0x0008, 0x63: 0x0008, + 0x64: 0x0008, 0x65: 0x0008, 0x66: 0x0008, 0x67: 0x0008, 0x68: 0x0008, 0x69: 0x0008, + 0x6a: 0x0008, 0x6b: 0x0008, 0x6c: 0x0008, 0x6d: 0x0008, 0x6e: 0x0008, 0x6f: 0x0008, + 0x70: 0x0008, 0x71: 0x0008, 0x72: 0x0008, 0x73: 0x0008, 0x74: 0x0008, 0x75: 0x0008, + 0x76: 0x0008, 0x77: 0x0008, 0x78: 0x0008, 0x79: 0x0008, 0x7a: 0x0008, 0x7b: 0x0080, + 0x7c: 0x0080, 0x7d: 0x0080, 0x7e: 0x0080, 0x7f: 0x0080, + // Block 0x2, offset 0x80 + // Block 0x3, offset 0xc0 + 0xc0: 0x0040, 0xc1: 0x0040, 0xc2: 0x0040, 0xc3: 0x0040, 0xc4: 0x0040, 0xc5: 0x0040, + 0xc6: 0x0040, 0xc7: 0x0040, 0xc8: 0x0040, 0xc9: 0x0040, 0xca: 0x0040, 0xcb: 0x0040, + 0xcc: 0x0040, 0xcd: 0x0040, 0xce: 0x0040, 0xcf: 0x0040, 0xd0: 0x0040, 0xd1: 0x0040, + 0xd2: 0x0040, 0xd3: 0x0040, 0xd4: 0x0040, 0xd5: 0x0040, 0xd6: 0x0040, 0xd7: 0x0040, + 0xd8: 0x0040, 0xd9: 0x0040, 0xda: 0x0040, 0xdb: 0x0040, 0xdc: 0x0040, 0xdd: 0x0040, + 0xde: 0x0040, 0xdf: 0x0040, 0xe0: 0x000a, 0xe1: 0x0018, 0xe2: 0x0018, 0xe3: 0x0018, + 0xe4: 0x0018, 0xe5: 0x0018, 0xe6: 0x0018, 0xe7: 0x0018, 0xe8: 0x0012, 0xe9: 0x0018, + 0xea: 0x0019, 0xeb: 0x0018, 0xec: 0x0018, 0xed: 0x03c0, 0xee: 0x0018, 0xef: 0x0022, + 0xf0: 0x0018, 0xf1: 0x0018, 0xf2: 0x0029, 0xf3: 0x0031, 0xf4: 0x003a, 0xf5: 0x0005, + 0xf6: 0x0018, 0xf7: 0x0008, 0xf8: 0x0042, 0xf9: 0x0049, 0xfa: 0x0051, 0xfb: 0x0018, + 0xfc: 0x0059, 0xfd: 0x0061, 0xfe: 0x0069, 0xff: 0x0018, + // Block 0x4, offset 0x100 + 0x100: 0xe00d, 0x101: 0x0008, 0x102: 0xe00d, 0x103: 0x0008, 0x104: 0xe00d, 0x105: 0x0008, + 0x106: 0xe00d, 0x107: 0x0008, 0x108: 0xe00d, 0x109: 0x0008, 0x10a: 0xe00d, 0x10b: 0x0008, + 0x10c: 0xe00d, 0x10d: 0x0008, 0x10e: 0xe00d, 0x10f: 0x0008, 0x110: 0xe00d, 0x111: 0x0008, + 0x112: 0xe00d, 0x113: 0x0008, 0x114: 0xe00d, 0x115: 0x0008, 0x116: 0xe00d, 0x117: 0x0008, + 0x118: 0xe00d, 0x119: 0x0008, 0x11a: 0xe00d, 0x11b: 0x0008, 0x11c: 0xe00d, 0x11d: 0x0008, + 0x11e: 0xe00d, 0x11f: 0x0008, 0x120: 0xe00d, 0x121: 0x0008, 0x122: 0xe00d, 0x123: 0x0008, + 0x124: 0xe00d, 0x125: 0x0008, 0x126: 0xe00d, 0x127: 0x0008, 0x128: 0xe00d, 0x129: 0x0008, + 0x12a: 0xe00d, 0x12b: 0x0008, 0x12c: 0xe00d, 0x12d: 0x0008, 0x12e: 0xe00d, 0x12f: 0x0008, + 0x130: 0x0071, 0x131: 0x0008, 0x132: 0x0035, 0x133: 0x004d, 0x134: 0xe00d, 0x135: 0x0008, + 0x136: 0xe00d, 0x137: 0x0008, 0x138: 0x0008, 0x139: 0xe01d, 0x13a: 0x0008, 0x13b: 0xe03d, + 0x13c: 0x0008, 0x13d: 0xe01d, 0x13e: 0x0008, 0x13f: 0x0079, + // Block 0x5, offset 0x140 + 0x140: 0x0079, 0x141: 0xe01d, 0x142: 0x0008, 0x143: 0xe03d, 0x144: 0x0008, 0x145: 0xe01d, + 0x146: 0x0008, 0x147: 0xe07d, 0x148: 0x0008, 0x149: 0x0081, 0x14a: 0xe00d, 0x14b: 0x0008, + 0x14c: 0xe00d, 0x14d: 0x0008, 0x14e: 0xe00d, 0x14f: 0x0008, 0x150: 0xe00d, 0x151: 0x0008, + 0x152: 0xe00d, 0x153: 0x0008, 0x154: 0xe00d, 0x155: 0x0008, 0x156: 0xe00d, 0x157: 0x0008, + 0x158: 0xe00d, 0x159: 0x0008, 0x15a: 0xe00d, 0x15b: 0x0008, 0x15c: 0xe00d, 0x15d: 0x0008, + 0x15e: 0xe00d, 0x15f: 0x0008, 0x160: 0xe00d, 0x161: 0x0008, 0x162: 0xe00d, 0x163: 0x0008, + 0x164: 0xe00d, 0x165: 0x0008, 0x166: 0xe00d, 0x167: 0x0008, 0x168: 0xe00d, 0x169: 0x0008, + 0x16a: 0xe00d, 0x16b: 0x0008, 0x16c: 0xe00d, 0x16d: 0x0008, 0x16e: 0xe00d, 0x16f: 0x0008, + 0x170: 0xe00d, 0x171: 0x0008, 0x172: 0xe00d, 0x173: 0x0008, 0x174: 0xe00d, 0x175: 0x0008, + 0x176: 0xe00d, 0x177: 0x0008, 0x178: 0x0065, 0x179: 0xe01d, 0x17a: 0x0008, 0x17b: 0xe03d, + 0x17c: 0x0008, 0x17d: 0xe01d, 0x17e: 0x0008, 0x17f: 0x0089, + // Block 0x6, offset 0x180 + 0x180: 0x0008, 0x181: 0x007d, 0x182: 0xe00d, 0x183: 0x0008, 0x184: 0xe00d, 0x185: 0x0008, + 0x186: 0x007d, 0x187: 0xe07d, 0x188: 0x0008, 0x189: 0x0095, 0x18a: 0x00ad, 0x18b: 0xe03d, + 0x18c: 0x0008, 0x18d: 0x0008, 0x18e: 0x00c5, 0x18f: 0x00dd, 0x190: 0x00f5, 0x191: 0xe01d, + 0x192: 0x0008, 0x193: 0x010d, 0x194: 0x0125, 0x195: 0x0008, 0x196: 0x013d, 0x197: 0x013d, + 0x198: 0xe00d, 0x199: 0x0008, 0x19a: 0x0008, 0x19b: 0x0008, 0x19c: 0x010d, 0x19d: 0x0155, + 0x19e: 0x0008, 0x19f: 0x016d, 0x1a0: 0xe00d, 0x1a1: 0x0008, 0x1a2: 0xe00d, 0x1a3: 0x0008, + 0x1a4: 0xe00d, 0x1a5: 0x0008, 0x1a6: 0x0185, 0x1a7: 0xe07d, 0x1a8: 0x0008, 0x1a9: 0x019d, + 0x1aa: 0x0008, 0x1ab: 0x0008, 0x1ac: 0xe00d, 0x1ad: 0x0008, 0x1ae: 0x0185, 0x1af: 0xe0fd, + 0x1b0: 0x0008, 0x1b1: 0x01b5, 0x1b2: 0x01cd, 0x1b3: 0xe03d, 0x1b4: 0x0008, 0x1b5: 0xe01d, + 0x1b6: 0x0008, 0x1b7: 0x01e5, 0x1b8: 0xe00d, 0x1b9: 0x0008, 0x1ba: 0x0008, 0x1bb: 0x0008, + 0x1bc: 0xe00d, 0x1bd: 0x0008, 0x1be: 0x0008, 0x1bf: 0x0008, + // Block 0x7, offset 0x1c0 + 0x1c0: 0x0008, 0x1c1: 0x0008, 0x1c2: 0x0008, 0x1c3: 0x0008, 0x1c4: 0x0091, 0x1c5: 0x0091, + 0x1c6: 0x0091, 0x1c7: 0x01fd, 0x1c8: 0x0215, 0x1c9: 0x022d, 0x1ca: 0x0245, 0x1cb: 0x025d, + 0x1cc: 0x0275, 0x1cd: 0xe01d, 0x1ce: 0x0008, 0x1cf: 0xe0fd, 0x1d0: 0x0008, 0x1d1: 0xe01d, + 0x1d2: 0x0008, 0x1d3: 0xe03d, 0x1d4: 0x0008, 0x1d5: 0xe01d, 0x1d6: 0x0008, 0x1d7: 0xe07d, + 0x1d8: 0x0008, 0x1d9: 0xe01d, 0x1da: 0x0008, 0x1db: 0xe03d, 0x1dc: 0x0008, 0x1dd: 0x0008, + 0x1de: 0xe00d, 0x1df: 0x0008, 0x1e0: 0xe00d, 0x1e1: 0x0008, 0x1e2: 0xe00d, 0x1e3: 0x0008, + 0x1e4: 0xe00d, 0x1e5: 0x0008, 0x1e6: 0xe00d, 0x1e7: 0x0008, 0x1e8: 0xe00d, 0x1e9: 0x0008, + 0x1ea: 0xe00d, 0x1eb: 0x0008, 0x1ec: 0xe00d, 0x1ed: 0x0008, 0x1ee: 0xe00d, 0x1ef: 0x0008, + 0x1f0: 0x0008, 0x1f1: 0x028d, 0x1f2: 0x02a5, 0x1f3: 0x02bd, 0x1f4: 0xe00d, 0x1f5: 0x0008, + 0x1f6: 0x02d5, 0x1f7: 0x02ed, 0x1f8: 0xe00d, 0x1f9: 0x0008, 0x1fa: 0xe00d, 0x1fb: 0x0008, + 0x1fc: 0xe00d, 0x1fd: 0x0008, 0x1fe: 0xe00d, 0x1ff: 0x0008, + // Block 0x8, offset 0x200 + 0x200: 0xe00d, 0x201: 0x0008, 0x202: 0xe00d, 0x203: 0x0008, 0x204: 0xe00d, 0x205: 0x0008, + 0x206: 0xe00d, 0x207: 0x0008, 0x208: 0xe00d, 0x209: 0x0008, 0x20a: 0xe00d, 0x20b: 0x0008, + 0x20c: 0xe00d, 0x20d: 0x0008, 0x20e: 0xe00d, 0x20f: 0x0008, 0x210: 0xe00d, 0x211: 0x0008, + 0x212: 0xe00d, 0x213: 0x0008, 0x214: 0xe00d, 0x215: 0x0008, 0x216: 0xe00d, 0x217: 0x0008, + 0x218: 0xe00d, 0x219: 0x0008, 0x21a: 0xe00d, 0x21b: 0x0008, 0x21c: 0xe00d, 0x21d: 0x0008, + 0x21e: 0xe00d, 0x21f: 0x0008, 0x220: 0x0305, 0x221: 0x0008, 0x222: 0xe00d, 0x223: 0x0008, + 0x224: 0xe00d, 0x225: 0x0008, 0x226: 0xe00d, 0x227: 0x0008, 0x228: 0xe00d, 0x229: 0x0008, + 0x22a: 0xe00d, 0x22b: 0x0008, 0x22c: 0xe00d, 0x22d: 0x0008, 0x22e: 0xe00d, 0x22f: 0x0008, + 0x230: 0xe00d, 0x231: 0x0008, 0x232: 0xe00d, 0x233: 0x0008, 0x234: 0x0008, 0x235: 0x0008, + 0x236: 0x0008, 0x237: 0x0008, 0x238: 0x0008, 0x239: 0x0008, 0x23a: 0x0099, 0x23b: 0xe03d, + 0x23c: 0x0008, 0x23d: 0x031d, 0x23e: 0x00a1, 0x23f: 0x0008, + // Block 0x9, offset 0x240 + 0x240: 0x0008, 0x241: 0x0008, 0x242: 0x0018, 0x243: 0x0018, 0x244: 0x0018, 0x245: 0x0018, + 0x246: 0x0008, 0x247: 0x0008, 0x248: 0x0008, 0x249: 0x0008, 0x24a: 0x0008, 0x24b: 0x0008, + 0x24c: 0x0008, 0x24d: 0x0008, 0x24e: 0x0008, 0x24f: 0x0008, 0x250: 0x0008, 0x251: 0x0008, + 0x252: 0x0018, 0x253: 0x0018, 0x254: 0x0018, 0x255: 0x0018, 0x256: 0x0018, 0x257: 0x0018, + 0x258: 0x00d2, 0x259: 0x00da, 0x25a: 0x00e2, 0x25b: 0x00ea, 0x25c: 0x00f2, 0x25d: 0x00fa, + 0x25e: 0x0018, 0x25f: 0x0018, 0x260: 0x03ad, 0x261: 0x0101, 0x262: 0x0089, 0x263: 0x0109, + 0x264: 0x03c5, 0x265: 0x0018, 0x266: 0x0018, 0x267: 0x0018, 0x268: 0x0018, 0x269: 0x0018, + 0x26a: 0x0018, 0x26b: 0x0018, 0x26c: 0x0008, 0x26d: 0x0018, 0x26e: 0x0008, 0x26f: 0x0018, + 0x270: 0x0018, 0x271: 0x0018, 0x272: 0x0018, 0x273: 0x0018, 0x274: 0x0018, 0x275: 0x0018, + 0x276: 0x0018, 0x277: 0x0018, 0x278: 0x0018, 0x279: 0x0018, 0x27a: 0x0018, 0x27b: 0x0018, + 0x27c: 0x0018, 0x27d: 0x0018, 0x27e: 0x0018, 0x27f: 0x0018, + // Block 0xa, offset 0x280 + 0x280: 0x03dd, 0x281: 0x03dd, 0x282: 0x3308, 0x283: 0x03f5, 0x284: 0x0111, 0x285: 0x040d, + 0x286: 0x3308, 0x287: 0x3308, 0x288: 0x3308, 0x289: 0x3308, 0x28a: 0x3308, 0x28b: 0x3308, + 0x28c: 0x3308, 0x28d: 0x3308, 0x28e: 0x3308, 0x28f: 0x33c0, 0x290: 0x3308, 0x291: 0x3308, + 0x292: 0x3308, 0x293: 0x3308, 0x294: 0x3308, 0x295: 0x3308, 0x296: 0x3308, 0x297: 0x3308, + 0x298: 0x3308, 0x299: 0x3308, 0x29a: 0x3308, 0x29b: 0x3308, 0x29c: 0x3308, 0x29d: 0x3308, + 0x29e: 0x3308, 0x29f: 0x3308, 0x2a0: 0x3308, 0x2a1: 0x3308, 0x2a2: 0x3308, 0x2a3: 0x3308, + 0x2a4: 0x3308, 0x2a5: 0x3308, 0x2a6: 0x3308, 0x2a7: 0x3308, 0x2a8: 0x3308, 0x2a9: 0x3308, + 0x2aa: 0x3308, 0x2ab: 0x3308, 0x2ac: 0x3308, 0x2ad: 0x3308, 0x2ae: 0x3308, 0x2af: 0x3308, + 0x2b0: 0xe00d, 0x2b1: 0x0008, 0x2b2: 0xe00d, 0x2b3: 0x0008, 0x2b4: 0x0425, 0x2b5: 0x0008, + 0x2b6: 0xe00d, 0x2b7: 0x0008, 0x2b8: 0x0040, 0x2b9: 0x0040, 0x2ba: 0x011a, 0x2bb: 0x0008, + 0x2bc: 0x0008, 0x2bd: 0x0008, 0x2be: 0x0122, 0x2bf: 0x043d, + // Block 0xb, offset 0x2c0 + 0x2c0: 0x0040, 0x2c1: 0x0040, 0x2c2: 0x0040, 0x2c3: 0x0040, 0x2c4: 0x003a, 0x2c5: 0x012a, + 0x2c6: 0xe155, 0x2c7: 0x0455, 0x2c8: 0xe12d, 0x2c9: 0xe13d, 0x2ca: 0xe12d, 0x2cb: 0x0040, + 0x2cc: 0x03dd, 0x2cd: 0x0040, 0x2ce: 0x046d, 0x2cf: 0x0485, 0x2d0: 0x0008, 0x2d1: 0xe105, + 0x2d2: 0xe105, 0x2d3: 0xe105, 0x2d4: 0xe105, 0x2d5: 0xe105, 0x2d6: 0xe105, 0x2d7: 0xe105, + 0x2d8: 0xe105, 0x2d9: 0xe105, 0x2da: 0xe105, 0x2db: 0xe105, 0x2dc: 0xe105, 0x2dd: 0xe105, + 0x2de: 0xe105, 0x2df: 0xe105, 0x2e0: 0x049d, 0x2e1: 0x049d, 0x2e2: 0x0040, 0x2e3: 0x049d, + 0x2e4: 0x049d, 0x2e5: 0x049d, 0x2e6: 0x049d, 0x2e7: 0x049d, 0x2e8: 0x049d, 0x2e9: 0x049d, + 0x2ea: 0x049d, 0x2eb: 0x049d, 0x2ec: 0x0008, 0x2ed: 0x0008, 0x2ee: 0x0008, 0x2ef: 0x0008, + 0x2f0: 0x0008, 0x2f1: 0x0008, 0x2f2: 0x0008, 0x2f3: 0x0008, 0x2f4: 0x0008, 0x2f5: 0x0008, + 0x2f6: 0x0008, 0x2f7: 0x0008, 0x2f8: 0x0008, 0x2f9: 0x0008, 0x2fa: 0x0008, 0x2fb: 0x0008, + 0x2fc: 0x0008, 0x2fd: 0x0008, 0x2fe: 0x0008, 0x2ff: 0x0008, + // Block 0xc, offset 0x300 + 0x300: 0x0008, 0x301: 0x0008, 0x302: 0xe00f, 0x303: 0x0008, 0x304: 0x0008, 0x305: 0x0008, + 0x306: 0x0008, 0x307: 0x0008, 0x308: 0x0008, 0x309: 0x0008, 0x30a: 0x0008, 0x30b: 0x0008, + 0x30c: 0x0008, 0x30d: 0x0008, 0x30e: 0x0008, 0x30f: 0xe0c5, 0x310: 0x04b5, 0x311: 0x04cd, + 0x312: 0xe0bd, 0x313: 0xe0f5, 0x314: 0xe0fd, 0x315: 0xe09d, 0x316: 0xe0b5, 0x317: 0x0008, + 0x318: 0xe00d, 0x319: 0x0008, 0x31a: 0xe00d, 0x31b: 0x0008, 0x31c: 0xe00d, 0x31d: 0x0008, + 0x31e: 0xe00d, 0x31f: 0x0008, 0x320: 0xe00d, 0x321: 0x0008, 0x322: 0xe00d, 0x323: 0x0008, + 0x324: 0xe00d, 0x325: 0x0008, 0x326: 0xe00d, 0x327: 0x0008, 0x328: 0xe00d, 0x329: 0x0008, + 0x32a: 0xe00d, 0x32b: 0x0008, 0x32c: 0xe00d, 0x32d: 0x0008, 0x32e: 0xe00d, 0x32f: 0x0008, + 0x330: 0x04e5, 0x331: 0xe185, 0x332: 0xe18d, 0x333: 0x0008, 0x334: 0x04fd, 0x335: 0x03dd, + 0x336: 0x0018, 0x337: 0xe07d, 0x338: 0x0008, 0x339: 0xe1d5, 0x33a: 0xe00d, 0x33b: 0x0008, + 0x33c: 0x0008, 0x33d: 0x0515, 0x33e: 0x052d, 0x33f: 0x052d, + // Block 0xd, offset 0x340 + 0x340: 0x0008, 0x341: 0x0008, 0x342: 0x0008, 0x343: 0x0008, 0x344: 0x0008, 0x345: 0x0008, + 0x346: 0x0008, 0x347: 0x0008, 0x348: 0x0008, 0x349: 0x0008, 0x34a: 0x0008, 0x34b: 0x0008, + 0x34c: 0x0008, 0x34d: 0x0008, 0x34e: 0x0008, 0x34f: 0x0008, 0x350: 0x0008, 0x351: 0x0008, + 0x352: 0x0008, 0x353: 0x0008, 0x354: 0x0008, 0x355: 0x0008, 0x356: 0x0008, 0x357: 0x0008, + 0x358: 0x0008, 0x359: 0x0008, 0x35a: 0x0008, 0x35b: 0x0008, 0x35c: 0x0008, 0x35d: 0x0008, + 0x35e: 0x0008, 0x35f: 0x0008, 0x360: 0xe00d, 0x361: 0x0008, 0x362: 0xe00d, 0x363: 0x0008, + 0x364: 0xe00d, 0x365: 0x0008, 0x366: 0xe00d, 0x367: 0x0008, 0x368: 0xe00d, 0x369: 0x0008, + 0x36a: 0xe00d, 0x36b: 0x0008, 0x36c: 0xe00d, 0x36d: 0x0008, 0x36e: 0xe00d, 0x36f: 0x0008, + 0x370: 0xe00d, 0x371: 0x0008, 0x372: 0xe00d, 0x373: 0x0008, 0x374: 0xe00d, 0x375: 0x0008, + 0x376: 0xe00d, 0x377: 0x0008, 0x378: 0xe00d, 0x379: 0x0008, 0x37a: 0xe00d, 0x37b: 0x0008, + 0x37c: 0xe00d, 0x37d: 0x0008, 0x37e: 0xe00d, 0x37f: 0x0008, + // Block 0xe, offset 0x380 + 0x380: 0xe00d, 0x381: 0x0008, 0x382: 0x0018, 0x383: 0x3308, 0x384: 0x3308, 0x385: 0x3308, + 0x386: 0x3308, 0x387: 0x3308, 0x388: 0x3318, 0x389: 0x3318, 0x38a: 0xe00d, 0x38b: 0x0008, + 0x38c: 0xe00d, 0x38d: 0x0008, 0x38e: 0xe00d, 0x38f: 0x0008, 0x390: 0xe00d, 0x391: 0x0008, + 0x392: 0xe00d, 0x393: 0x0008, 0x394: 0xe00d, 0x395: 0x0008, 0x396: 0xe00d, 0x397: 0x0008, + 0x398: 0xe00d, 0x399: 0x0008, 0x39a: 0xe00d, 0x39b: 0x0008, 0x39c: 0xe00d, 0x39d: 0x0008, + 0x39e: 0xe00d, 0x39f: 0x0008, 0x3a0: 0xe00d, 0x3a1: 0x0008, 0x3a2: 0xe00d, 0x3a3: 0x0008, + 0x3a4: 0xe00d, 0x3a5: 0x0008, 0x3a6: 0xe00d, 0x3a7: 0x0008, 0x3a8: 0xe00d, 0x3a9: 0x0008, + 0x3aa: 0xe00d, 0x3ab: 0x0008, 0x3ac: 0xe00d, 0x3ad: 0x0008, 0x3ae: 0xe00d, 0x3af: 0x0008, + 0x3b0: 0xe00d, 0x3b1: 0x0008, 0x3b2: 0xe00d, 0x3b3: 0x0008, 0x3b4: 0xe00d, 0x3b5: 0x0008, + 0x3b6: 0xe00d, 0x3b7: 0x0008, 0x3b8: 0xe00d, 0x3b9: 0x0008, 0x3ba: 0xe00d, 0x3bb: 0x0008, + 0x3bc: 0xe00d, 0x3bd: 0x0008, 0x3be: 0xe00d, 0x3bf: 0x0008, + // Block 0xf, offset 0x3c0 + 0x3c0: 0x0040, 0x3c1: 0xe01d, 0x3c2: 0x0008, 0x3c3: 0xe03d, 0x3c4: 0x0008, 0x3c5: 0xe01d, + 0x3c6: 0x0008, 0x3c7: 0xe07d, 0x3c8: 0x0008, 0x3c9: 0xe01d, 0x3ca: 0x0008, 0x3cb: 0xe03d, + 0x3cc: 0x0008, 0x3cd: 0xe01d, 0x3ce: 0x0008, 0x3cf: 0x0008, 0x3d0: 0xe00d, 0x3d1: 0x0008, + 0x3d2: 0xe00d, 0x3d3: 0x0008, 0x3d4: 0xe00d, 0x3d5: 0x0008, 0x3d6: 0xe00d, 0x3d7: 0x0008, + 0x3d8: 0xe00d, 0x3d9: 0x0008, 0x3da: 0xe00d, 0x3db: 0x0008, 0x3dc: 0xe00d, 0x3dd: 0x0008, + 0x3de: 0xe00d, 0x3df: 0x0008, 0x3e0: 0xe00d, 0x3e1: 0x0008, 0x3e2: 0xe00d, 0x3e3: 0x0008, + 0x3e4: 0xe00d, 0x3e5: 0x0008, 0x3e6: 0xe00d, 0x3e7: 0x0008, 0x3e8: 0xe00d, 0x3e9: 0x0008, + 0x3ea: 0xe00d, 0x3eb: 0x0008, 0x3ec: 0xe00d, 0x3ed: 0x0008, 0x3ee: 0xe00d, 0x3ef: 0x0008, + 0x3f0: 0xe00d, 0x3f1: 0x0008, 0x3f2: 0xe00d, 0x3f3: 0x0008, 0x3f4: 0xe00d, 0x3f5: 0x0008, + 0x3f6: 0xe00d, 0x3f7: 0x0008, 0x3f8: 0xe00d, 0x3f9: 0x0008, 0x3fa: 0xe00d, 0x3fb: 0x0008, + 0x3fc: 0xe00d, 0x3fd: 0x0008, 0x3fe: 0xe00d, 0x3ff: 0x0008, + // Block 0x10, offset 0x400 + 0x400: 0xe00d, 0x401: 0x0008, 0x402: 0xe00d, 0x403: 0x0008, 0x404: 0xe00d, 0x405: 0x0008, + 0x406: 0xe00d, 0x407: 0x0008, 0x408: 0xe00d, 0x409: 0x0008, 0x40a: 0xe00d, 0x40b: 0x0008, + 0x40c: 0xe00d, 0x40d: 0x0008, 0x40e: 0xe00d, 0x40f: 0x0008, 0x410: 0xe00d, 0x411: 0x0008, + 0x412: 0xe00d, 0x413: 0x0008, 0x414: 0xe00d, 0x415: 0x0008, 0x416: 0xe00d, 0x417: 0x0008, + 0x418: 0xe00d, 0x419: 0x0008, 0x41a: 0xe00d, 0x41b: 0x0008, 0x41c: 0xe00d, 0x41d: 0x0008, + 0x41e: 0xe00d, 0x41f: 0x0008, 0x420: 0xe00d, 0x421: 0x0008, 0x422: 0xe00d, 0x423: 0x0008, + 0x424: 0xe00d, 0x425: 0x0008, 0x426: 0xe00d, 0x427: 0x0008, 0x428: 0xe00d, 0x429: 0x0008, + 0x42a: 0xe00d, 0x42b: 0x0008, 0x42c: 0xe00d, 0x42d: 0x0008, 0x42e: 0xe00d, 0x42f: 0x0008, + 0x430: 0x0040, 0x431: 0x03f5, 0x432: 0x03f5, 0x433: 0x03f5, 0x434: 0x03f5, 0x435: 0x03f5, + 0x436: 0x03f5, 0x437: 0x03f5, 0x438: 0x03f5, 0x439: 0x03f5, 0x43a: 0x03f5, 0x43b: 0x03f5, + 0x43c: 0x03f5, 0x43d: 0x03f5, 0x43e: 0x03f5, 0x43f: 0x03f5, + // Block 0x11, offset 0x440 + 0x440: 0x0840, 0x441: 0x0840, 0x442: 0x0840, 0x443: 0x0840, 0x444: 0x0840, 0x445: 0x0840, + 0x446: 0x0018, 0x447: 0x0018, 0x448: 0x0818, 0x449: 0x0018, 0x44a: 0x0018, 0x44b: 0x0818, + 0x44c: 0x0018, 0x44d: 0x0818, 0x44e: 0x0018, 0x44f: 0x0018, 0x450: 0x3308, 0x451: 0x3308, + 0x452: 0x3308, 0x453: 0x3308, 0x454: 0x3308, 0x455: 0x3308, 0x456: 0x3308, 0x457: 0x3308, + 0x458: 0x3308, 0x459: 0x3308, 0x45a: 0x3308, 0x45b: 0x0818, 0x45c: 0x0b40, 0x45d: 0x0818, + 0x45e: 0x0818, 0x45f: 0x0818, 0x460: 0x0a08, 0x461: 0x0808, 0x462: 0x0c08, 0x463: 0x0c08, + 0x464: 0x0c08, 0x465: 0x0c08, 0x466: 0x0a08, 0x467: 0x0c08, 0x468: 0x0a08, 0x469: 0x0c08, + 0x46a: 0x0a08, 0x46b: 0x0a08, 0x46c: 0x0a08, 0x46d: 0x0a08, 0x46e: 0x0a08, 0x46f: 0x0c08, + 0x470: 0x0c08, 0x471: 0x0c08, 0x472: 0x0c08, 0x473: 0x0a08, 0x474: 0x0a08, 0x475: 0x0a08, + 0x476: 0x0a08, 0x477: 0x0a08, 0x478: 0x0a08, 0x479: 0x0a08, 0x47a: 0x0a08, 0x47b: 0x0a08, + 0x47c: 0x0a08, 0x47d: 0x0a08, 0x47e: 0x0a08, 0x47f: 0x0a08, + // Block 0x12, offset 0x480 + 0x480: 0x0818, 0x481: 0x0a08, 0x482: 0x0a08, 0x483: 0x0a08, 0x484: 0x0a08, 0x485: 0x0a08, + 0x486: 0x0a08, 0x487: 0x0a08, 0x488: 0x0c08, 0x489: 0x0a08, 0x48a: 0x0a08, 0x48b: 0x3308, + 0x48c: 0x3308, 0x48d: 0x3308, 0x48e: 0x3308, 0x48f: 0x3308, 0x490: 0x3308, 0x491: 0x3308, + 0x492: 0x3308, 0x493: 0x3308, 0x494: 0x3308, 0x495: 0x3308, 0x496: 0x3308, 0x497: 0x3308, + 0x498: 0x3308, 0x499: 0x3308, 0x49a: 0x3308, 0x49b: 0x3308, 0x49c: 0x3308, 0x49d: 0x3308, + 0x49e: 0x3308, 0x49f: 0x3308, 0x4a0: 0x0808, 0x4a1: 0x0808, 0x4a2: 0x0808, 0x4a3: 0x0808, + 0x4a4: 0x0808, 0x4a5: 0x0808, 0x4a6: 0x0808, 0x4a7: 0x0808, 0x4a8: 0x0808, 0x4a9: 0x0808, + 0x4aa: 0x0018, 0x4ab: 0x0818, 0x4ac: 0x0818, 0x4ad: 0x0818, 0x4ae: 0x0a08, 0x4af: 0x0a08, + 0x4b0: 0x3308, 0x4b1: 0x0c08, 0x4b2: 0x0c08, 0x4b3: 0x0c08, 0x4b4: 0x0808, 0x4b5: 0x0139, + 0x4b6: 0x0141, 0x4b7: 0x0149, 0x4b8: 0x0151, 0x4b9: 0x0a08, 0x4ba: 0x0a08, 0x4bb: 0x0a08, + 0x4bc: 0x0a08, 0x4bd: 0x0a08, 0x4be: 0x0a08, 0x4bf: 0x0a08, + // Block 0x13, offset 0x4c0 + 0x4c0: 0x0c08, 0x4c1: 0x0a08, 0x4c2: 0x0a08, 0x4c3: 0x0c08, 0x4c4: 0x0c08, 0x4c5: 0x0c08, + 0x4c6: 0x0c08, 0x4c7: 0x0c08, 0x4c8: 0x0c08, 0x4c9: 0x0c08, 0x4ca: 0x0c08, 0x4cb: 0x0c08, + 0x4cc: 0x0a08, 0x4cd: 0x0c08, 0x4ce: 0x0a08, 0x4cf: 0x0c08, 0x4d0: 0x0a08, 0x4d1: 0x0a08, + 0x4d2: 0x0c08, 0x4d3: 0x0c08, 0x4d4: 0x0818, 0x4d5: 0x0c08, 0x4d6: 0x3308, 0x4d7: 0x3308, + 0x4d8: 0x3308, 0x4d9: 0x3308, 0x4da: 0x3308, 0x4db: 0x3308, 0x4dc: 0x3308, 0x4dd: 0x0840, + 0x4de: 0x0018, 0x4df: 0x3308, 0x4e0: 0x3308, 0x4e1: 0x3308, 0x4e2: 0x3308, 0x4e3: 0x3308, + 0x4e4: 0x3308, 0x4e5: 0x0808, 0x4e6: 0x0808, 0x4e7: 0x3308, 0x4e8: 0x3308, 0x4e9: 0x0018, + 0x4ea: 0x3308, 0x4eb: 0x3308, 0x4ec: 0x3308, 0x4ed: 0x3308, 0x4ee: 0x0c08, 0x4ef: 0x0c08, + 0x4f0: 0x0008, 0x4f1: 0x0008, 0x4f2: 0x0008, 0x4f3: 0x0008, 0x4f4: 0x0008, 0x4f5: 0x0008, + 0x4f6: 0x0008, 0x4f7: 0x0008, 0x4f8: 0x0008, 0x4f9: 0x0008, 0x4fa: 0x0a08, 0x4fb: 0x0a08, + 0x4fc: 0x0a08, 0x4fd: 0x0808, 0x4fe: 0x0808, 0x4ff: 0x0a08, + // Block 0x14, offset 0x500 + 0x500: 0x0818, 0x501: 0x0818, 0x502: 0x0818, 0x503: 0x0818, 0x504: 0x0818, 0x505: 0x0818, + 0x506: 0x0818, 0x507: 0x0818, 0x508: 0x0818, 0x509: 0x0818, 0x50a: 0x0818, 0x50b: 0x0818, + 0x50c: 0x0818, 0x50d: 0x0818, 0x50e: 0x0040, 0x50f: 0x0b40, 0x510: 0x0c08, 0x511: 0x3308, + 0x512: 0x0a08, 0x513: 0x0a08, 0x514: 0x0a08, 0x515: 0x0c08, 0x516: 0x0c08, 0x517: 0x0c08, + 0x518: 0x0c08, 0x519: 0x0c08, 0x51a: 0x0a08, 0x51b: 0x0a08, 0x51c: 0x0a08, 0x51d: 0x0a08, + 0x51e: 0x0c08, 0x51f: 0x0a08, 0x520: 0x0a08, 0x521: 0x0a08, 0x522: 0x0a08, 0x523: 0x0a08, + 0x524: 0x0a08, 0x525: 0x0a08, 0x526: 0x0a08, 0x527: 0x0a08, 0x528: 0x0c08, 0x529: 0x0a08, + 0x52a: 0x0c08, 0x52b: 0x0a08, 0x52c: 0x0c08, 0x52d: 0x0a08, 0x52e: 0x0a08, 0x52f: 0x0c08, + 0x530: 0x3308, 0x531: 0x3308, 0x532: 0x3308, 0x533: 0x3308, 0x534: 0x3308, 0x535: 0x3308, + 0x536: 0x3308, 0x537: 0x3308, 0x538: 0x3308, 0x539: 0x3308, 0x53a: 0x3308, 0x53b: 0x3308, + 0x53c: 0x3308, 0x53d: 0x3308, 0x53e: 0x3308, 0x53f: 0x3308, + // Block 0x15, offset 0x540 + 0x540: 0x0c08, 0x541: 0x0a08, 0x542: 0x0a08, 0x543: 0x0a08, 0x544: 0x0a08, 0x545: 0x0a08, + 0x546: 0x0c08, 0x547: 0x0c08, 0x548: 0x0a08, 0x549: 0x0c08, 0x54a: 0x0a08, 0x54b: 0x0a08, + 0x54c: 0x0a08, 0x54d: 0x0a08, 0x54e: 0x0a08, 0x54f: 0x0a08, 0x550: 0x0a08, 0x551: 0x0a08, + 0x552: 0x0a08, 0x553: 0x0a08, 0x554: 0x0c08, 0x555: 0x0a08, 0x556: 0x0c08, 0x557: 0x0c08, + 0x558: 0x0c08, 0x559: 0x3308, 0x55a: 0x3308, 0x55b: 0x3308, 0x55c: 0x0040, 0x55d: 0x0040, + 0x55e: 0x0818, 0x55f: 0x0040, 0x560: 0x0a08, 0x561: 0x0808, 0x562: 0x0a08, 0x563: 0x0a08, + 0x564: 0x0a08, 0x565: 0x0a08, 0x566: 0x0808, 0x567: 0x0c08, 0x568: 0x0a08, 0x569: 0x0c08, + 0x56a: 0x0c08, 0x56b: 0x0040, 0x56c: 0x0040, 0x56d: 0x0040, 0x56e: 0x0040, 0x56f: 0x0040, + 0x570: 0x0c08, 0x571: 0x0c08, 0x572: 0x0c08, 0x573: 0x0c08, 0x574: 0x0c08, 0x575: 0x0c08, + 0x576: 0x0c08, 0x577: 0x0c08, 0x578: 0x0c08, 0x579: 0x0c08, 0x57a: 0x0c08, 0x57b: 0x0c08, + 0x57c: 0x0c08, 0x57d: 0x0c08, 0x57e: 0x0c08, 0x57f: 0x0c08, + // Block 0x16, offset 0x580 + 0x580: 0x0c08, 0x581: 0x0c08, 0x582: 0x0c08, 0x583: 0x0808, 0x584: 0x0808, 0x585: 0x0808, + 0x586: 0x0a08, 0x587: 0x0808, 0x588: 0x0818, 0x589: 0x0a08, 0x58a: 0x0a08, 0x58b: 0x0a08, + 0x58c: 0x0a08, 0x58d: 0x0a08, 0x58e: 0x0c08, 0x58f: 0x0040, 0x590: 0x0840, 0x591: 0x0840, + 0x592: 0x0040, 0x593: 0x0040, 0x594: 0x0040, 0x595: 0x0040, 0x596: 0x0040, 0x597: 0x0040, + 0x598: 0x3308, 0x599: 0x3308, 0x59a: 0x3308, 0x59b: 0x3308, 0x59c: 0x3308, 0x59d: 0x3308, + 0x59e: 0x3308, 0x59f: 0x3308, 0x5a0: 0x0a08, 0x5a1: 0x0a08, 0x5a2: 0x0a08, 0x5a3: 0x0a08, + 0x5a4: 0x0a08, 0x5a5: 0x0a08, 0x5a6: 0x0a08, 0x5a7: 0x0a08, 0x5a8: 0x0a08, 0x5a9: 0x0a08, + 0x5aa: 0x0c08, 0x5ab: 0x0c08, 0x5ac: 0x0c08, 0x5ad: 0x0808, 0x5ae: 0x0c08, 0x5af: 0x0a08, + 0x5b0: 0x0a08, 0x5b1: 0x0c08, 0x5b2: 0x0c08, 0x5b3: 0x0a08, 0x5b4: 0x0a08, 0x5b5: 0x0a08, + 0x5b6: 0x0a08, 0x5b7: 0x0a08, 0x5b8: 0x0a08, 0x5b9: 0x0c08, 0x5ba: 0x0a08, 0x5bb: 0x0a08, + 0x5bc: 0x0a08, 0x5bd: 0x0a08, 0x5be: 0x0a08, 0x5bf: 0x0a08, + // Block 0x17, offset 0x5c0 + 0x5c0: 0x3008, 0x5c1: 0x3308, 0x5c2: 0x3308, 0x5c3: 0x3308, 0x5c4: 0x3308, 0x5c5: 0x3308, + 0x5c6: 0x3308, 0x5c7: 0x3308, 0x5c8: 0x3308, 0x5c9: 0x3008, 0x5ca: 0x3008, 0x5cb: 0x3008, + 0x5cc: 0x3008, 0x5cd: 0x3b08, 0x5ce: 0x3008, 0x5cf: 0x3008, 0x5d0: 0x0008, 0x5d1: 0x3308, + 0x5d2: 0x3308, 0x5d3: 0x3308, 0x5d4: 0x3308, 0x5d5: 0x3308, 0x5d6: 0x3308, 0x5d7: 0x3308, + 0x5d8: 0x0159, 0x5d9: 0x0161, 0x5da: 0x0169, 0x5db: 0x0171, 0x5dc: 0x0179, 0x5dd: 0x0181, + 0x5de: 0x0189, 0x5df: 0x0191, 0x5e0: 0x0008, 0x5e1: 0x0008, 0x5e2: 0x3308, 0x5e3: 0x3308, + 0x5e4: 0x0018, 0x5e5: 0x0018, 0x5e6: 0x0008, 0x5e7: 0x0008, 0x5e8: 0x0008, 0x5e9: 0x0008, + 0x5ea: 0x0008, 0x5eb: 0x0008, 0x5ec: 0x0008, 0x5ed: 0x0008, 0x5ee: 0x0008, 0x5ef: 0x0008, + 0x5f0: 0x0018, 0x5f1: 0x0008, 0x5f2: 0x0008, 0x5f3: 0x0008, 0x5f4: 0x0008, 0x5f5: 0x0008, + 0x5f6: 0x0008, 0x5f7: 0x0008, 0x5f8: 0x0008, 0x5f9: 0x0008, 0x5fa: 0x0008, 0x5fb: 0x0008, + 0x5fc: 0x0008, 0x5fd: 0x0008, 0x5fe: 0x0008, 0x5ff: 0x0008, + // Block 0x18, offset 0x600 + 0x600: 0x0008, 0x601: 0x3308, 0x602: 0x3008, 0x603: 0x3008, 0x604: 0x0040, 0x605: 0x0008, + 0x606: 0x0008, 0x607: 0x0008, 0x608: 0x0008, 0x609: 0x0008, 0x60a: 0x0008, 0x60b: 0x0008, + 0x60c: 0x0008, 0x60d: 0x0040, 0x60e: 0x0040, 0x60f: 0x0008, 0x610: 0x0008, 0x611: 0x0040, + 0x612: 0x0040, 0x613: 0x0008, 0x614: 0x0008, 0x615: 0x0008, 0x616: 0x0008, 0x617: 0x0008, + 0x618: 0x0008, 0x619: 0x0008, 0x61a: 0x0008, 0x61b: 0x0008, 0x61c: 0x0008, 0x61d: 0x0008, + 0x61e: 0x0008, 0x61f: 0x0008, 0x620: 0x0008, 0x621: 0x0008, 0x622: 0x0008, 0x623: 0x0008, + 0x624: 0x0008, 0x625: 0x0008, 0x626: 0x0008, 0x627: 0x0008, 0x628: 0x0008, 0x629: 0x0040, + 0x62a: 0x0008, 0x62b: 0x0008, 0x62c: 0x0008, 0x62d: 0x0008, 0x62e: 0x0008, 0x62f: 0x0008, + 0x630: 0x0008, 0x631: 0x0040, 0x632: 0x0008, 0x633: 0x0040, 0x634: 0x0040, 0x635: 0x0040, + 0x636: 0x0008, 0x637: 0x0008, 0x638: 0x0008, 0x639: 0x0008, 0x63a: 0x0040, 0x63b: 0x0040, + 0x63c: 0x3308, 0x63d: 0x0008, 0x63e: 0x3008, 0x63f: 0x3008, + // Block 0x19, offset 0x640 + 0x640: 0x3008, 0x641: 0x3308, 0x642: 0x3308, 0x643: 0x3308, 0x644: 0x3308, 0x645: 0x0040, + 0x646: 0x0040, 0x647: 0x3008, 0x648: 0x3008, 0x649: 0x0040, 0x64a: 0x0040, 0x64b: 0x3008, + 0x64c: 0x3008, 0x64d: 0x3b08, 0x64e: 0x0008, 0x64f: 0x0040, 0x650: 0x0040, 0x651: 0x0040, + 0x652: 0x0040, 0x653: 0x0040, 0x654: 0x0040, 0x655: 0x0040, 0x656: 0x0040, 0x657: 0x3008, + 0x658: 0x0040, 0x659: 0x0040, 0x65a: 0x0040, 0x65b: 0x0040, 0x65c: 0x0199, 0x65d: 0x01a1, + 0x65e: 0x0040, 0x65f: 0x01a9, 0x660: 0x0008, 0x661: 0x0008, 0x662: 0x3308, 0x663: 0x3308, + 0x664: 0x0040, 0x665: 0x0040, 0x666: 0x0008, 0x667: 0x0008, 0x668: 0x0008, 0x669: 0x0008, + 0x66a: 0x0008, 0x66b: 0x0008, 0x66c: 0x0008, 0x66d: 0x0008, 0x66e: 0x0008, 0x66f: 0x0008, + 0x670: 0x0008, 0x671: 0x0008, 0x672: 0x0018, 0x673: 0x0018, 0x674: 0x0018, 0x675: 0x0018, + 0x676: 0x0018, 0x677: 0x0018, 0x678: 0x0018, 0x679: 0x0018, 0x67a: 0x0018, 0x67b: 0x0018, + 0x67c: 0x0008, 0x67d: 0x0018, 0x67e: 0x3308, 0x67f: 0x0040, + // Block 0x1a, offset 0x680 + 0x680: 0x0040, 0x681: 0x3308, 0x682: 0x3308, 0x683: 0x3008, 0x684: 0x0040, 0x685: 0x0008, + 0x686: 0x0008, 0x687: 0x0008, 0x688: 0x0008, 0x689: 0x0008, 0x68a: 0x0008, 0x68b: 0x0040, + 0x68c: 0x0040, 0x68d: 0x0040, 0x68e: 0x0040, 0x68f: 0x0008, 0x690: 0x0008, 0x691: 0x0040, + 0x692: 0x0040, 0x693: 0x0008, 0x694: 0x0008, 0x695: 0x0008, 0x696: 0x0008, 0x697: 0x0008, + 0x698: 0x0008, 0x699: 0x0008, 0x69a: 0x0008, 0x69b: 0x0008, 0x69c: 0x0008, 0x69d: 0x0008, + 0x69e: 0x0008, 0x69f: 0x0008, 0x6a0: 0x0008, 0x6a1: 0x0008, 0x6a2: 0x0008, 0x6a3: 0x0008, + 0x6a4: 0x0008, 0x6a5: 0x0008, 0x6a6: 0x0008, 0x6a7: 0x0008, 0x6a8: 0x0008, 0x6a9: 0x0040, + 0x6aa: 0x0008, 0x6ab: 0x0008, 0x6ac: 0x0008, 0x6ad: 0x0008, 0x6ae: 0x0008, 0x6af: 0x0008, + 0x6b0: 0x0008, 0x6b1: 0x0040, 0x6b2: 0x0008, 0x6b3: 0x01b1, 0x6b4: 0x0040, 0x6b5: 0x0008, + 0x6b6: 0x01b9, 0x6b7: 0x0040, 0x6b8: 0x0008, 0x6b9: 0x0008, 0x6ba: 0x0040, 0x6bb: 0x0040, + 0x6bc: 0x3308, 0x6bd: 0x0040, 0x6be: 0x3008, 0x6bf: 0x3008, + // Block 0x1b, offset 0x6c0 + 0x6c0: 0x3008, 0x6c1: 0x3308, 0x6c2: 0x3308, 0x6c3: 0x0040, 0x6c4: 0x0040, 0x6c5: 0x0040, + 0x6c6: 0x0040, 0x6c7: 0x3308, 0x6c8: 0x3308, 0x6c9: 0x0040, 0x6ca: 0x0040, 0x6cb: 0x3308, + 0x6cc: 0x3308, 0x6cd: 0x3b08, 0x6ce: 0x0040, 0x6cf: 0x0040, 0x6d0: 0x0040, 0x6d1: 0x3308, + 0x6d2: 0x0040, 0x6d3: 0x0040, 0x6d4: 0x0040, 0x6d5: 0x0040, 0x6d6: 0x0040, 0x6d7: 0x0040, + 0x6d8: 0x0040, 0x6d9: 0x01c1, 0x6da: 0x01c9, 0x6db: 0x01d1, 0x6dc: 0x0008, 0x6dd: 0x0040, + 0x6de: 0x01d9, 0x6df: 0x0040, 0x6e0: 0x0040, 0x6e1: 0x0040, 0x6e2: 0x0040, 0x6e3: 0x0040, + 0x6e4: 0x0040, 0x6e5: 0x0040, 0x6e6: 0x0008, 0x6e7: 0x0008, 0x6e8: 0x0008, 0x6e9: 0x0008, + 0x6ea: 0x0008, 0x6eb: 0x0008, 0x6ec: 0x0008, 0x6ed: 0x0008, 0x6ee: 0x0008, 0x6ef: 0x0008, + 0x6f0: 0x3308, 0x6f1: 0x3308, 0x6f2: 0x0008, 0x6f3: 0x0008, 0x6f4: 0x0008, 0x6f5: 0x3308, + 0x6f6: 0x0018, 0x6f7: 0x0040, 0x6f8: 0x0040, 0x6f9: 0x0040, 0x6fa: 0x0040, 0x6fb: 0x0040, + 0x6fc: 0x0040, 0x6fd: 0x0040, 0x6fe: 0x0040, 0x6ff: 0x0040, + // Block 0x1c, offset 0x700 + 0x700: 0x0040, 0x701: 0x3308, 0x702: 0x3308, 0x703: 0x3008, 0x704: 0x0040, 0x705: 0x0008, + 0x706: 0x0008, 0x707: 0x0008, 0x708: 0x0008, 0x709: 0x0008, 0x70a: 0x0008, 0x70b: 0x0008, + 0x70c: 0x0008, 0x70d: 0x0008, 0x70e: 0x0040, 0x70f: 0x0008, 0x710: 0x0008, 0x711: 0x0008, + 0x712: 0x0040, 0x713: 0x0008, 0x714: 0x0008, 0x715: 0x0008, 0x716: 0x0008, 0x717: 0x0008, + 0x718: 0x0008, 0x719: 0x0008, 0x71a: 0x0008, 0x71b: 0x0008, 0x71c: 0x0008, 0x71d: 0x0008, + 0x71e: 0x0008, 0x71f: 0x0008, 0x720: 0x0008, 0x721: 0x0008, 0x722: 0x0008, 0x723: 0x0008, + 0x724: 0x0008, 0x725: 0x0008, 0x726: 0x0008, 0x727: 0x0008, 0x728: 0x0008, 0x729: 0x0040, + 0x72a: 0x0008, 0x72b: 0x0008, 0x72c: 0x0008, 0x72d: 0x0008, 0x72e: 0x0008, 0x72f: 0x0008, + 0x730: 0x0008, 0x731: 0x0040, 0x732: 0x0008, 0x733: 0x0008, 0x734: 0x0040, 0x735: 0x0008, + 0x736: 0x0008, 0x737: 0x0008, 0x738: 0x0008, 0x739: 0x0008, 0x73a: 0x0040, 0x73b: 0x0040, + 0x73c: 0x3308, 0x73d: 0x0008, 0x73e: 0x3008, 0x73f: 0x3008, + // Block 0x1d, offset 0x740 + 0x740: 0x3008, 0x741: 0x3308, 0x742: 0x3308, 0x743: 0x3308, 0x744: 0x3308, 0x745: 0x3308, + 0x746: 0x0040, 0x747: 0x3308, 0x748: 0x3308, 0x749: 0x3008, 0x74a: 0x0040, 0x74b: 0x3008, + 0x74c: 0x3008, 0x74d: 0x3b08, 0x74e: 0x0040, 0x74f: 0x0040, 0x750: 0x0008, 0x751: 0x0040, + 0x752: 0x0040, 0x753: 0x0040, 0x754: 0x0040, 0x755: 0x0040, 0x756: 0x0040, 0x757: 0x0040, + 0x758: 0x0040, 0x759: 0x0040, 0x75a: 0x0040, 0x75b: 0x0040, 0x75c: 0x0040, 0x75d: 0x0040, + 0x75e: 0x0040, 0x75f: 0x0040, 0x760: 0x0008, 0x761: 0x0008, 0x762: 0x3308, 0x763: 0x3308, + 0x764: 0x0040, 0x765: 0x0040, 0x766: 0x0008, 0x767: 0x0008, 0x768: 0x0008, 0x769: 0x0008, + 0x76a: 0x0008, 0x76b: 0x0008, 0x76c: 0x0008, 0x76d: 0x0008, 0x76e: 0x0008, 0x76f: 0x0008, + 0x770: 0x0018, 0x771: 0x0018, 0x772: 0x0040, 0x773: 0x0040, 0x774: 0x0040, 0x775: 0x0040, + 0x776: 0x0040, 0x777: 0x0040, 0x778: 0x0040, 0x779: 0x0008, 0x77a: 0x3308, 0x77b: 0x3308, + 0x77c: 0x3308, 0x77d: 0x3308, 0x77e: 0x3308, 0x77f: 0x3308, + // Block 0x1e, offset 0x780 + 0x780: 0x0040, 0x781: 0x3308, 0x782: 0x3008, 0x783: 0x3008, 0x784: 0x0040, 0x785: 0x0008, + 0x786: 0x0008, 0x787: 0x0008, 0x788: 0x0008, 0x789: 0x0008, 0x78a: 0x0008, 0x78b: 0x0008, + 0x78c: 0x0008, 0x78d: 0x0040, 0x78e: 0x0040, 0x78f: 0x0008, 0x790: 0x0008, 0x791: 0x0040, + 0x792: 0x0040, 0x793: 0x0008, 0x794: 0x0008, 0x795: 0x0008, 0x796: 0x0008, 0x797: 0x0008, + 0x798: 0x0008, 0x799: 0x0008, 0x79a: 0x0008, 0x79b: 0x0008, 0x79c: 0x0008, 0x79d: 0x0008, + 0x79e: 0x0008, 0x79f: 0x0008, 0x7a0: 0x0008, 0x7a1: 0x0008, 0x7a2: 0x0008, 0x7a3: 0x0008, + 0x7a4: 0x0008, 0x7a5: 0x0008, 0x7a6: 0x0008, 0x7a7: 0x0008, 0x7a8: 0x0008, 0x7a9: 0x0040, + 0x7aa: 0x0008, 0x7ab: 0x0008, 0x7ac: 0x0008, 0x7ad: 0x0008, 0x7ae: 0x0008, 0x7af: 0x0008, + 0x7b0: 0x0008, 0x7b1: 0x0040, 0x7b2: 0x0008, 0x7b3: 0x0008, 0x7b4: 0x0040, 0x7b5: 0x0008, + 0x7b6: 0x0008, 0x7b7: 0x0008, 0x7b8: 0x0008, 0x7b9: 0x0008, 0x7ba: 0x0040, 0x7bb: 0x0040, + 0x7bc: 0x3308, 0x7bd: 0x0008, 0x7be: 0x3008, 0x7bf: 0x3308, + // Block 0x1f, offset 0x7c0 + 0x7c0: 0x3008, 0x7c1: 0x3308, 0x7c2: 0x3308, 0x7c3: 0x3308, 0x7c4: 0x3308, 0x7c5: 0x0040, + 0x7c6: 0x0040, 0x7c7: 0x3008, 0x7c8: 0x3008, 0x7c9: 0x0040, 0x7ca: 0x0040, 0x7cb: 0x3008, + 0x7cc: 0x3008, 0x7cd: 0x3b08, 0x7ce: 0x0040, 0x7cf: 0x0040, 0x7d0: 0x0040, 0x7d1: 0x0040, + 0x7d2: 0x0040, 0x7d3: 0x0040, 0x7d4: 0x0040, 0x7d5: 0x3308, 0x7d6: 0x3308, 0x7d7: 0x3008, + 0x7d8: 0x0040, 0x7d9: 0x0040, 0x7da: 0x0040, 0x7db: 0x0040, 0x7dc: 0x01e1, 0x7dd: 0x01e9, + 0x7de: 0x0040, 0x7df: 0x0008, 0x7e0: 0x0008, 0x7e1: 0x0008, 0x7e2: 0x3308, 0x7e3: 0x3308, + 0x7e4: 0x0040, 0x7e5: 0x0040, 0x7e6: 0x0008, 0x7e7: 0x0008, 0x7e8: 0x0008, 0x7e9: 0x0008, + 0x7ea: 0x0008, 0x7eb: 0x0008, 0x7ec: 0x0008, 0x7ed: 0x0008, 0x7ee: 0x0008, 0x7ef: 0x0008, + 0x7f0: 0x0018, 0x7f1: 0x0008, 0x7f2: 0x0018, 0x7f3: 0x0018, 0x7f4: 0x0018, 0x7f5: 0x0018, + 0x7f6: 0x0018, 0x7f7: 0x0018, 0x7f8: 0x0040, 0x7f9: 0x0040, 0x7fa: 0x0040, 0x7fb: 0x0040, + 0x7fc: 0x0040, 0x7fd: 0x0040, 0x7fe: 0x0040, 0x7ff: 0x0040, + // Block 0x20, offset 0x800 + 0x800: 0x0040, 0x801: 0x0040, 0x802: 0x3308, 0x803: 0x0008, 0x804: 0x0040, 0x805: 0x0008, + 0x806: 0x0008, 0x807: 0x0008, 0x808: 0x0008, 0x809: 0x0008, 0x80a: 0x0008, 0x80b: 0x0040, + 0x80c: 0x0040, 0x80d: 0x0040, 0x80e: 0x0008, 0x80f: 0x0008, 0x810: 0x0008, 0x811: 0x0040, + 0x812: 0x0008, 0x813: 0x0008, 0x814: 0x0008, 0x815: 0x0008, 0x816: 0x0040, 0x817: 0x0040, + 0x818: 0x0040, 0x819: 0x0008, 0x81a: 0x0008, 0x81b: 0x0040, 0x81c: 0x0008, 0x81d: 0x0040, + 0x81e: 0x0008, 0x81f: 0x0008, 0x820: 0x0040, 0x821: 0x0040, 0x822: 0x0040, 0x823: 0x0008, + 0x824: 0x0008, 0x825: 0x0040, 0x826: 0x0040, 0x827: 0x0040, 0x828: 0x0008, 0x829: 0x0008, + 0x82a: 0x0008, 0x82b: 0x0040, 0x82c: 0x0040, 0x82d: 0x0040, 0x82e: 0x0008, 0x82f: 0x0008, + 0x830: 0x0008, 0x831: 0x0008, 0x832: 0x0008, 0x833: 0x0008, 0x834: 0x0008, 0x835: 0x0008, + 0x836: 0x0008, 0x837: 0x0008, 0x838: 0x0008, 0x839: 0x0008, 0x83a: 0x0040, 0x83b: 0x0040, + 0x83c: 0x0040, 0x83d: 0x0040, 0x83e: 0x3008, 0x83f: 0x3008, + // Block 0x21, offset 0x840 + 0x840: 0x3308, 0x841: 0x3008, 0x842: 0x3008, 0x843: 0x3008, 0x844: 0x3008, 0x845: 0x0040, + 0x846: 0x3308, 0x847: 0x3308, 0x848: 0x3308, 0x849: 0x0040, 0x84a: 0x3308, 0x84b: 0x3308, + 0x84c: 0x3308, 0x84d: 0x3b08, 0x84e: 0x0040, 0x84f: 0x0040, 0x850: 0x0040, 0x851: 0x0040, + 0x852: 0x0040, 0x853: 0x0040, 0x854: 0x0040, 0x855: 0x3308, 0x856: 0x3308, 0x857: 0x0040, + 0x858: 0x0008, 0x859: 0x0008, 0x85a: 0x0008, 0x85b: 0x0040, 0x85c: 0x0040, 0x85d: 0x0008, + 0x85e: 0x0040, 0x85f: 0x0040, 0x860: 0x0008, 0x861: 0x0008, 0x862: 0x3308, 0x863: 0x3308, + 0x864: 0x0040, 0x865: 0x0040, 0x866: 0x0008, 0x867: 0x0008, 0x868: 0x0008, 0x869: 0x0008, + 0x86a: 0x0008, 0x86b: 0x0008, 0x86c: 0x0008, 0x86d: 0x0008, 0x86e: 0x0008, 0x86f: 0x0008, + 0x870: 0x0040, 0x871: 0x0040, 0x872: 0x0040, 0x873: 0x0040, 0x874: 0x0040, 0x875: 0x0040, + 0x876: 0x0040, 0x877: 0x0018, 0x878: 0x0018, 0x879: 0x0018, 0x87a: 0x0018, 0x87b: 0x0018, + 0x87c: 0x0018, 0x87d: 0x0018, 0x87e: 0x0018, 0x87f: 0x0018, + // Block 0x22, offset 0x880 + 0x880: 0x0008, 0x881: 0x3308, 0x882: 0x3008, 0x883: 0x3008, 0x884: 0x0018, 0x885: 0x0008, + 0x886: 0x0008, 0x887: 0x0008, 0x888: 0x0008, 0x889: 0x0008, 0x88a: 0x0008, 0x88b: 0x0008, + 0x88c: 0x0008, 0x88d: 0x0040, 0x88e: 0x0008, 0x88f: 0x0008, 0x890: 0x0008, 0x891: 0x0040, + 0x892: 0x0008, 0x893: 0x0008, 0x894: 0x0008, 0x895: 0x0008, 0x896: 0x0008, 0x897: 0x0008, + 0x898: 0x0008, 0x899: 0x0008, 0x89a: 0x0008, 0x89b: 0x0008, 0x89c: 0x0008, 0x89d: 0x0008, + 0x89e: 0x0008, 0x89f: 0x0008, 0x8a0: 0x0008, 0x8a1: 0x0008, 0x8a2: 0x0008, 0x8a3: 0x0008, + 0x8a4: 0x0008, 0x8a5: 0x0008, 0x8a6: 0x0008, 0x8a7: 0x0008, 0x8a8: 0x0008, 0x8a9: 0x0040, + 0x8aa: 0x0008, 0x8ab: 0x0008, 0x8ac: 0x0008, 0x8ad: 0x0008, 0x8ae: 0x0008, 0x8af: 0x0008, + 0x8b0: 0x0008, 0x8b1: 0x0008, 0x8b2: 0x0008, 0x8b3: 0x0008, 0x8b4: 0x0040, 0x8b5: 0x0008, + 0x8b6: 0x0008, 0x8b7: 0x0008, 0x8b8: 0x0008, 0x8b9: 0x0008, 0x8ba: 0x0040, 0x8bb: 0x0040, + 0x8bc: 0x3308, 0x8bd: 0x0008, 0x8be: 0x3008, 0x8bf: 0x3308, + // Block 0x23, offset 0x8c0 + 0x8c0: 0x3008, 0x8c1: 0x3008, 0x8c2: 0x3008, 0x8c3: 0x3008, 0x8c4: 0x3008, 0x8c5: 0x0040, + 0x8c6: 0x3308, 0x8c7: 0x3008, 0x8c8: 0x3008, 0x8c9: 0x0040, 0x8ca: 0x3008, 0x8cb: 0x3008, + 0x8cc: 0x3308, 0x8cd: 0x3b08, 0x8ce: 0x0040, 0x8cf: 0x0040, 0x8d0: 0x0040, 0x8d1: 0x0040, + 0x8d2: 0x0040, 0x8d3: 0x0040, 0x8d4: 0x0040, 0x8d5: 0x3008, 0x8d6: 0x3008, 0x8d7: 0x0040, + 0x8d8: 0x0040, 0x8d9: 0x0040, 0x8da: 0x0040, 0x8db: 0x0040, 0x8dc: 0x0040, 0x8dd: 0x0008, + 0x8de: 0x0008, 0x8df: 0x0040, 0x8e0: 0x0008, 0x8e1: 0x0008, 0x8e2: 0x3308, 0x8e3: 0x3308, + 0x8e4: 0x0040, 0x8e5: 0x0040, 0x8e6: 0x0008, 0x8e7: 0x0008, 0x8e8: 0x0008, 0x8e9: 0x0008, + 0x8ea: 0x0008, 0x8eb: 0x0008, 0x8ec: 0x0008, 0x8ed: 0x0008, 0x8ee: 0x0008, 0x8ef: 0x0008, + 0x8f0: 0x0040, 0x8f1: 0x0008, 0x8f2: 0x0008, 0x8f3: 0x3008, 0x8f4: 0x0040, 0x8f5: 0x0040, + 0x8f6: 0x0040, 0x8f7: 0x0040, 0x8f8: 0x0040, 0x8f9: 0x0040, 0x8fa: 0x0040, 0x8fb: 0x0040, + 0x8fc: 0x0040, 0x8fd: 0x0040, 0x8fe: 0x0040, 0x8ff: 0x0040, + // Block 0x24, offset 0x900 + 0x900: 0x3008, 0x901: 0x3308, 0x902: 0x3308, 0x903: 0x3308, 0x904: 0x3308, 0x905: 0x0040, + 0x906: 0x3008, 0x907: 0x3008, 0x908: 0x3008, 0x909: 0x0040, 0x90a: 0x3008, 0x90b: 0x3008, + 0x90c: 0x3008, 0x90d: 0x3b08, 0x90e: 0x0008, 0x90f: 0x0018, 0x910: 0x0040, 0x911: 0x0040, + 0x912: 0x0040, 0x913: 0x0040, 0x914: 0x0008, 0x915: 0x0008, 0x916: 0x0008, 0x917: 0x3008, + 0x918: 0x0018, 0x919: 0x0018, 0x91a: 0x0018, 0x91b: 0x0018, 0x91c: 0x0018, 0x91d: 0x0018, + 0x91e: 0x0018, 0x91f: 0x0008, 0x920: 0x0008, 0x921: 0x0008, 0x922: 0x3308, 0x923: 0x3308, + 0x924: 0x0040, 0x925: 0x0040, 0x926: 0x0008, 0x927: 0x0008, 0x928: 0x0008, 0x929: 0x0008, + 0x92a: 0x0008, 0x92b: 0x0008, 0x92c: 0x0008, 0x92d: 0x0008, 0x92e: 0x0008, 0x92f: 0x0008, + 0x930: 0x0018, 0x931: 0x0018, 0x932: 0x0018, 0x933: 0x0018, 0x934: 0x0018, 0x935: 0x0018, + 0x936: 0x0018, 0x937: 0x0018, 0x938: 0x0018, 0x939: 0x0018, 0x93a: 0x0008, 0x93b: 0x0008, + 0x93c: 0x0008, 0x93d: 0x0008, 0x93e: 0x0008, 0x93f: 0x0008, + // Block 0x25, offset 0x940 + 0x940: 0x0040, 0x941: 0x0008, 0x942: 0x0008, 0x943: 0x0040, 0x944: 0x0008, 0x945: 0x0040, + 0x946: 0x0008, 0x947: 0x0008, 0x948: 0x0008, 0x949: 0x0008, 0x94a: 0x0008, 0x94b: 0x0040, + 0x94c: 0x0008, 0x94d: 0x0008, 0x94e: 0x0008, 0x94f: 0x0008, 0x950: 0x0008, 0x951: 0x0008, + 0x952: 0x0008, 0x953: 0x0008, 0x954: 0x0008, 0x955: 0x0008, 0x956: 0x0008, 0x957: 0x0008, + 0x958: 0x0008, 0x959: 0x0008, 0x95a: 0x0008, 0x95b: 0x0008, 0x95c: 0x0008, 0x95d: 0x0008, + 0x95e: 0x0008, 0x95f: 0x0008, 0x960: 0x0008, 0x961: 0x0008, 0x962: 0x0008, 0x963: 0x0008, + 0x964: 0x0040, 0x965: 0x0008, 0x966: 0x0040, 0x967: 0x0008, 0x968: 0x0008, 0x969: 0x0008, + 0x96a: 0x0008, 0x96b: 0x0008, 0x96c: 0x0008, 0x96d: 0x0008, 0x96e: 0x0008, 0x96f: 0x0008, + 0x970: 0x0008, 0x971: 0x3308, 0x972: 0x0008, 0x973: 0x01f9, 0x974: 0x3308, 0x975: 0x3308, + 0x976: 0x3308, 0x977: 0x3308, 0x978: 0x3308, 0x979: 0x3308, 0x97a: 0x3b08, 0x97b: 0x3308, + 0x97c: 0x3308, 0x97d: 0x0008, 0x97e: 0x0040, 0x97f: 0x0040, + // Block 0x26, offset 0x980 + 0x980: 0x0008, 0x981: 0x0008, 0x982: 0x0008, 0x983: 0x0211, 0x984: 0x0008, 0x985: 0x0008, + 0x986: 0x0008, 0x987: 0x0008, 0x988: 0x0040, 0x989: 0x0008, 0x98a: 0x0008, 0x98b: 0x0008, + 0x98c: 0x0008, 0x98d: 0x0219, 0x98e: 0x0008, 0x98f: 0x0008, 0x990: 0x0008, 0x991: 0x0008, + 0x992: 0x0221, 0x993: 0x0008, 0x994: 0x0008, 0x995: 0x0008, 0x996: 0x0008, 0x997: 0x0229, + 0x998: 0x0008, 0x999: 0x0008, 0x99a: 0x0008, 0x99b: 0x0008, 0x99c: 0x0231, 0x99d: 0x0008, + 0x99e: 0x0008, 0x99f: 0x0008, 0x9a0: 0x0008, 0x9a1: 0x0008, 0x9a2: 0x0008, 0x9a3: 0x0008, + 0x9a4: 0x0008, 0x9a5: 0x0008, 0x9a6: 0x0008, 0x9a7: 0x0008, 0x9a8: 0x0008, 0x9a9: 0x0239, + 0x9aa: 0x0008, 0x9ab: 0x0008, 0x9ac: 0x0008, 0x9ad: 0x0040, 0x9ae: 0x0040, 0x9af: 0x0040, + 0x9b0: 0x0040, 0x9b1: 0x3308, 0x9b2: 0x3308, 0x9b3: 0x0241, 0x9b4: 0x3308, 0x9b5: 0x0249, + 0x9b6: 0x0251, 0x9b7: 0x0259, 0x9b8: 0x0261, 0x9b9: 0x0269, 0x9ba: 0x3308, 0x9bb: 0x3308, + 0x9bc: 0x3308, 0x9bd: 0x3308, 0x9be: 0x3308, 0x9bf: 0x3008, + // Block 0x27, offset 0x9c0 + 0x9c0: 0x3308, 0x9c1: 0x0271, 0x9c2: 0x3308, 0x9c3: 0x3308, 0x9c4: 0x3b08, 0x9c5: 0x0018, + 0x9c6: 0x3308, 0x9c7: 0x3308, 0x9c8: 0x0008, 0x9c9: 0x0008, 0x9ca: 0x0008, 0x9cb: 0x0008, + 0x9cc: 0x0008, 0x9cd: 0x3308, 0x9ce: 0x3308, 0x9cf: 0x3308, 0x9d0: 0x3308, 0x9d1: 0x3308, + 0x9d2: 0x3308, 0x9d3: 0x0279, 0x9d4: 0x3308, 0x9d5: 0x3308, 0x9d6: 0x3308, 0x9d7: 0x3308, + 0x9d8: 0x0040, 0x9d9: 0x3308, 0x9da: 0x3308, 0x9db: 0x3308, 0x9dc: 0x3308, 0x9dd: 0x0281, + 0x9de: 0x3308, 0x9df: 0x3308, 0x9e0: 0x3308, 0x9e1: 0x3308, 0x9e2: 0x0289, 0x9e3: 0x3308, + 0x9e4: 0x3308, 0x9e5: 0x3308, 0x9e6: 0x3308, 0x9e7: 0x0291, 0x9e8: 0x3308, 0x9e9: 0x3308, + 0x9ea: 0x3308, 0x9eb: 0x3308, 0x9ec: 0x0299, 0x9ed: 0x3308, 0x9ee: 0x3308, 0x9ef: 0x3308, + 0x9f0: 0x3308, 0x9f1: 0x3308, 0x9f2: 0x3308, 0x9f3: 0x3308, 0x9f4: 0x3308, 0x9f5: 0x3308, + 0x9f6: 0x3308, 0x9f7: 0x3308, 0x9f8: 0x3308, 0x9f9: 0x02a1, 0x9fa: 0x3308, 0x9fb: 0x3308, + 0x9fc: 0x3308, 0x9fd: 0x0040, 0x9fe: 0x0018, 0x9ff: 0x0018, + // Block 0x28, offset 0xa00 + 0xa00: 0x0008, 0xa01: 0x0008, 0xa02: 0x0008, 0xa03: 0x0008, 0xa04: 0x0008, 0xa05: 0x0008, + 0xa06: 0x0008, 0xa07: 0x0008, 0xa08: 0x0008, 0xa09: 0x0008, 0xa0a: 0x0008, 0xa0b: 0x0008, + 0xa0c: 0x0008, 0xa0d: 0x0008, 0xa0e: 0x0008, 0xa0f: 0x0008, 0xa10: 0x0008, 0xa11: 0x0008, + 0xa12: 0x0008, 0xa13: 0x0008, 0xa14: 0x0008, 0xa15: 0x0008, 0xa16: 0x0008, 0xa17: 0x0008, + 0xa18: 0x0008, 0xa19: 0x0008, 0xa1a: 0x0008, 0xa1b: 0x0008, 0xa1c: 0x0008, 0xa1d: 0x0008, + 0xa1e: 0x0008, 0xa1f: 0x0008, 0xa20: 0x0008, 0xa21: 0x0008, 0xa22: 0x0008, 0xa23: 0x0008, + 0xa24: 0x0008, 0xa25: 0x0008, 0xa26: 0x0008, 0xa27: 0x0008, 0xa28: 0x0008, 0xa29: 0x0008, + 0xa2a: 0x0008, 0xa2b: 0x0008, 0xa2c: 0x0019, 0xa2d: 0x02e1, 0xa2e: 0x02e9, 0xa2f: 0x0008, + 0xa30: 0x02f1, 0xa31: 0x02f9, 0xa32: 0x0301, 0xa33: 0x0309, 0xa34: 0x00a9, 0xa35: 0x0311, + 0xa36: 0x00b1, 0xa37: 0x0319, 0xa38: 0x0101, 0xa39: 0x0321, 0xa3a: 0x0329, 0xa3b: 0x0008, + 0xa3c: 0x0051, 0xa3d: 0x0331, 0xa3e: 0x0339, 0xa3f: 0x00b9, + // Block 0x29, offset 0xa40 + 0xa40: 0x0341, 0xa41: 0x0349, 0xa42: 0x00c1, 0xa43: 0x0019, 0xa44: 0x0351, 0xa45: 0x0359, + 0xa46: 0x05b5, 0xa47: 0x02e9, 0xa48: 0x02f1, 0xa49: 0x02f9, 0xa4a: 0x0361, 0xa4b: 0x0369, + 0xa4c: 0x0371, 0xa4d: 0x0309, 0xa4e: 0x0008, 0xa4f: 0x0319, 0xa50: 0x0321, 0xa51: 0x0379, + 0xa52: 0x0051, 0xa53: 0x0381, 0xa54: 0x05cd, 0xa55: 0x05cd, 0xa56: 0x0339, 0xa57: 0x0341, + 0xa58: 0x0349, 0xa59: 0x05b5, 0xa5a: 0x0389, 0xa5b: 0x0391, 0xa5c: 0x05e5, 0xa5d: 0x0399, + 0xa5e: 0x03a1, 0xa5f: 0x03a9, 0xa60: 0x03b1, 0xa61: 0x03b9, 0xa62: 0x0311, 0xa63: 0x00b9, + 0xa64: 0x0349, 0xa65: 0x0391, 0xa66: 0x0399, 0xa67: 0x03a1, 0xa68: 0x03c1, 0xa69: 0x03b1, + 0xa6a: 0x03b9, 0xa6b: 0x0008, 0xa6c: 0x0008, 0xa6d: 0x0008, 0xa6e: 0x0008, 0xa6f: 0x0008, + 0xa70: 0x0008, 0xa71: 0x0008, 0xa72: 0x0008, 0xa73: 0x0008, 0xa74: 0x0008, 0xa75: 0x0008, + 0xa76: 0x0008, 0xa77: 0x0008, 0xa78: 0x03c9, 0xa79: 0x0008, 0xa7a: 0x0008, 0xa7b: 0x0008, + 0xa7c: 0x0008, 0xa7d: 0x0008, 0xa7e: 0x0008, 0xa7f: 0x0008, + // Block 0x2a, offset 0xa80 + 0xa80: 0x0008, 0xa81: 0x0008, 0xa82: 0x0008, 0xa83: 0x0008, 0xa84: 0x0008, 0xa85: 0x0008, + 0xa86: 0x0008, 0xa87: 0x0008, 0xa88: 0x0008, 0xa89: 0x0008, 0xa8a: 0x0008, 0xa8b: 0x0008, + 0xa8c: 0x0008, 0xa8d: 0x0008, 0xa8e: 0x0008, 0xa8f: 0x0008, 0xa90: 0x0008, 0xa91: 0x0008, + 0xa92: 0x0008, 0xa93: 0x0008, 0xa94: 0x0008, 0xa95: 0x0008, 0xa96: 0x0008, 0xa97: 0x0008, + 0xa98: 0x0008, 0xa99: 0x0008, 0xa9a: 0x0008, 0xa9b: 0x03d1, 0xa9c: 0x03d9, 0xa9d: 0x03e1, + 0xa9e: 0x03e9, 0xa9f: 0x0371, 0xaa0: 0x03f1, 0xaa1: 0x03f9, 0xaa2: 0x0401, 0xaa3: 0x0409, + 0xaa4: 0x0411, 0xaa5: 0x0419, 0xaa6: 0x0421, 0xaa7: 0x05fd, 0xaa8: 0x0429, 0xaa9: 0x0431, + 0xaaa: 0xe17d, 0xaab: 0x0439, 0xaac: 0x0441, 0xaad: 0x0449, 0xaae: 0x0451, 0xaaf: 0x0459, + 0xab0: 0x0461, 0xab1: 0x0469, 0xab2: 0x0471, 0xab3: 0x0479, 0xab4: 0x0481, 0xab5: 0x0489, + 0xab6: 0x0491, 0xab7: 0x0499, 0xab8: 0x0615, 0xab9: 0x04a1, 0xaba: 0x04a9, 0xabb: 0x04b1, + 0xabc: 0x04b9, 0xabd: 0x04c1, 0xabe: 0x04c9, 0xabf: 0x04d1, + // Block 0x2b, offset 0xac0 + 0xac0: 0xe00d, 0xac1: 0x0008, 0xac2: 0xe00d, 0xac3: 0x0008, 0xac4: 0xe00d, 0xac5: 0x0008, + 0xac6: 0xe00d, 0xac7: 0x0008, 0xac8: 0xe00d, 0xac9: 0x0008, 0xaca: 0xe00d, 0xacb: 0x0008, + 0xacc: 0xe00d, 0xacd: 0x0008, 0xace: 0xe00d, 0xacf: 0x0008, 0xad0: 0xe00d, 0xad1: 0x0008, + 0xad2: 0xe00d, 0xad3: 0x0008, 0xad4: 0xe00d, 0xad5: 0x0008, 0xad6: 0xe00d, 0xad7: 0x0008, + 0xad8: 0xe00d, 0xad9: 0x0008, 0xada: 0xe00d, 0xadb: 0x0008, 0xadc: 0xe00d, 0xadd: 0x0008, + 0xade: 0xe00d, 0xadf: 0x0008, 0xae0: 0xe00d, 0xae1: 0x0008, 0xae2: 0xe00d, 0xae3: 0x0008, + 0xae4: 0xe00d, 0xae5: 0x0008, 0xae6: 0xe00d, 0xae7: 0x0008, 0xae8: 0xe00d, 0xae9: 0x0008, + 0xaea: 0xe00d, 0xaeb: 0x0008, 0xaec: 0xe00d, 0xaed: 0x0008, 0xaee: 0xe00d, 0xaef: 0x0008, + 0xaf0: 0xe00d, 0xaf1: 0x0008, 0xaf2: 0xe00d, 0xaf3: 0x0008, 0xaf4: 0xe00d, 0xaf5: 0x0008, + 0xaf6: 0xe00d, 0xaf7: 0x0008, 0xaf8: 0xe00d, 0xaf9: 0x0008, 0xafa: 0xe00d, 0xafb: 0x0008, + 0xafc: 0xe00d, 0xafd: 0x0008, 0xafe: 0xe00d, 0xaff: 0x0008, + // Block 0x2c, offset 0xb00 + 0xb00: 0xe00d, 0xb01: 0x0008, 0xb02: 0xe00d, 0xb03: 0x0008, 0xb04: 0xe00d, 0xb05: 0x0008, + 0xb06: 0xe00d, 0xb07: 0x0008, 0xb08: 0xe00d, 0xb09: 0x0008, 0xb0a: 0xe00d, 0xb0b: 0x0008, + 0xb0c: 0xe00d, 0xb0d: 0x0008, 0xb0e: 0xe00d, 0xb0f: 0x0008, 0xb10: 0xe00d, 0xb11: 0x0008, + 0xb12: 0xe00d, 0xb13: 0x0008, 0xb14: 0xe00d, 0xb15: 0x0008, 0xb16: 0x0008, 0xb17: 0x0008, + 0xb18: 0x0008, 0xb19: 0x0008, 0xb1a: 0x062d, 0xb1b: 0x064d, 0xb1c: 0x0008, 0xb1d: 0x0008, + 0xb1e: 0x04d9, 0xb1f: 0x0008, 0xb20: 0xe00d, 0xb21: 0x0008, 0xb22: 0xe00d, 0xb23: 0x0008, + 0xb24: 0xe00d, 0xb25: 0x0008, 0xb26: 0xe00d, 0xb27: 0x0008, 0xb28: 0xe00d, 0xb29: 0x0008, + 0xb2a: 0xe00d, 0xb2b: 0x0008, 0xb2c: 0xe00d, 0xb2d: 0x0008, 0xb2e: 0xe00d, 0xb2f: 0x0008, + 0xb30: 0xe00d, 0xb31: 0x0008, 0xb32: 0xe00d, 0xb33: 0x0008, 0xb34: 0xe00d, 0xb35: 0x0008, + 0xb36: 0xe00d, 0xb37: 0x0008, 0xb38: 0xe00d, 0xb39: 0x0008, 0xb3a: 0xe00d, 0xb3b: 0x0008, + 0xb3c: 0xe00d, 0xb3d: 0x0008, 0xb3e: 0xe00d, 0xb3f: 0x0008, + // Block 0x2d, offset 0xb40 + 0xb40: 0x0008, 0xb41: 0x0008, 0xb42: 0x0008, 0xb43: 0x0008, 0xb44: 0x0008, 0xb45: 0x0008, + 0xb46: 0x0040, 0xb47: 0x0040, 0xb48: 0xe045, 0xb49: 0xe045, 0xb4a: 0xe045, 0xb4b: 0xe045, + 0xb4c: 0xe045, 0xb4d: 0xe045, 0xb4e: 0x0040, 0xb4f: 0x0040, 0xb50: 0x0008, 0xb51: 0x0008, + 0xb52: 0x0008, 0xb53: 0x0008, 0xb54: 0x0008, 0xb55: 0x0008, 0xb56: 0x0008, 0xb57: 0x0008, + 0xb58: 0x0040, 0xb59: 0xe045, 0xb5a: 0x0040, 0xb5b: 0xe045, 0xb5c: 0x0040, 0xb5d: 0xe045, + 0xb5e: 0x0040, 0xb5f: 0xe045, 0xb60: 0x0008, 0xb61: 0x0008, 0xb62: 0x0008, 0xb63: 0x0008, + 0xb64: 0x0008, 0xb65: 0x0008, 0xb66: 0x0008, 0xb67: 0x0008, 0xb68: 0xe045, 0xb69: 0xe045, + 0xb6a: 0xe045, 0xb6b: 0xe045, 0xb6c: 0xe045, 0xb6d: 0xe045, 0xb6e: 0xe045, 0xb6f: 0xe045, + 0xb70: 0x0008, 0xb71: 0x04e1, 0xb72: 0x0008, 0xb73: 0x04e9, 0xb74: 0x0008, 0xb75: 0x04f1, + 0xb76: 0x0008, 0xb77: 0x04f9, 0xb78: 0x0008, 0xb79: 0x0501, 0xb7a: 0x0008, 0xb7b: 0x0509, + 0xb7c: 0x0008, 0xb7d: 0x0511, 0xb7e: 0x0040, 0xb7f: 0x0040, + // Block 0x2e, offset 0xb80 + 0xb80: 0x0519, 0xb81: 0x0521, 0xb82: 0x0529, 0xb83: 0x0531, 0xb84: 0x0539, 0xb85: 0x0541, + 0xb86: 0x0549, 0xb87: 0x0551, 0xb88: 0x0519, 0xb89: 0x0521, 0xb8a: 0x0529, 0xb8b: 0x0531, + 0xb8c: 0x0539, 0xb8d: 0x0541, 0xb8e: 0x0549, 0xb8f: 0x0551, 0xb90: 0x0559, 0xb91: 0x0561, + 0xb92: 0x0569, 0xb93: 0x0571, 0xb94: 0x0579, 0xb95: 0x0581, 0xb96: 0x0589, 0xb97: 0x0591, + 0xb98: 0x0559, 0xb99: 0x0561, 0xb9a: 0x0569, 0xb9b: 0x0571, 0xb9c: 0x0579, 0xb9d: 0x0581, + 0xb9e: 0x0589, 0xb9f: 0x0591, 0xba0: 0x0599, 0xba1: 0x05a1, 0xba2: 0x05a9, 0xba3: 0x05b1, + 0xba4: 0x05b9, 0xba5: 0x05c1, 0xba6: 0x05c9, 0xba7: 0x05d1, 0xba8: 0x0599, 0xba9: 0x05a1, + 0xbaa: 0x05a9, 0xbab: 0x05b1, 0xbac: 0x05b9, 0xbad: 0x05c1, 0xbae: 0x05c9, 0xbaf: 0x05d1, + 0xbb0: 0x0008, 0xbb1: 0x0008, 0xbb2: 0x05d9, 0xbb3: 0x05e1, 0xbb4: 0x05e9, 0xbb5: 0x0040, + 0xbb6: 0x0008, 0xbb7: 0x05f1, 0xbb8: 0xe045, 0xbb9: 0xe045, 0xbba: 0x0665, 0xbbb: 0x04e1, + 0xbbc: 0x05e1, 0xbbd: 0x067e, 0xbbe: 0x05f9, 0xbbf: 0x069e, + // Block 0x2f, offset 0xbc0 + 0xbc0: 0x06be, 0xbc1: 0x0602, 0xbc2: 0x0609, 0xbc3: 0x0611, 0xbc4: 0x0619, 0xbc5: 0x0040, + 0xbc6: 0x0008, 0xbc7: 0x0621, 0xbc8: 0x06dd, 0xbc9: 0x04e9, 0xbca: 0x06f5, 0xbcb: 0x04f1, + 0xbcc: 0x0611, 0xbcd: 0x062a, 0xbce: 0x0632, 0xbcf: 0x063a, 0xbd0: 0x0008, 0xbd1: 0x0008, + 0xbd2: 0x0008, 0xbd3: 0x0641, 0xbd4: 0x0040, 0xbd5: 0x0040, 0xbd6: 0x0008, 0xbd7: 0x0008, + 0xbd8: 0xe045, 0xbd9: 0xe045, 0xbda: 0x070d, 0xbdb: 0x04f9, 0xbdc: 0x0040, 0xbdd: 0x064a, + 0xbde: 0x0652, 0xbdf: 0x065a, 0xbe0: 0x0008, 0xbe1: 0x0008, 0xbe2: 0x0008, 0xbe3: 0x0661, + 0xbe4: 0x0008, 0xbe5: 0x0008, 0xbe6: 0x0008, 0xbe7: 0x0008, 0xbe8: 0xe045, 0xbe9: 0xe045, + 0xbea: 0x0725, 0xbeb: 0x0509, 0xbec: 0xe04d, 0xbed: 0x066a, 0xbee: 0x012a, 0xbef: 0x0672, + 0xbf0: 0x0040, 0xbf1: 0x0040, 0xbf2: 0x0679, 0xbf3: 0x0681, 0xbf4: 0x0689, 0xbf5: 0x0040, + 0xbf6: 0x0008, 0xbf7: 0x0691, 0xbf8: 0x073d, 0xbf9: 0x0501, 0xbfa: 0x0515, 0xbfb: 0x0511, + 0xbfc: 0x0681, 0xbfd: 0x0756, 0xbfe: 0x0776, 0xbff: 0x0040, + // Block 0x30, offset 0xc00 + 0xc00: 0x000a, 0xc01: 0x000a, 0xc02: 0x000a, 0xc03: 0x000a, 0xc04: 0x000a, 0xc05: 0x000a, + 0xc06: 0x000a, 0xc07: 0x000a, 0xc08: 0x000a, 0xc09: 0x000a, 0xc0a: 0x000a, 0xc0b: 0x03c0, + 0xc0c: 0x0003, 0xc0d: 0x0003, 0xc0e: 0x0340, 0xc0f: 0x0b40, 0xc10: 0x0018, 0xc11: 0xe00d, + 0xc12: 0x0018, 0xc13: 0x0018, 0xc14: 0x0018, 0xc15: 0x0018, 0xc16: 0x0018, 0xc17: 0x0796, + 0xc18: 0x0018, 0xc19: 0x0018, 0xc1a: 0x0018, 0xc1b: 0x0018, 0xc1c: 0x0018, 0xc1d: 0x0018, + 0xc1e: 0x0018, 0xc1f: 0x0018, 0xc20: 0x0018, 0xc21: 0x0018, 0xc22: 0x0018, 0xc23: 0x0018, + 0xc24: 0x0040, 0xc25: 0x0040, 0xc26: 0x0040, 0xc27: 0x0018, 0xc28: 0x0040, 0xc29: 0x0040, + 0xc2a: 0x0340, 0xc2b: 0x0340, 0xc2c: 0x0340, 0xc2d: 0x0340, 0xc2e: 0x0340, 0xc2f: 0x000a, + 0xc30: 0x0018, 0xc31: 0x0018, 0xc32: 0x0018, 0xc33: 0x0699, 0xc34: 0x06a1, 0xc35: 0x0018, + 0xc36: 0x06a9, 0xc37: 0x06b1, 0xc38: 0x0018, 0xc39: 0x0018, 0xc3a: 0x0018, 0xc3b: 0x0018, + 0xc3c: 0x06ba, 0xc3d: 0x0018, 0xc3e: 0x07b6, 0xc3f: 0x0018, + // Block 0x31, offset 0xc40 + 0xc40: 0x0018, 0xc41: 0x0018, 0xc42: 0x0018, 0xc43: 0x0018, 0xc44: 0x0018, 0xc45: 0x0018, + 0xc46: 0x0018, 0xc47: 0x06c2, 0xc48: 0x06ca, 0xc49: 0x06d2, 0xc4a: 0x0018, 0xc4b: 0x0018, + 0xc4c: 0x0018, 0xc4d: 0x0018, 0xc4e: 0x0018, 0xc4f: 0x0018, 0xc50: 0x0018, 0xc51: 0x0018, + 0xc52: 0x0018, 0xc53: 0x0018, 0xc54: 0x0018, 0xc55: 0x0018, 0xc56: 0x0018, 0xc57: 0x06d9, + 0xc58: 0x0018, 0xc59: 0x0018, 0xc5a: 0x0018, 0xc5b: 0x0018, 0xc5c: 0x0018, 0xc5d: 0x0018, + 0xc5e: 0x0018, 0xc5f: 0x000a, 0xc60: 0x03c0, 0xc61: 0x0340, 0xc62: 0x0340, 0xc63: 0x0340, + 0xc64: 0x03c0, 0xc65: 0x0040, 0xc66: 0x0040, 0xc67: 0x0040, 0xc68: 0x0040, 0xc69: 0x0040, + 0xc6a: 0x0340, 0xc6b: 0x0340, 0xc6c: 0x0340, 0xc6d: 0x0340, 0xc6e: 0x0340, 0xc6f: 0x0340, + 0xc70: 0x06e1, 0xc71: 0x0311, 0xc72: 0x0040, 0xc73: 0x0040, 0xc74: 0x06e9, 0xc75: 0x06f1, + 0xc76: 0x06f9, 0xc77: 0x0701, 0xc78: 0x0709, 0xc79: 0x0711, 0xc7a: 0x071a, 0xc7b: 0x07d5, + 0xc7c: 0x0722, 0xc7d: 0x072a, 0xc7e: 0x0732, 0xc7f: 0x0329, + // Block 0x32, offset 0xc80 + 0xc80: 0x06e1, 0xc81: 0x0049, 0xc82: 0x0029, 0xc83: 0x0031, 0xc84: 0x06e9, 0xc85: 0x06f1, + 0xc86: 0x06f9, 0xc87: 0x0701, 0xc88: 0x0709, 0xc89: 0x0711, 0xc8a: 0x071a, 0xc8b: 0x07ed, + 0xc8c: 0x0722, 0xc8d: 0x072a, 0xc8e: 0x0732, 0xc8f: 0x0040, 0xc90: 0x0019, 0xc91: 0x02f9, + 0xc92: 0x0051, 0xc93: 0x0109, 0xc94: 0x0361, 0xc95: 0x00a9, 0xc96: 0x0319, 0xc97: 0x0101, + 0xc98: 0x0321, 0xc99: 0x0329, 0xc9a: 0x0339, 0xc9b: 0x0089, 0xc9c: 0x0341, 0xc9d: 0x0040, + 0xc9e: 0x0040, 0xc9f: 0x0040, 0xca0: 0x0018, 0xca1: 0x0018, 0xca2: 0x0018, 0xca3: 0x0018, + 0xca4: 0x0018, 0xca5: 0x0018, 0xca6: 0x0018, 0xca7: 0x0018, 0xca8: 0x0739, 0xca9: 0x0018, + 0xcaa: 0x0018, 0xcab: 0x0018, 0xcac: 0x0018, 0xcad: 0x0018, 0xcae: 0x0018, 0xcaf: 0x0018, + 0xcb0: 0x0018, 0xcb1: 0x0018, 0xcb2: 0x0018, 0xcb3: 0x0018, 0xcb4: 0x0018, 0xcb5: 0x0018, + 0xcb6: 0x0018, 0xcb7: 0x0018, 0xcb8: 0x0018, 0xcb9: 0x0018, 0xcba: 0x0018, 0xcbb: 0x0018, + 0xcbc: 0x0018, 0xcbd: 0x0018, 0xcbe: 0x0018, 0xcbf: 0x0018, + // Block 0x33, offset 0xcc0 + 0xcc0: 0x0806, 0xcc1: 0x0826, 0xcc2: 0x03d9, 0xcc3: 0x0845, 0xcc4: 0x0018, 0xcc5: 0x0866, + 0xcc6: 0x0886, 0xcc7: 0x0369, 0xcc8: 0x0018, 0xcc9: 0x08a5, 0xcca: 0x0309, 0xccb: 0x00a9, + 0xccc: 0x00a9, 0xccd: 0x00a9, 0xcce: 0x00a9, 0xccf: 0x0741, 0xcd0: 0x0311, 0xcd1: 0x0311, + 0xcd2: 0x0101, 0xcd3: 0x0101, 0xcd4: 0x0018, 0xcd5: 0x0329, 0xcd6: 0x0749, 0xcd7: 0x0018, + 0xcd8: 0x0018, 0xcd9: 0x0339, 0xcda: 0x0751, 0xcdb: 0x00b9, 0xcdc: 0x00b9, 0xcdd: 0x00b9, + 0xcde: 0x0018, 0xcdf: 0x0018, 0xce0: 0x0759, 0xce1: 0x08c5, 0xce2: 0x0761, 0xce3: 0x0018, + 0xce4: 0x04b1, 0xce5: 0x0018, 0xce6: 0x0769, 0xce7: 0x0018, 0xce8: 0x04b1, 0xce9: 0x0018, + 0xcea: 0x0319, 0xceb: 0x0771, 0xcec: 0x02e9, 0xced: 0x03d9, 0xcee: 0x0018, 0xcef: 0x02f9, + 0xcf0: 0x02f9, 0xcf1: 0x03f1, 0xcf2: 0x0040, 0xcf3: 0x0321, 0xcf4: 0x0051, 0xcf5: 0x0779, + 0xcf6: 0x0781, 0xcf7: 0x0789, 0xcf8: 0x0791, 0xcf9: 0x0311, 0xcfa: 0x0018, 0xcfb: 0x08e5, + 0xcfc: 0x0799, 0xcfd: 0x03a1, 0xcfe: 0x03a1, 0xcff: 0x0799, + // Block 0x34, offset 0xd00 + 0xd00: 0x0905, 0xd01: 0x0018, 0xd02: 0x0018, 0xd03: 0x0018, 0xd04: 0x0018, 0xd05: 0x02f1, + 0xd06: 0x02f1, 0xd07: 0x02f9, 0xd08: 0x0311, 0xd09: 0x00b1, 0xd0a: 0x0018, 0xd0b: 0x0018, + 0xd0c: 0x0018, 0xd0d: 0x0018, 0xd0e: 0x0008, 0xd0f: 0x0018, 0xd10: 0x07a1, 0xd11: 0x07a9, + 0xd12: 0x07b1, 0xd13: 0x07b9, 0xd14: 0x07c1, 0xd15: 0x07c9, 0xd16: 0x07d1, 0xd17: 0x07d9, + 0xd18: 0x07e1, 0xd19: 0x07e9, 0xd1a: 0x07f1, 0xd1b: 0x07f9, 0xd1c: 0x0801, 0xd1d: 0x0809, + 0xd1e: 0x0811, 0xd1f: 0x0819, 0xd20: 0x0311, 0xd21: 0x0821, 0xd22: 0x091d, 0xd23: 0x0829, + 0xd24: 0x0391, 0xd25: 0x0831, 0xd26: 0x093d, 0xd27: 0x0839, 0xd28: 0x0841, 0xd29: 0x0109, + 0xd2a: 0x0849, 0xd2b: 0x095d, 0xd2c: 0x0101, 0xd2d: 0x03d9, 0xd2e: 0x02f1, 0xd2f: 0x0321, + 0xd30: 0x0311, 0xd31: 0x0821, 0xd32: 0x097d, 0xd33: 0x0829, 0xd34: 0x0391, 0xd35: 0x0831, + 0xd36: 0x099d, 0xd37: 0x0839, 0xd38: 0x0841, 0xd39: 0x0109, 0xd3a: 0x0849, 0xd3b: 0x09bd, + 0xd3c: 0x0101, 0xd3d: 0x03d9, 0xd3e: 0x02f1, 0xd3f: 0x0321, + // Block 0x35, offset 0xd40 + 0xd40: 0x0018, 0xd41: 0x0018, 0xd42: 0x0018, 0xd43: 0x0018, 0xd44: 0x0018, 0xd45: 0x0018, + 0xd46: 0x0018, 0xd47: 0x0018, 0xd48: 0x0018, 0xd49: 0x0018, 0xd4a: 0x0018, 0xd4b: 0x0040, + 0xd4c: 0x0040, 0xd4d: 0x0040, 0xd4e: 0x0040, 0xd4f: 0x0040, 0xd50: 0x0040, 0xd51: 0x0040, + 0xd52: 0x0040, 0xd53: 0x0040, 0xd54: 0x0040, 0xd55: 0x0040, 0xd56: 0x0040, 0xd57: 0x0040, + 0xd58: 0x0040, 0xd59: 0x0040, 0xd5a: 0x0040, 0xd5b: 0x0040, 0xd5c: 0x0040, 0xd5d: 0x0040, + 0xd5e: 0x0040, 0xd5f: 0x0040, 0xd60: 0x0049, 0xd61: 0x0029, 0xd62: 0x0031, 0xd63: 0x06e9, + 0xd64: 0x06f1, 0xd65: 0x06f9, 0xd66: 0x0701, 0xd67: 0x0709, 0xd68: 0x0711, 0xd69: 0x0879, + 0xd6a: 0x0881, 0xd6b: 0x0889, 0xd6c: 0x0891, 0xd6d: 0x0899, 0xd6e: 0x08a1, 0xd6f: 0x08a9, + 0xd70: 0x08b1, 0xd71: 0x08b9, 0xd72: 0x08c1, 0xd73: 0x08c9, 0xd74: 0x0a1e, 0xd75: 0x0a3e, + 0xd76: 0x0a5e, 0xd77: 0x0a7e, 0xd78: 0x0a9e, 0xd79: 0x0abe, 0xd7a: 0x0ade, 0xd7b: 0x0afe, + 0xd7c: 0x0b1e, 0xd7d: 0x08d2, 0xd7e: 0x08da, 0xd7f: 0x08e2, + // Block 0x36, offset 0xd80 + 0xd80: 0x08ea, 0xd81: 0x08f2, 0xd82: 0x08fa, 0xd83: 0x0902, 0xd84: 0x090a, 0xd85: 0x0912, + 0xd86: 0x091a, 0xd87: 0x0922, 0xd88: 0x0040, 0xd89: 0x0040, 0xd8a: 0x0040, 0xd8b: 0x0040, + 0xd8c: 0x0040, 0xd8d: 0x0040, 0xd8e: 0x0040, 0xd8f: 0x0040, 0xd90: 0x0040, 0xd91: 0x0040, + 0xd92: 0x0040, 0xd93: 0x0040, 0xd94: 0x0040, 0xd95: 0x0040, 0xd96: 0x0040, 0xd97: 0x0040, + 0xd98: 0x0040, 0xd99: 0x0040, 0xd9a: 0x0040, 0xd9b: 0x0040, 0xd9c: 0x0b3e, 0xd9d: 0x0b5e, + 0xd9e: 0x0b7e, 0xd9f: 0x0b9e, 0xda0: 0x0bbe, 0xda1: 0x0bde, 0xda2: 0x0bfe, 0xda3: 0x0c1e, + 0xda4: 0x0c3e, 0xda5: 0x0c5e, 0xda6: 0x0c7e, 0xda7: 0x0c9e, 0xda8: 0x0cbe, 0xda9: 0x0cde, + 0xdaa: 0x0cfe, 0xdab: 0x0d1e, 0xdac: 0x0d3e, 0xdad: 0x0d5e, 0xdae: 0x0d7e, 0xdaf: 0x0d9e, + 0xdb0: 0x0dbe, 0xdb1: 0x0dde, 0xdb2: 0x0dfe, 0xdb3: 0x0e1e, 0xdb4: 0x0e3e, 0xdb5: 0x0e5e, + 0xdb6: 0x0019, 0xdb7: 0x02e9, 0xdb8: 0x03d9, 0xdb9: 0x02f1, 0xdba: 0x02f9, 0xdbb: 0x03f1, + 0xdbc: 0x0309, 0xdbd: 0x00a9, 0xdbe: 0x0311, 0xdbf: 0x00b1, + // Block 0x37, offset 0xdc0 + 0xdc0: 0x0319, 0xdc1: 0x0101, 0xdc2: 0x0321, 0xdc3: 0x0329, 0xdc4: 0x0051, 0xdc5: 0x0339, + 0xdc6: 0x0751, 0xdc7: 0x00b9, 0xdc8: 0x0089, 0xdc9: 0x0341, 0xdca: 0x0349, 0xdcb: 0x0391, + 0xdcc: 0x00c1, 0xdcd: 0x0109, 0xdce: 0x00c9, 0xdcf: 0x04b1, 0xdd0: 0x0019, 0xdd1: 0x02e9, + 0xdd2: 0x03d9, 0xdd3: 0x02f1, 0xdd4: 0x02f9, 0xdd5: 0x03f1, 0xdd6: 0x0309, 0xdd7: 0x00a9, + 0xdd8: 0x0311, 0xdd9: 0x00b1, 0xdda: 0x0319, 0xddb: 0x0101, 0xddc: 0x0321, 0xddd: 0x0329, + 0xdde: 0x0051, 0xddf: 0x0339, 0xde0: 0x0751, 0xde1: 0x00b9, 0xde2: 0x0089, 0xde3: 0x0341, + 0xde4: 0x0349, 0xde5: 0x0391, 0xde6: 0x00c1, 0xde7: 0x0109, 0xde8: 0x00c9, 0xde9: 0x04b1, + 0xdea: 0x06e1, 0xdeb: 0x0018, 0xdec: 0x0018, 0xded: 0x0018, 0xdee: 0x0018, 0xdef: 0x0018, + 0xdf0: 0x0018, 0xdf1: 0x0018, 0xdf2: 0x0018, 0xdf3: 0x0018, 0xdf4: 0x0018, 0xdf5: 0x0018, + 0xdf6: 0x0018, 0xdf7: 0x0018, 0xdf8: 0x0018, 0xdf9: 0x0018, 0xdfa: 0x0018, 0xdfb: 0x0018, + 0xdfc: 0x0018, 0xdfd: 0x0018, 0xdfe: 0x0018, 0xdff: 0x0018, + // Block 0x38, offset 0xe00 + 0xe00: 0x0008, 0xe01: 0x0008, 0xe02: 0x0008, 0xe03: 0x0008, 0xe04: 0x0008, 0xe05: 0x0008, + 0xe06: 0x0008, 0xe07: 0x0008, 0xe08: 0x0008, 0xe09: 0x0008, 0xe0a: 0x0008, 0xe0b: 0x0008, + 0xe0c: 0x0008, 0xe0d: 0x0008, 0xe0e: 0x0008, 0xe0f: 0x0008, 0xe10: 0x0008, 0xe11: 0x0008, + 0xe12: 0x0008, 0xe13: 0x0008, 0xe14: 0x0008, 0xe15: 0x0008, 0xe16: 0x0008, 0xe17: 0x0008, + 0xe18: 0x0008, 0xe19: 0x0008, 0xe1a: 0x0008, 0xe1b: 0x0008, 0xe1c: 0x0008, 0xe1d: 0x0008, + 0xe1e: 0x0008, 0xe1f: 0x0008, 0xe20: 0xe00d, 0xe21: 0x0008, 0xe22: 0x0941, 0xe23: 0x0ed5, + 0xe24: 0x0949, 0xe25: 0x0008, 0xe26: 0x0008, 0xe27: 0xe07d, 0xe28: 0x0008, 0xe29: 0xe01d, + 0xe2a: 0x0008, 0xe2b: 0xe03d, 0xe2c: 0x0008, 0xe2d: 0x0359, 0xe2e: 0x0441, 0xe2f: 0x0351, + 0xe30: 0x03d1, 0xe31: 0x0008, 0xe32: 0xe00d, 0xe33: 0x0008, 0xe34: 0x0008, 0xe35: 0xe01d, + 0xe36: 0x0008, 0xe37: 0x0008, 0xe38: 0x0008, 0xe39: 0x0008, 0xe3a: 0x0008, 0xe3b: 0x0008, + 0xe3c: 0x00b1, 0xe3d: 0x0391, 0xe3e: 0x0951, 0xe3f: 0x0959, + // Block 0x39, offset 0xe40 + 0xe40: 0xe00d, 0xe41: 0x0008, 0xe42: 0xe00d, 0xe43: 0x0008, 0xe44: 0xe00d, 0xe45: 0x0008, + 0xe46: 0xe00d, 0xe47: 0x0008, 0xe48: 0xe00d, 0xe49: 0x0008, 0xe4a: 0xe00d, 0xe4b: 0x0008, + 0xe4c: 0xe00d, 0xe4d: 0x0008, 0xe4e: 0xe00d, 0xe4f: 0x0008, 0xe50: 0xe00d, 0xe51: 0x0008, + 0xe52: 0xe00d, 0xe53: 0x0008, 0xe54: 0xe00d, 0xe55: 0x0008, 0xe56: 0xe00d, 0xe57: 0x0008, + 0xe58: 0xe00d, 0xe59: 0x0008, 0xe5a: 0xe00d, 0xe5b: 0x0008, 0xe5c: 0xe00d, 0xe5d: 0x0008, + 0xe5e: 0xe00d, 0xe5f: 0x0008, 0xe60: 0xe00d, 0xe61: 0x0008, 0xe62: 0xe00d, 0xe63: 0x0008, + 0xe64: 0x0008, 0xe65: 0x0018, 0xe66: 0x0018, 0xe67: 0x0018, 0xe68: 0x0018, 0xe69: 0x0018, + 0xe6a: 0x0018, 0xe6b: 0xe03d, 0xe6c: 0x0008, 0xe6d: 0xe01d, 0xe6e: 0x0008, 0xe6f: 0x3308, + 0xe70: 0x3308, 0xe71: 0x3308, 0xe72: 0xe00d, 0xe73: 0x0008, 0xe74: 0x0040, 0xe75: 0x0040, + 0xe76: 0x0040, 0xe77: 0x0040, 0xe78: 0x0040, 0xe79: 0x0018, 0xe7a: 0x0018, 0xe7b: 0x0018, + 0xe7c: 0x0018, 0xe7d: 0x0018, 0xe7e: 0x0018, 0xe7f: 0x0018, + // Block 0x3a, offset 0xe80 + 0xe80: 0x2715, 0xe81: 0x2735, 0xe82: 0x2755, 0xe83: 0x2775, 0xe84: 0x2795, 0xe85: 0x27b5, + 0xe86: 0x27d5, 0xe87: 0x27f5, 0xe88: 0x2815, 0xe89: 0x2835, 0xe8a: 0x2855, 0xe8b: 0x2875, + 0xe8c: 0x2895, 0xe8d: 0x28b5, 0xe8e: 0x28d5, 0xe8f: 0x28f5, 0xe90: 0x2915, 0xe91: 0x2935, + 0xe92: 0x2955, 0xe93: 0x2975, 0xe94: 0x2995, 0xe95: 0x29b5, 0xe96: 0x0040, 0xe97: 0x0040, + 0xe98: 0x0040, 0xe99: 0x0040, 0xe9a: 0x0040, 0xe9b: 0x0040, 0xe9c: 0x0040, 0xe9d: 0x0040, + 0xe9e: 0x0040, 0xe9f: 0x0040, 0xea0: 0x0040, 0xea1: 0x0040, 0xea2: 0x0040, 0xea3: 0x0040, + 0xea4: 0x0040, 0xea5: 0x0040, 0xea6: 0x0040, 0xea7: 0x0040, 0xea8: 0x0040, 0xea9: 0x0040, + 0xeaa: 0x0040, 0xeab: 0x0040, 0xeac: 0x0040, 0xead: 0x0040, 0xeae: 0x0040, 0xeaf: 0x0040, + 0xeb0: 0x0040, 0xeb1: 0x0040, 0xeb2: 0x0040, 0xeb3: 0x0040, 0xeb4: 0x0040, 0xeb5: 0x0040, + 0xeb6: 0x0040, 0xeb7: 0x0040, 0xeb8: 0x0040, 0xeb9: 0x0040, 0xeba: 0x0040, 0xebb: 0x0040, + 0xebc: 0x0040, 0xebd: 0x0040, 0xebe: 0x0040, 0xebf: 0x0040, + // Block 0x3b, offset 0xec0 + 0xec0: 0x000a, 0xec1: 0x0018, 0xec2: 0x0961, 0xec3: 0x0018, 0xec4: 0x0018, 0xec5: 0x0008, + 0xec6: 0x0008, 0xec7: 0x0008, 0xec8: 0x0018, 0xec9: 0x0018, 0xeca: 0x0018, 0xecb: 0x0018, + 0xecc: 0x0018, 0xecd: 0x0018, 0xece: 0x0018, 0xecf: 0x0018, 0xed0: 0x0018, 0xed1: 0x0018, + 0xed2: 0x0018, 0xed3: 0x0018, 0xed4: 0x0018, 0xed5: 0x0018, 0xed6: 0x0018, 0xed7: 0x0018, + 0xed8: 0x0018, 0xed9: 0x0018, 0xeda: 0x0018, 0xedb: 0x0018, 0xedc: 0x0018, 0xedd: 0x0018, + 0xede: 0x0018, 0xedf: 0x0018, 0xee0: 0x0018, 0xee1: 0x0018, 0xee2: 0x0018, 0xee3: 0x0018, + 0xee4: 0x0018, 0xee5: 0x0018, 0xee6: 0x0018, 0xee7: 0x0018, 0xee8: 0x0018, 0xee9: 0x0018, + 0xeea: 0x3308, 0xeeb: 0x3308, 0xeec: 0x3308, 0xeed: 0x3308, 0xeee: 0x3018, 0xeef: 0x3018, + 0xef0: 0x0018, 0xef1: 0x0018, 0xef2: 0x0018, 0xef3: 0x0018, 0xef4: 0x0018, 0xef5: 0x0018, + 0xef6: 0xe125, 0xef7: 0x0018, 0xef8: 0x29d5, 0xef9: 0x29f5, 0xefa: 0x2a15, 0xefb: 0x0018, + 0xefc: 0x0008, 0xefd: 0x0018, 0xefe: 0x0018, 0xeff: 0x0018, + // Block 0x3c, offset 0xf00 + 0xf00: 0x2b55, 0xf01: 0x2b75, 0xf02: 0x2b95, 0xf03: 0x2bb5, 0xf04: 0x2bd5, 0xf05: 0x2bf5, + 0xf06: 0x2bf5, 0xf07: 0x2bf5, 0xf08: 0x2c15, 0xf09: 0x2c15, 0xf0a: 0x2c15, 0xf0b: 0x2c15, + 0xf0c: 0x2c35, 0xf0d: 0x2c35, 0xf0e: 0x2c35, 0xf0f: 0x2c55, 0xf10: 0x2c75, 0xf11: 0x2c75, + 0xf12: 0x2a95, 0xf13: 0x2a95, 0xf14: 0x2c75, 0xf15: 0x2c75, 0xf16: 0x2c95, 0xf17: 0x2c95, + 0xf18: 0x2c75, 0xf19: 0x2c75, 0xf1a: 0x2a95, 0xf1b: 0x2a95, 0xf1c: 0x2c75, 0xf1d: 0x2c75, + 0xf1e: 0x2c55, 0xf1f: 0x2c55, 0xf20: 0x2cb5, 0xf21: 0x2cb5, 0xf22: 0x2cd5, 0xf23: 0x2cd5, + 0xf24: 0x0040, 0xf25: 0x2cf5, 0xf26: 0x2d15, 0xf27: 0x2d35, 0xf28: 0x2d35, 0xf29: 0x2d55, + 0xf2a: 0x2d75, 0xf2b: 0x2d95, 0xf2c: 0x2db5, 0xf2d: 0x2dd5, 0xf2e: 0x2df5, 0xf2f: 0x2e15, + 0xf30: 0x2e35, 0xf31: 0x2e55, 0xf32: 0x2e55, 0xf33: 0x2e75, 0xf34: 0x2e95, 0xf35: 0x2e95, + 0xf36: 0x2eb5, 0xf37: 0x2ed5, 0xf38: 0x2e75, 0xf39: 0x2ef5, 0xf3a: 0x2f15, 0xf3b: 0x2ef5, + 0xf3c: 0x2e75, 0xf3d: 0x2f35, 0xf3e: 0x2f55, 0xf3f: 0x2f75, + // Block 0x3d, offset 0xf40 + 0xf40: 0x2f95, 0xf41: 0x2fb5, 0xf42: 0x2d15, 0xf43: 0x2cf5, 0xf44: 0x2fd5, 0xf45: 0x2ff5, + 0xf46: 0x3015, 0xf47: 0x3035, 0xf48: 0x3055, 0xf49: 0x3075, 0xf4a: 0x3095, 0xf4b: 0x30b5, + 0xf4c: 0x30d5, 0xf4d: 0x30f5, 0xf4e: 0x3115, 0xf4f: 0x0040, 0xf50: 0x0018, 0xf51: 0x0018, + 0xf52: 0x3135, 0xf53: 0x3155, 0xf54: 0x3175, 0xf55: 0x3195, 0xf56: 0x31b5, 0xf57: 0x31d5, + 0xf58: 0x31f5, 0xf59: 0x3215, 0xf5a: 0x3235, 0xf5b: 0x3255, 0xf5c: 0x3175, 0xf5d: 0x3275, + 0xf5e: 0x3295, 0xf5f: 0x32b5, 0xf60: 0x0008, 0xf61: 0x0008, 0xf62: 0x0008, 0xf63: 0x0008, + 0xf64: 0x0008, 0xf65: 0x0008, 0xf66: 0x0008, 0xf67: 0x0008, 0xf68: 0x0008, 0xf69: 0x0008, + 0xf6a: 0x0008, 0xf6b: 0x0008, 0xf6c: 0x0008, 0xf6d: 0x0008, 0xf6e: 0x0008, 0xf6f: 0x0008, + 0xf70: 0x0008, 0xf71: 0x0008, 0xf72: 0x0008, 0xf73: 0x0008, 0xf74: 0x0008, 0xf75: 0x0008, + 0xf76: 0x0008, 0xf77: 0x0008, 0xf78: 0x0008, 0xf79: 0x0008, 0xf7a: 0x0008, 0xf7b: 0x0008, + 0xf7c: 0x0008, 0xf7d: 0x0008, 0xf7e: 0x0008, 0xf7f: 0x0008, + // Block 0x3e, offset 0xf80 + 0xf80: 0x0b82, 0xf81: 0x0b8a, 0xf82: 0x0b92, 0xf83: 0x0b9a, 0xf84: 0x32d5, 0xf85: 0x32f5, + 0xf86: 0x3315, 0xf87: 0x3335, 0xf88: 0x0018, 0xf89: 0x0018, 0xf8a: 0x0018, 0xf8b: 0x0018, + 0xf8c: 0x0018, 0xf8d: 0x0018, 0xf8e: 0x0018, 0xf8f: 0x0018, 0xf90: 0x3355, 0xf91: 0x0ba1, + 0xf92: 0x0ba9, 0xf93: 0x0bb1, 0xf94: 0x0bb9, 0xf95: 0x0bc1, 0xf96: 0x0bc9, 0xf97: 0x0bd1, + 0xf98: 0x0bd9, 0xf99: 0x0be1, 0xf9a: 0x0be9, 0xf9b: 0x0bf1, 0xf9c: 0x0bf9, 0xf9d: 0x0c01, + 0xf9e: 0x0c09, 0xf9f: 0x0c11, 0xfa0: 0x3375, 0xfa1: 0x3395, 0xfa2: 0x33b5, 0xfa3: 0x33d5, + 0xfa4: 0x33f5, 0xfa5: 0x33f5, 0xfa6: 0x3415, 0xfa7: 0x3435, 0xfa8: 0x3455, 0xfa9: 0x3475, + 0xfaa: 0x3495, 0xfab: 0x34b5, 0xfac: 0x34d5, 0xfad: 0x34f5, 0xfae: 0x3515, 0xfaf: 0x3535, + 0xfb0: 0x3555, 0xfb1: 0x3575, 0xfb2: 0x3595, 0xfb3: 0x35b5, 0xfb4: 0x35d5, 0xfb5: 0x35f5, + 0xfb6: 0x3615, 0xfb7: 0x3635, 0xfb8: 0x3655, 0xfb9: 0x3675, 0xfba: 0x3695, 0xfbb: 0x36b5, + 0xfbc: 0x0c19, 0xfbd: 0x0c21, 0xfbe: 0x36d5, 0xfbf: 0x0018, + // Block 0x3f, offset 0xfc0 + 0xfc0: 0x36f5, 0xfc1: 0x3715, 0xfc2: 0x3735, 0xfc3: 0x3755, 0xfc4: 0x3775, 0xfc5: 0x3795, + 0xfc6: 0x37b5, 0xfc7: 0x37d5, 0xfc8: 0x37f5, 0xfc9: 0x3815, 0xfca: 0x3835, 0xfcb: 0x3855, + 0xfcc: 0x3875, 0xfcd: 0x3895, 0xfce: 0x38b5, 0xfcf: 0x38d5, 0xfd0: 0x38f5, 0xfd1: 0x3915, + 0xfd2: 0x3935, 0xfd3: 0x3955, 0xfd4: 0x3975, 0xfd5: 0x3995, 0xfd6: 0x39b5, 0xfd7: 0x39d5, + 0xfd8: 0x39f5, 0xfd9: 0x3a15, 0xfda: 0x3a35, 0xfdb: 0x3a55, 0xfdc: 0x3a75, 0xfdd: 0x3a95, + 0xfde: 0x3ab5, 0xfdf: 0x3ad5, 0xfe0: 0x3af5, 0xfe1: 0x3b15, 0xfe2: 0x3b35, 0xfe3: 0x3b55, + 0xfe4: 0x3b75, 0xfe5: 0x3b95, 0xfe6: 0x1295, 0xfe7: 0x3bb5, 0xfe8: 0x3bd5, 0xfe9: 0x3bf5, + 0xfea: 0x3c15, 0xfeb: 0x3c35, 0xfec: 0x3c55, 0xfed: 0x3c75, 0xfee: 0x23b5, 0xfef: 0x3c95, + 0xff0: 0x3cb5, 0xff1: 0x0c29, 0xff2: 0x0c31, 0xff3: 0x0c39, 0xff4: 0x0c41, 0xff5: 0x0c49, + 0xff6: 0x0c51, 0xff7: 0x0c59, 0xff8: 0x0c61, 0xff9: 0x0c69, 0xffa: 0x0c71, 0xffb: 0x0c79, + 0xffc: 0x0c81, 0xffd: 0x0c89, 0xffe: 0x0c91, 0xfff: 0x0c99, + // Block 0x40, offset 0x1000 + 0x1000: 0x0ca1, 0x1001: 0x0ca9, 0x1002: 0x0cb1, 0x1003: 0x0cb9, 0x1004: 0x0cc1, 0x1005: 0x0cc9, + 0x1006: 0x0cd1, 0x1007: 0x0cd9, 0x1008: 0x0ce1, 0x1009: 0x0ce9, 0x100a: 0x0cf1, 0x100b: 0x0cf9, + 0x100c: 0x0d01, 0x100d: 0x3cd5, 0x100e: 0x0d09, 0x100f: 0x3cf5, 0x1010: 0x3d15, 0x1011: 0x3d2d, + 0x1012: 0x3d45, 0x1013: 0x3d5d, 0x1014: 0x3d75, 0x1015: 0x3d75, 0x1016: 0x3d5d, 0x1017: 0x3d8d, + 0x1018: 0x07d5, 0x1019: 0x3da5, 0x101a: 0x3dbd, 0x101b: 0x3dd5, 0x101c: 0x3ded, 0x101d: 0x3e05, + 0x101e: 0x3e1d, 0x101f: 0x3e35, 0x1020: 0x3e4d, 0x1021: 0x3e65, 0x1022: 0x3e7d, 0x1023: 0x3e95, + 0x1024: 0x3ead, 0x1025: 0x3ead, 0x1026: 0x3ec5, 0x1027: 0x3ec5, 0x1028: 0x3edd, 0x1029: 0x3edd, + 0x102a: 0x3ef5, 0x102b: 0x3f0d, 0x102c: 0x3f25, 0x102d: 0x3f3d, 0x102e: 0x3f55, 0x102f: 0x3f55, + 0x1030: 0x3f6d, 0x1031: 0x3f6d, 0x1032: 0x3f6d, 0x1033: 0x3f85, 0x1034: 0x3f9d, 0x1035: 0x3fb5, + 0x1036: 0x3fcd, 0x1037: 0x3fb5, 0x1038: 0x3fe5, 0x1039: 0x3ffd, 0x103a: 0x3f85, 0x103b: 0x4015, + 0x103c: 0x402d, 0x103d: 0x402d, 0x103e: 0x402d, 0x103f: 0x0d11, + // Block 0x41, offset 0x1040 + 0x1040: 0x10f9, 0x1041: 0x1101, 0x1042: 0x40a5, 0x1043: 0x1109, 0x1044: 0x1111, 0x1045: 0x1119, + 0x1046: 0x1121, 0x1047: 0x1129, 0x1048: 0x40c5, 0x1049: 0x1131, 0x104a: 0x1139, 0x104b: 0x1141, + 0x104c: 0x40e5, 0x104d: 0x40e5, 0x104e: 0x1149, 0x104f: 0x1151, 0x1050: 0x1159, 0x1051: 0x4105, + 0x1052: 0x4125, 0x1053: 0x4145, 0x1054: 0x4165, 0x1055: 0x4185, 0x1056: 0x1161, 0x1057: 0x1169, + 0x1058: 0x1171, 0x1059: 0x1179, 0x105a: 0x1181, 0x105b: 0x41a5, 0x105c: 0x1189, 0x105d: 0x1191, + 0x105e: 0x1199, 0x105f: 0x41c5, 0x1060: 0x41e5, 0x1061: 0x11a1, 0x1062: 0x4205, 0x1063: 0x4225, + 0x1064: 0x4245, 0x1065: 0x11a9, 0x1066: 0x4265, 0x1067: 0x11b1, 0x1068: 0x11b9, 0x1069: 0x10f9, + 0x106a: 0x4285, 0x106b: 0x42a5, 0x106c: 0x42c5, 0x106d: 0x42e5, 0x106e: 0x11c1, 0x106f: 0x11c9, + 0x1070: 0x11d1, 0x1071: 0x11d9, 0x1072: 0x4305, 0x1073: 0x11e1, 0x1074: 0x11e9, 0x1075: 0x11f1, + 0x1076: 0x4325, 0x1077: 0x11f9, 0x1078: 0x1201, 0x1079: 0x11f9, 0x107a: 0x1209, 0x107b: 0x1211, + 0x107c: 0x4345, 0x107d: 0x1219, 0x107e: 0x1221, 0x107f: 0x1219, + // Block 0x42, offset 0x1080 + 0x1080: 0x4365, 0x1081: 0x4385, 0x1082: 0x0040, 0x1083: 0x1229, 0x1084: 0x1231, 0x1085: 0x1239, + 0x1086: 0x1241, 0x1087: 0x0040, 0x1088: 0x1249, 0x1089: 0x1251, 0x108a: 0x1259, 0x108b: 0x1261, + 0x108c: 0x1269, 0x108d: 0x1271, 0x108e: 0x1199, 0x108f: 0x1279, 0x1090: 0x1281, 0x1091: 0x1289, + 0x1092: 0x43a5, 0x1093: 0x1291, 0x1094: 0x1121, 0x1095: 0x43c5, 0x1096: 0x43e5, 0x1097: 0x1299, + 0x1098: 0x0040, 0x1099: 0x4405, 0x109a: 0x12a1, 0x109b: 0x12a9, 0x109c: 0x12b1, 0x109d: 0x12b9, + 0x109e: 0x12c1, 0x109f: 0x12c9, 0x10a0: 0x12d1, 0x10a1: 0x12d9, 0x10a2: 0x12e1, 0x10a3: 0x12e9, + 0x10a4: 0x12f1, 0x10a5: 0x12f9, 0x10a6: 0x1301, 0x10a7: 0x1309, 0x10a8: 0x1311, 0x10a9: 0x1319, + 0x10aa: 0x1321, 0x10ab: 0x1329, 0x10ac: 0x1331, 0x10ad: 0x1339, 0x10ae: 0x1341, 0x10af: 0x1349, + 0x10b0: 0x1351, 0x10b1: 0x1359, 0x10b2: 0x1361, 0x10b3: 0x1369, 0x10b4: 0x1371, 0x10b5: 0x1379, + 0x10b6: 0x1381, 0x10b7: 0x1389, 0x10b8: 0x1391, 0x10b9: 0x1399, 0x10ba: 0x13a1, 0x10bb: 0x13a9, + 0x10bc: 0x13b1, 0x10bd: 0x13b9, 0x10be: 0x13c1, 0x10bf: 0x4425, + // Block 0x43, offset 0x10c0 + 0x10c0: 0xe00d, 0x10c1: 0x0008, 0x10c2: 0xe00d, 0x10c3: 0x0008, 0x10c4: 0xe00d, 0x10c5: 0x0008, + 0x10c6: 0xe00d, 0x10c7: 0x0008, 0x10c8: 0xe00d, 0x10c9: 0x0008, 0x10ca: 0xe00d, 0x10cb: 0x0008, + 0x10cc: 0xe00d, 0x10cd: 0x0008, 0x10ce: 0xe00d, 0x10cf: 0x0008, 0x10d0: 0xe00d, 0x10d1: 0x0008, + 0x10d2: 0xe00d, 0x10d3: 0x0008, 0x10d4: 0xe00d, 0x10d5: 0x0008, 0x10d6: 0xe00d, 0x10d7: 0x0008, + 0x10d8: 0xe00d, 0x10d9: 0x0008, 0x10da: 0xe00d, 0x10db: 0x0008, 0x10dc: 0xe00d, 0x10dd: 0x0008, + 0x10de: 0xe00d, 0x10df: 0x0008, 0x10e0: 0xe00d, 0x10e1: 0x0008, 0x10e2: 0xe00d, 0x10e3: 0x0008, + 0x10e4: 0xe00d, 0x10e5: 0x0008, 0x10e6: 0xe00d, 0x10e7: 0x0008, 0x10e8: 0xe00d, 0x10e9: 0x0008, + 0x10ea: 0xe00d, 0x10eb: 0x0008, 0x10ec: 0xe00d, 0x10ed: 0x0008, 0x10ee: 0x0008, 0x10ef: 0x3308, + 0x10f0: 0x3318, 0x10f1: 0x3318, 0x10f2: 0x3318, 0x10f3: 0x0018, 0x10f4: 0x3308, 0x10f5: 0x3308, + 0x10f6: 0x3308, 0x10f7: 0x3308, 0x10f8: 0x3308, 0x10f9: 0x3308, 0x10fa: 0x3308, 0x10fb: 0x3308, + 0x10fc: 0x3308, 0x10fd: 0x3308, 0x10fe: 0x0018, 0x10ff: 0x0008, + // Block 0x44, offset 0x1100 + 0x1100: 0xe00d, 0x1101: 0x0008, 0x1102: 0xe00d, 0x1103: 0x0008, 0x1104: 0xe00d, 0x1105: 0x0008, + 0x1106: 0xe00d, 0x1107: 0x0008, 0x1108: 0xe00d, 0x1109: 0x0008, 0x110a: 0xe00d, 0x110b: 0x0008, + 0x110c: 0xe00d, 0x110d: 0x0008, 0x110e: 0xe00d, 0x110f: 0x0008, 0x1110: 0xe00d, 0x1111: 0x0008, + 0x1112: 0xe00d, 0x1113: 0x0008, 0x1114: 0xe00d, 0x1115: 0x0008, 0x1116: 0xe00d, 0x1117: 0x0008, + 0x1118: 0xe00d, 0x1119: 0x0008, 0x111a: 0xe00d, 0x111b: 0x0008, 0x111c: 0x02d1, 0x111d: 0x13c9, + 0x111e: 0x3308, 0x111f: 0x3308, 0x1120: 0x0008, 0x1121: 0x0008, 0x1122: 0x0008, 0x1123: 0x0008, + 0x1124: 0x0008, 0x1125: 0x0008, 0x1126: 0x0008, 0x1127: 0x0008, 0x1128: 0x0008, 0x1129: 0x0008, + 0x112a: 0x0008, 0x112b: 0x0008, 0x112c: 0x0008, 0x112d: 0x0008, 0x112e: 0x0008, 0x112f: 0x0008, + 0x1130: 0x0008, 0x1131: 0x0008, 0x1132: 0x0008, 0x1133: 0x0008, 0x1134: 0x0008, 0x1135: 0x0008, + 0x1136: 0x0008, 0x1137: 0x0008, 0x1138: 0x0008, 0x1139: 0x0008, 0x113a: 0x0008, 0x113b: 0x0008, + 0x113c: 0x0008, 0x113d: 0x0008, 0x113e: 0x0008, 0x113f: 0x0008, + // Block 0x45, offset 0x1140 + 0x1140: 0x0018, 0x1141: 0x0018, 0x1142: 0x0018, 0x1143: 0x0018, 0x1144: 0x0018, 0x1145: 0x0018, + 0x1146: 0x0018, 0x1147: 0x0018, 0x1148: 0x0018, 0x1149: 0x0018, 0x114a: 0x0018, 0x114b: 0x0018, + 0x114c: 0x0018, 0x114d: 0x0018, 0x114e: 0x0018, 0x114f: 0x0018, 0x1150: 0x0018, 0x1151: 0x0018, + 0x1152: 0x0018, 0x1153: 0x0018, 0x1154: 0x0018, 0x1155: 0x0018, 0x1156: 0x0018, 0x1157: 0x0008, + 0x1158: 0x0008, 0x1159: 0x0008, 0x115a: 0x0008, 0x115b: 0x0008, 0x115c: 0x0008, 0x115d: 0x0008, + 0x115e: 0x0008, 0x115f: 0x0008, 0x1160: 0x0018, 0x1161: 0x0018, 0x1162: 0xe00d, 0x1163: 0x0008, + 0x1164: 0xe00d, 0x1165: 0x0008, 0x1166: 0xe00d, 0x1167: 0x0008, 0x1168: 0xe00d, 0x1169: 0x0008, + 0x116a: 0xe00d, 0x116b: 0x0008, 0x116c: 0xe00d, 0x116d: 0x0008, 0x116e: 0xe00d, 0x116f: 0x0008, + 0x1170: 0x0008, 0x1171: 0x0008, 0x1172: 0xe00d, 0x1173: 0x0008, 0x1174: 0xe00d, 0x1175: 0x0008, + 0x1176: 0xe00d, 0x1177: 0x0008, 0x1178: 0xe00d, 0x1179: 0x0008, 0x117a: 0xe00d, 0x117b: 0x0008, + 0x117c: 0xe00d, 0x117d: 0x0008, 0x117e: 0xe00d, 0x117f: 0x0008, + // Block 0x46, offset 0x1180 + 0x1180: 0xe00d, 0x1181: 0x0008, 0x1182: 0xe00d, 0x1183: 0x0008, 0x1184: 0xe00d, 0x1185: 0x0008, + 0x1186: 0xe00d, 0x1187: 0x0008, 0x1188: 0xe00d, 0x1189: 0x0008, 0x118a: 0xe00d, 0x118b: 0x0008, + 0x118c: 0xe00d, 0x118d: 0x0008, 0x118e: 0xe00d, 0x118f: 0x0008, 0x1190: 0xe00d, 0x1191: 0x0008, + 0x1192: 0xe00d, 0x1193: 0x0008, 0x1194: 0xe00d, 0x1195: 0x0008, 0x1196: 0xe00d, 0x1197: 0x0008, + 0x1198: 0xe00d, 0x1199: 0x0008, 0x119a: 0xe00d, 0x119b: 0x0008, 0x119c: 0xe00d, 0x119d: 0x0008, + 0x119e: 0xe00d, 0x119f: 0x0008, 0x11a0: 0xe00d, 0x11a1: 0x0008, 0x11a2: 0xe00d, 0x11a3: 0x0008, + 0x11a4: 0xe00d, 0x11a5: 0x0008, 0x11a6: 0xe00d, 0x11a7: 0x0008, 0x11a8: 0xe00d, 0x11a9: 0x0008, + 0x11aa: 0xe00d, 0x11ab: 0x0008, 0x11ac: 0xe00d, 0x11ad: 0x0008, 0x11ae: 0xe00d, 0x11af: 0x0008, + 0x11b0: 0xe0fd, 0x11b1: 0x0008, 0x11b2: 0x0008, 0x11b3: 0x0008, 0x11b4: 0x0008, 0x11b5: 0x0008, + 0x11b6: 0x0008, 0x11b7: 0x0008, 0x11b8: 0x0008, 0x11b9: 0xe01d, 0x11ba: 0x0008, 0x11bb: 0xe03d, + 0x11bc: 0x0008, 0x11bd: 0x4445, 0x11be: 0xe00d, 0x11bf: 0x0008, + // Block 0x47, offset 0x11c0 + 0x11c0: 0xe00d, 0x11c1: 0x0008, 0x11c2: 0xe00d, 0x11c3: 0x0008, 0x11c4: 0xe00d, 0x11c5: 0x0008, + 0x11c6: 0xe00d, 0x11c7: 0x0008, 0x11c8: 0x0008, 0x11c9: 0x0018, 0x11ca: 0x0018, 0x11cb: 0xe03d, + 0x11cc: 0x0008, 0x11cd: 0x0409, 0x11ce: 0x0008, 0x11cf: 0x0008, 0x11d0: 0xe00d, 0x11d1: 0x0008, + 0x11d2: 0xe00d, 0x11d3: 0x0008, 0x11d4: 0x0008, 0x11d5: 0x0008, 0x11d6: 0xe00d, 0x11d7: 0x0008, + 0x11d8: 0xe00d, 0x11d9: 0x0008, 0x11da: 0xe00d, 0x11db: 0x0008, 0x11dc: 0xe00d, 0x11dd: 0x0008, + 0x11de: 0xe00d, 0x11df: 0x0008, 0x11e0: 0xe00d, 0x11e1: 0x0008, 0x11e2: 0xe00d, 0x11e3: 0x0008, + 0x11e4: 0xe00d, 0x11e5: 0x0008, 0x11e6: 0xe00d, 0x11e7: 0x0008, 0x11e8: 0xe00d, 0x11e9: 0x0008, + 0x11ea: 0x13d1, 0x11eb: 0x0371, 0x11ec: 0x0401, 0x11ed: 0x13d9, 0x11ee: 0x0421, 0x11ef: 0x0008, + 0x11f0: 0x13e1, 0x11f1: 0x13e9, 0x11f2: 0x0429, 0x11f3: 0x4465, 0x11f4: 0xe00d, 0x11f5: 0x0008, + 0x11f6: 0xe00d, 0x11f7: 0x0008, 0x11f8: 0xe00d, 0x11f9: 0x0008, 0x11fa: 0xe00d, 0x11fb: 0x0008, + 0x11fc: 0xe00d, 0x11fd: 0x0008, 0x11fe: 0xe00d, 0x11ff: 0x0008, + // Block 0x48, offset 0x1200 + 0x1200: 0xe00d, 0x1201: 0x0008, 0x1202: 0xe00d, 0x1203: 0x0008, 0x1204: 0x03f5, 0x1205: 0x0479, + 0x1206: 0x447d, 0x1207: 0xe07d, 0x1208: 0x0008, 0x1209: 0xe01d, 0x120a: 0x0008, 0x120b: 0x0040, + 0x120c: 0x0040, 0x120d: 0x0040, 0x120e: 0x0040, 0x120f: 0x0040, 0x1210: 0xe00d, 0x1211: 0x0008, + 0x1212: 0x0040, 0x1213: 0x0008, 0x1214: 0x0040, 0x1215: 0x0008, 0x1216: 0xe00d, 0x1217: 0x0008, + 0x1218: 0xe00d, 0x1219: 0x0008, 0x121a: 0x0040, 0x121b: 0x0040, 0x121c: 0x0040, 0x121d: 0x0040, + 0x121e: 0x0040, 0x121f: 0x0040, 0x1220: 0x0040, 0x1221: 0x0040, 0x1222: 0x0040, 0x1223: 0x0040, + 0x1224: 0x0040, 0x1225: 0x0040, 0x1226: 0x0040, 0x1227: 0x0040, 0x1228: 0x0040, 0x1229: 0x0040, + 0x122a: 0x0040, 0x122b: 0x0040, 0x122c: 0x0040, 0x122d: 0x0040, 0x122e: 0x0040, 0x122f: 0x0040, + 0x1230: 0x0040, 0x1231: 0x0040, 0x1232: 0x03d9, 0x1233: 0x03f1, 0x1234: 0x0751, 0x1235: 0xe01d, + 0x1236: 0x0008, 0x1237: 0x0008, 0x1238: 0x0741, 0x1239: 0x13f1, 0x123a: 0x0008, 0x123b: 0x0008, + 0x123c: 0x0008, 0x123d: 0x0008, 0x123e: 0x0008, 0x123f: 0x0008, + // Block 0x49, offset 0x1240 + 0x1240: 0x650d, 0x1241: 0x652d, 0x1242: 0x654d, 0x1243: 0x656d, 0x1244: 0x658d, 0x1245: 0x65ad, + 0x1246: 0x65cd, 0x1247: 0x65ed, 0x1248: 0x660d, 0x1249: 0x662d, 0x124a: 0x664d, 0x124b: 0x666d, + 0x124c: 0x668d, 0x124d: 0x66ad, 0x124e: 0x0008, 0x124f: 0x0008, 0x1250: 0x66cd, 0x1251: 0x0008, + 0x1252: 0x66ed, 0x1253: 0x0008, 0x1254: 0x0008, 0x1255: 0x670d, 0x1256: 0x672d, 0x1257: 0x674d, + 0x1258: 0x676d, 0x1259: 0x678d, 0x125a: 0x67ad, 0x125b: 0x67cd, 0x125c: 0x67ed, 0x125d: 0x680d, + 0x125e: 0x682d, 0x125f: 0x0008, 0x1260: 0x684d, 0x1261: 0x0008, 0x1262: 0x686d, 0x1263: 0x0008, + 0x1264: 0x0008, 0x1265: 0x688d, 0x1266: 0x68ad, 0x1267: 0x0008, 0x1268: 0x0008, 0x1269: 0x0008, + 0x126a: 0x68cd, 0x126b: 0x68ed, 0x126c: 0x690d, 0x126d: 0x692d, 0x126e: 0x694d, 0x126f: 0x696d, + 0x1270: 0x698d, 0x1271: 0x69ad, 0x1272: 0x69cd, 0x1273: 0x69ed, 0x1274: 0x6a0d, 0x1275: 0x6a2d, + 0x1276: 0x6a4d, 0x1277: 0x6a6d, 0x1278: 0x6a8d, 0x1279: 0x6aad, 0x127a: 0x6acd, 0x127b: 0x6aed, + 0x127c: 0x6b0d, 0x127d: 0x6b2d, 0x127e: 0x6b4d, 0x127f: 0x6b6d, + // Block 0x4a, offset 0x1280 + 0x1280: 0x7acd, 0x1281: 0x7aed, 0x1282: 0x7b0d, 0x1283: 0x7b2d, 0x1284: 0x7b4d, 0x1285: 0x7b6d, + 0x1286: 0x7b8d, 0x1287: 0x7bad, 0x1288: 0x7bcd, 0x1289: 0x7bed, 0x128a: 0x7c0d, 0x128b: 0x7c2d, + 0x128c: 0x7c4d, 0x128d: 0x7c6d, 0x128e: 0x7c8d, 0x128f: 0x1409, 0x1290: 0x1411, 0x1291: 0x1419, + 0x1292: 0x7cad, 0x1293: 0x7ccd, 0x1294: 0x7ced, 0x1295: 0x1421, 0x1296: 0x1429, 0x1297: 0x1431, + 0x1298: 0x7d0d, 0x1299: 0x7d2d, 0x129a: 0x0040, 0x129b: 0x0040, 0x129c: 0x0040, 0x129d: 0x0040, + 0x129e: 0x0040, 0x129f: 0x0040, 0x12a0: 0x0040, 0x12a1: 0x0040, 0x12a2: 0x0040, 0x12a3: 0x0040, + 0x12a4: 0x0040, 0x12a5: 0x0040, 0x12a6: 0x0040, 0x12a7: 0x0040, 0x12a8: 0x0040, 0x12a9: 0x0040, + 0x12aa: 0x0040, 0x12ab: 0x0040, 0x12ac: 0x0040, 0x12ad: 0x0040, 0x12ae: 0x0040, 0x12af: 0x0040, + 0x12b0: 0x0040, 0x12b1: 0x0040, 0x12b2: 0x0040, 0x12b3: 0x0040, 0x12b4: 0x0040, 0x12b5: 0x0040, + 0x12b6: 0x0040, 0x12b7: 0x0040, 0x12b8: 0x0040, 0x12b9: 0x0040, 0x12ba: 0x0040, 0x12bb: 0x0040, + 0x12bc: 0x0040, 0x12bd: 0x0040, 0x12be: 0x0040, 0x12bf: 0x0040, + // Block 0x4b, offset 0x12c0 + 0x12c0: 0x1439, 0x12c1: 0x1441, 0x12c2: 0x1449, 0x12c3: 0x7d4d, 0x12c4: 0x7d6d, 0x12c5: 0x1451, + 0x12c6: 0x1451, 0x12c7: 0x0040, 0x12c8: 0x0040, 0x12c9: 0x0040, 0x12ca: 0x0040, 0x12cb: 0x0040, + 0x12cc: 0x0040, 0x12cd: 0x0040, 0x12ce: 0x0040, 0x12cf: 0x0040, 0x12d0: 0x0040, 0x12d1: 0x0040, + 0x12d2: 0x0040, 0x12d3: 0x1459, 0x12d4: 0x1461, 0x12d5: 0x1469, 0x12d6: 0x1471, 0x12d7: 0x1479, + 0x12d8: 0x0040, 0x12d9: 0x0040, 0x12da: 0x0040, 0x12db: 0x0040, 0x12dc: 0x0040, 0x12dd: 0x1481, + 0x12de: 0x3308, 0x12df: 0x1489, 0x12e0: 0x1491, 0x12e1: 0x0779, 0x12e2: 0x0791, 0x12e3: 0x1499, + 0x12e4: 0x14a1, 0x12e5: 0x14a9, 0x12e6: 0x14b1, 0x12e7: 0x14b9, 0x12e8: 0x14c1, 0x12e9: 0x071a, + 0x12ea: 0x14c9, 0x12eb: 0x14d1, 0x12ec: 0x14d9, 0x12ed: 0x14e1, 0x12ee: 0x14e9, 0x12ef: 0x14f1, + 0x12f0: 0x14f9, 0x12f1: 0x1501, 0x12f2: 0x1509, 0x12f3: 0x1511, 0x12f4: 0x1519, 0x12f5: 0x1521, + 0x12f6: 0x1529, 0x12f7: 0x0040, 0x12f8: 0x1531, 0x12f9: 0x1539, 0x12fa: 0x1541, 0x12fb: 0x1549, + 0x12fc: 0x1551, 0x12fd: 0x0040, 0x12fe: 0x1559, 0x12ff: 0x0040, + // Block 0x4c, offset 0x1300 + 0x1300: 0x1561, 0x1301: 0x1569, 0x1302: 0x0040, 0x1303: 0x1571, 0x1304: 0x1579, 0x1305: 0x0040, + 0x1306: 0x1581, 0x1307: 0x1589, 0x1308: 0x1591, 0x1309: 0x1599, 0x130a: 0x15a1, 0x130b: 0x15a9, + 0x130c: 0x15b1, 0x130d: 0x15b9, 0x130e: 0x15c1, 0x130f: 0x15c9, 0x1310: 0x15d1, 0x1311: 0x15d1, + 0x1312: 0x15d9, 0x1313: 0x15d9, 0x1314: 0x15d9, 0x1315: 0x15d9, 0x1316: 0x15e1, 0x1317: 0x15e1, + 0x1318: 0x15e1, 0x1319: 0x15e1, 0x131a: 0x15e9, 0x131b: 0x15e9, 0x131c: 0x15e9, 0x131d: 0x15e9, + 0x131e: 0x15f1, 0x131f: 0x15f1, 0x1320: 0x15f1, 0x1321: 0x15f1, 0x1322: 0x15f9, 0x1323: 0x15f9, + 0x1324: 0x15f9, 0x1325: 0x15f9, 0x1326: 0x1601, 0x1327: 0x1601, 0x1328: 0x1601, 0x1329: 0x1601, + 0x132a: 0x1609, 0x132b: 0x1609, 0x132c: 0x1609, 0x132d: 0x1609, 0x132e: 0x1611, 0x132f: 0x1611, + 0x1330: 0x1611, 0x1331: 0x1611, 0x1332: 0x1619, 0x1333: 0x1619, 0x1334: 0x1619, 0x1335: 0x1619, + 0x1336: 0x1621, 0x1337: 0x1621, 0x1338: 0x1621, 0x1339: 0x1621, 0x133a: 0x1629, 0x133b: 0x1629, + 0x133c: 0x1629, 0x133d: 0x1629, 0x133e: 0x1631, 0x133f: 0x1631, + // Block 0x4d, offset 0x1340 + 0x1340: 0x1631, 0x1341: 0x1631, 0x1342: 0x1639, 0x1343: 0x1639, 0x1344: 0x1641, 0x1345: 0x1641, + 0x1346: 0x1649, 0x1347: 0x1649, 0x1348: 0x1651, 0x1349: 0x1651, 0x134a: 0x1659, 0x134b: 0x1659, + 0x134c: 0x1661, 0x134d: 0x1661, 0x134e: 0x1669, 0x134f: 0x1669, 0x1350: 0x1669, 0x1351: 0x1669, + 0x1352: 0x1671, 0x1353: 0x1671, 0x1354: 0x1671, 0x1355: 0x1671, 0x1356: 0x1679, 0x1357: 0x1679, + 0x1358: 0x1679, 0x1359: 0x1679, 0x135a: 0x1681, 0x135b: 0x1681, 0x135c: 0x1681, 0x135d: 0x1681, + 0x135e: 0x1689, 0x135f: 0x1689, 0x1360: 0x1691, 0x1361: 0x1691, 0x1362: 0x1691, 0x1363: 0x1691, + 0x1364: 0x1699, 0x1365: 0x1699, 0x1366: 0x16a1, 0x1367: 0x16a1, 0x1368: 0x16a1, 0x1369: 0x16a1, + 0x136a: 0x16a9, 0x136b: 0x16a9, 0x136c: 0x16a9, 0x136d: 0x16a9, 0x136e: 0x16b1, 0x136f: 0x16b1, + 0x1370: 0x16b9, 0x1371: 0x16b9, 0x1372: 0x0818, 0x1373: 0x0818, 0x1374: 0x0818, 0x1375: 0x0818, + 0x1376: 0x0818, 0x1377: 0x0818, 0x1378: 0x0818, 0x1379: 0x0818, 0x137a: 0x0818, 0x137b: 0x0818, + 0x137c: 0x0818, 0x137d: 0x0818, 0x137e: 0x0818, 0x137f: 0x0818, + // Block 0x4e, offset 0x1380 + 0x1380: 0x0818, 0x1381: 0x0818, 0x1382: 0x0818, 0x1383: 0x0040, 0x1384: 0x0040, 0x1385: 0x0040, + 0x1386: 0x0040, 0x1387: 0x0040, 0x1388: 0x0040, 0x1389: 0x0040, 0x138a: 0x0040, 0x138b: 0x0040, + 0x138c: 0x0040, 0x138d: 0x0040, 0x138e: 0x0040, 0x138f: 0x0040, 0x1390: 0x0040, 0x1391: 0x0040, + 0x1392: 0x0040, 0x1393: 0x16c1, 0x1394: 0x16c1, 0x1395: 0x16c1, 0x1396: 0x16c1, 0x1397: 0x16c9, + 0x1398: 0x16c9, 0x1399: 0x16d1, 0x139a: 0x16d1, 0x139b: 0x16d9, 0x139c: 0x16d9, 0x139d: 0x0149, + 0x139e: 0x16e1, 0x139f: 0x16e1, 0x13a0: 0x16e9, 0x13a1: 0x16e9, 0x13a2: 0x16f1, 0x13a3: 0x16f1, + 0x13a4: 0x16f9, 0x13a5: 0x16f9, 0x13a6: 0x16f9, 0x13a7: 0x16f9, 0x13a8: 0x1701, 0x13a9: 0x1701, + 0x13aa: 0x1709, 0x13ab: 0x1709, 0x13ac: 0x1711, 0x13ad: 0x1711, 0x13ae: 0x1719, 0x13af: 0x1719, + 0x13b0: 0x1721, 0x13b1: 0x1721, 0x13b2: 0x1729, 0x13b3: 0x1729, 0x13b4: 0x1731, 0x13b5: 0x1731, + 0x13b6: 0x1739, 0x13b7: 0x1739, 0x13b8: 0x1739, 0x13b9: 0x1741, 0x13ba: 0x1741, 0x13bb: 0x1741, + 0x13bc: 0x1749, 0x13bd: 0x1749, 0x13be: 0x1749, 0x13bf: 0x1749, + // Block 0x4f, offset 0x13c0 + 0x13c0: 0x1949, 0x13c1: 0x1951, 0x13c2: 0x1959, 0x13c3: 0x1961, 0x13c4: 0x1969, 0x13c5: 0x1971, + 0x13c6: 0x1979, 0x13c7: 0x1981, 0x13c8: 0x1989, 0x13c9: 0x1991, 0x13ca: 0x1999, 0x13cb: 0x19a1, + 0x13cc: 0x19a9, 0x13cd: 0x19b1, 0x13ce: 0x19b9, 0x13cf: 0x19c1, 0x13d0: 0x19c9, 0x13d1: 0x19d1, + 0x13d2: 0x19d9, 0x13d3: 0x19e1, 0x13d4: 0x19e9, 0x13d5: 0x19f1, 0x13d6: 0x19f9, 0x13d7: 0x1a01, + 0x13d8: 0x1a09, 0x13d9: 0x1a11, 0x13da: 0x1a19, 0x13db: 0x1a21, 0x13dc: 0x1a29, 0x13dd: 0x1a31, + 0x13de: 0x1a3a, 0x13df: 0x1a42, 0x13e0: 0x1a4a, 0x13e1: 0x1a52, 0x13e2: 0x1a5a, 0x13e3: 0x1a62, + 0x13e4: 0x1a69, 0x13e5: 0x1a71, 0x13e6: 0x1761, 0x13e7: 0x1a79, 0x13e8: 0x1741, 0x13e9: 0x1769, + 0x13ea: 0x1a81, 0x13eb: 0x1a89, 0x13ec: 0x1789, 0x13ed: 0x1a91, 0x13ee: 0x1791, 0x13ef: 0x1799, + 0x13f0: 0x1a99, 0x13f1: 0x1aa1, 0x13f2: 0x17b9, 0x13f3: 0x1aa9, 0x13f4: 0x17c1, 0x13f5: 0x17c9, + 0x13f6: 0x1ab1, 0x13f7: 0x1ab9, 0x13f8: 0x17d9, 0x13f9: 0x1ac1, 0x13fa: 0x17e1, 0x13fb: 0x17e9, + 0x13fc: 0x18d1, 0x13fd: 0x18d9, 0x13fe: 0x18f1, 0x13ff: 0x18f9, + // Block 0x50, offset 0x1400 + 0x1400: 0x1901, 0x1401: 0x1921, 0x1402: 0x1929, 0x1403: 0x1931, 0x1404: 0x1939, 0x1405: 0x1959, + 0x1406: 0x1961, 0x1407: 0x1969, 0x1408: 0x1ac9, 0x1409: 0x1989, 0x140a: 0x1ad1, 0x140b: 0x1ad9, + 0x140c: 0x19b9, 0x140d: 0x1ae1, 0x140e: 0x19c1, 0x140f: 0x19c9, 0x1410: 0x1a31, 0x1411: 0x1ae9, + 0x1412: 0x1af1, 0x1413: 0x1a09, 0x1414: 0x1af9, 0x1415: 0x1a11, 0x1416: 0x1a19, 0x1417: 0x1751, + 0x1418: 0x1759, 0x1419: 0x1b01, 0x141a: 0x1761, 0x141b: 0x1b09, 0x141c: 0x1771, 0x141d: 0x1779, + 0x141e: 0x1781, 0x141f: 0x1789, 0x1420: 0x1b11, 0x1421: 0x17a1, 0x1422: 0x17a9, 0x1423: 0x17b1, + 0x1424: 0x17b9, 0x1425: 0x1b19, 0x1426: 0x17d9, 0x1427: 0x17f1, 0x1428: 0x17f9, 0x1429: 0x1801, + 0x142a: 0x1809, 0x142b: 0x1811, 0x142c: 0x1821, 0x142d: 0x1829, 0x142e: 0x1831, 0x142f: 0x1839, + 0x1430: 0x1841, 0x1431: 0x1849, 0x1432: 0x1b21, 0x1433: 0x1851, 0x1434: 0x1859, 0x1435: 0x1861, + 0x1436: 0x1869, 0x1437: 0x1871, 0x1438: 0x1879, 0x1439: 0x1889, 0x143a: 0x1891, 0x143b: 0x1899, + 0x143c: 0x18a1, 0x143d: 0x18a9, 0x143e: 0x18b1, 0x143f: 0x18b9, + // Block 0x51, offset 0x1440 + 0x1440: 0x18c1, 0x1441: 0x18c9, 0x1442: 0x18e1, 0x1443: 0x18e9, 0x1444: 0x1909, 0x1445: 0x1911, + 0x1446: 0x1919, 0x1447: 0x1921, 0x1448: 0x1929, 0x1449: 0x1941, 0x144a: 0x1949, 0x144b: 0x1951, + 0x144c: 0x1959, 0x144d: 0x1b29, 0x144e: 0x1971, 0x144f: 0x1979, 0x1450: 0x1981, 0x1451: 0x1989, + 0x1452: 0x19a1, 0x1453: 0x19a9, 0x1454: 0x19b1, 0x1455: 0x19b9, 0x1456: 0x1b31, 0x1457: 0x19d1, + 0x1458: 0x19d9, 0x1459: 0x1b39, 0x145a: 0x19f1, 0x145b: 0x19f9, 0x145c: 0x1a01, 0x145d: 0x1a09, + 0x145e: 0x1b41, 0x145f: 0x1761, 0x1460: 0x1b09, 0x1461: 0x1789, 0x1462: 0x1b11, 0x1463: 0x17b9, + 0x1464: 0x1b19, 0x1465: 0x17d9, 0x1466: 0x1b49, 0x1467: 0x1841, 0x1468: 0x1b51, 0x1469: 0x1b59, + 0x146a: 0x1b61, 0x146b: 0x1921, 0x146c: 0x1929, 0x146d: 0x1959, 0x146e: 0x19b9, 0x146f: 0x1b31, + 0x1470: 0x1a09, 0x1471: 0x1b41, 0x1472: 0x1b69, 0x1473: 0x1b71, 0x1474: 0x1b79, 0x1475: 0x1b81, + 0x1476: 0x1b89, 0x1477: 0x1b91, 0x1478: 0x1b99, 0x1479: 0x1ba1, 0x147a: 0x1ba9, 0x147b: 0x1bb1, + 0x147c: 0x1bb9, 0x147d: 0x1bc1, 0x147e: 0x1bc9, 0x147f: 0x1bd1, + // Block 0x52, offset 0x1480 + 0x1480: 0x1bd9, 0x1481: 0x1be1, 0x1482: 0x1be9, 0x1483: 0x1bf1, 0x1484: 0x1bf9, 0x1485: 0x1c01, + 0x1486: 0x1c09, 0x1487: 0x1c11, 0x1488: 0x1c19, 0x1489: 0x1c21, 0x148a: 0x1c29, 0x148b: 0x1c31, + 0x148c: 0x1b59, 0x148d: 0x1c39, 0x148e: 0x1c41, 0x148f: 0x1c49, 0x1490: 0x1c51, 0x1491: 0x1b81, + 0x1492: 0x1b89, 0x1493: 0x1b91, 0x1494: 0x1b99, 0x1495: 0x1ba1, 0x1496: 0x1ba9, 0x1497: 0x1bb1, + 0x1498: 0x1bb9, 0x1499: 0x1bc1, 0x149a: 0x1bc9, 0x149b: 0x1bd1, 0x149c: 0x1bd9, 0x149d: 0x1be1, + 0x149e: 0x1be9, 0x149f: 0x1bf1, 0x14a0: 0x1bf9, 0x14a1: 0x1c01, 0x14a2: 0x1c09, 0x14a3: 0x1c11, + 0x14a4: 0x1c19, 0x14a5: 0x1c21, 0x14a6: 0x1c29, 0x14a7: 0x1c31, 0x14a8: 0x1b59, 0x14a9: 0x1c39, + 0x14aa: 0x1c41, 0x14ab: 0x1c49, 0x14ac: 0x1c51, 0x14ad: 0x1c21, 0x14ae: 0x1c29, 0x14af: 0x1c31, + 0x14b0: 0x1b59, 0x14b1: 0x1b51, 0x14b2: 0x1b61, 0x14b3: 0x1881, 0x14b4: 0x1829, 0x14b5: 0x1831, + 0x14b6: 0x1839, 0x14b7: 0x1c21, 0x14b8: 0x1c29, 0x14b9: 0x1c31, 0x14ba: 0x1881, 0x14bb: 0x1889, + 0x14bc: 0x1c59, 0x14bd: 0x1c59, 0x14be: 0x0018, 0x14bf: 0x0018, + // Block 0x53, offset 0x14c0 + 0x14c0: 0x0018, 0x14c1: 0x0018, 0x14c2: 0x0018, 0x14c3: 0x0018, 0x14c4: 0x0018, 0x14c5: 0x0018, + 0x14c6: 0x0018, 0x14c7: 0x0018, 0x14c8: 0x0018, 0x14c9: 0x0018, 0x14ca: 0x0018, 0x14cb: 0x0018, + 0x14cc: 0x0018, 0x14cd: 0x0018, 0x14ce: 0x0018, 0x14cf: 0x0018, 0x14d0: 0x1c61, 0x14d1: 0x1c69, + 0x14d2: 0x1c69, 0x14d3: 0x1c71, 0x14d4: 0x1c79, 0x14d5: 0x1c81, 0x14d6: 0x1c89, 0x14d7: 0x1c91, + 0x14d8: 0x1c99, 0x14d9: 0x1c99, 0x14da: 0x1ca1, 0x14db: 0x1ca9, 0x14dc: 0x1cb1, 0x14dd: 0x1cb9, + 0x14de: 0x1cc1, 0x14df: 0x1cc9, 0x14e0: 0x1cc9, 0x14e1: 0x1cd1, 0x14e2: 0x1cd9, 0x14e3: 0x1cd9, + 0x14e4: 0x1ce1, 0x14e5: 0x1ce1, 0x14e6: 0x1ce9, 0x14e7: 0x1cf1, 0x14e8: 0x1cf1, 0x14e9: 0x1cf9, + 0x14ea: 0x1d01, 0x14eb: 0x1d01, 0x14ec: 0x1d09, 0x14ed: 0x1d09, 0x14ee: 0x1d11, 0x14ef: 0x1d19, + 0x14f0: 0x1d19, 0x14f1: 0x1d21, 0x14f2: 0x1d21, 0x14f3: 0x1d29, 0x14f4: 0x1d31, 0x14f5: 0x1d39, + 0x14f6: 0x1d41, 0x14f7: 0x1d41, 0x14f8: 0x1d49, 0x14f9: 0x1d51, 0x14fa: 0x1d59, 0x14fb: 0x1d61, + 0x14fc: 0x1d69, 0x14fd: 0x1d69, 0x14fe: 0x1d71, 0x14ff: 0x1d79, + // Block 0x54, offset 0x1500 + 0x1500: 0x1f29, 0x1501: 0x1f31, 0x1502: 0x1f39, 0x1503: 0x1f11, 0x1504: 0x1d39, 0x1505: 0x1ce9, + 0x1506: 0x1f41, 0x1507: 0x1f49, 0x1508: 0x0040, 0x1509: 0x0040, 0x150a: 0x0040, 0x150b: 0x0040, + 0x150c: 0x0040, 0x150d: 0x0040, 0x150e: 0x0040, 0x150f: 0x0018, 0x1510: 0x0040, 0x1511: 0x0040, + 0x1512: 0x0040, 0x1513: 0x0040, 0x1514: 0x0040, 0x1515: 0x0040, 0x1516: 0x0040, 0x1517: 0x0040, + 0x1518: 0x0040, 0x1519: 0x0040, 0x151a: 0x0040, 0x151b: 0x0040, 0x151c: 0x0040, 0x151d: 0x0040, + 0x151e: 0x0040, 0x151f: 0x0040, 0x1520: 0x0040, 0x1521: 0x0040, 0x1522: 0x0040, 0x1523: 0x0040, + 0x1524: 0x0040, 0x1525: 0x0040, 0x1526: 0x0040, 0x1527: 0x0040, 0x1528: 0x0040, 0x1529: 0x0040, + 0x152a: 0x0040, 0x152b: 0x0040, 0x152c: 0x0040, 0x152d: 0x0040, 0x152e: 0x0040, 0x152f: 0x0040, + 0x1530: 0x1f51, 0x1531: 0x1f59, 0x1532: 0x1f61, 0x1533: 0x1f69, 0x1534: 0x1f71, 0x1535: 0x1f79, + 0x1536: 0x1f81, 0x1537: 0x1f89, 0x1538: 0x1f91, 0x1539: 0x1f99, 0x153a: 0x1fa2, 0x153b: 0x1faa, + 0x153c: 0x1fb1, 0x153d: 0x0018, 0x153e: 0x0018, 0x153f: 0x0018, + // Block 0x55, offset 0x1540 + 0x1540: 0x33c0, 0x1541: 0x33c0, 0x1542: 0x33c0, 0x1543: 0x33c0, 0x1544: 0x33c0, 0x1545: 0x33c0, + 0x1546: 0x33c0, 0x1547: 0x33c0, 0x1548: 0x33c0, 0x1549: 0x33c0, 0x154a: 0x33c0, 0x154b: 0x33c0, + 0x154c: 0x33c0, 0x154d: 0x33c0, 0x154e: 0x33c0, 0x154f: 0x33c0, 0x1550: 0x1fba, 0x1551: 0x7d8d, + 0x1552: 0x0040, 0x1553: 0x1fc2, 0x1554: 0x0122, 0x1555: 0x1fca, 0x1556: 0x1fd2, 0x1557: 0x7dad, + 0x1558: 0x7dcd, 0x1559: 0x0040, 0x155a: 0x0040, 0x155b: 0x0040, 0x155c: 0x0040, 0x155d: 0x0040, + 0x155e: 0x0040, 0x155f: 0x0040, 0x1560: 0x3308, 0x1561: 0x3308, 0x1562: 0x3308, 0x1563: 0x3308, + 0x1564: 0x3308, 0x1565: 0x3308, 0x1566: 0x3308, 0x1567: 0x3308, 0x1568: 0x3308, 0x1569: 0x3308, + 0x156a: 0x3308, 0x156b: 0x3308, 0x156c: 0x3308, 0x156d: 0x3308, 0x156e: 0x3308, 0x156f: 0x3308, + 0x1570: 0x0040, 0x1571: 0x7ded, 0x1572: 0x7e0d, 0x1573: 0x1fda, 0x1574: 0x1fda, 0x1575: 0x072a, + 0x1576: 0x0732, 0x1577: 0x1fe2, 0x1578: 0x1fea, 0x1579: 0x7e2d, 0x157a: 0x7e4d, 0x157b: 0x7e6d, + 0x157c: 0x7e2d, 0x157d: 0x7e8d, 0x157e: 0x7ead, 0x157f: 0x7e8d, + // Block 0x56, offset 0x1580 + 0x1580: 0x7ecd, 0x1581: 0x7eed, 0x1582: 0x7f0d, 0x1583: 0x7eed, 0x1584: 0x7f2d, 0x1585: 0x0018, + 0x1586: 0x0018, 0x1587: 0x1ff2, 0x1588: 0x1ffa, 0x1589: 0x7f4e, 0x158a: 0x7f6e, 0x158b: 0x7f8e, + 0x158c: 0x7fae, 0x158d: 0x1fda, 0x158e: 0x1fda, 0x158f: 0x1fda, 0x1590: 0x1fba, 0x1591: 0x7fcd, + 0x1592: 0x0040, 0x1593: 0x0040, 0x1594: 0x0122, 0x1595: 0x1fc2, 0x1596: 0x1fd2, 0x1597: 0x1fca, + 0x1598: 0x7fed, 0x1599: 0x072a, 0x159a: 0x0732, 0x159b: 0x1fe2, 0x159c: 0x1fea, 0x159d: 0x7ecd, + 0x159e: 0x7f2d, 0x159f: 0x2002, 0x15a0: 0x200a, 0x15a1: 0x2012, 0x15a2: 0x071a, 0x15a3: 0x2019, + 0x15a4: 0x2022, 0x15a5: 0x202a, 0x15a6: 0x0722, 0x15a7: 0x0040, 0x15a8: 0x2032, 0x15a9: 0x203a, + 0x15aa: 0x2042, 0x15ab: 0x204a, 0x15ac: 0x0040, 0x15ad: 0x0040, 0x15ae: 0x0040, 0x15af: 0x0040, + 0x15b0: 0x800e, 0x15b1: 0x2051, 0x15b2: 0x802e, 0x15b3: 0x0808, 0x15b4: 0x804e, 0x15b5: 0x0040, + 0x15b6: 0x806e, 0x15b7: 0x2059, 0x15b8: 0x808e, 0x15b9: 0x2061, 0x15ba: 0x80ae, 0x15bb: 0x2069, + 0x15bc: 0x80ce, 0x15bd: 0x2071, 0x15be: 0x80ee, 0x15bf: 0x2079, + // Block 0x57, offset 0x15c0 + 0x15c0: 0x2081, 0x15c1: 0x2089, 0x15c2: 0x2089, 0x15c3: 0x2091, 0x15c4: 0x2091, 0x15c5: 0x2099, + 0x15c6: 0x2099, 0x15c7: 0x20a1, 0x15c8: 0x20a1, 0x15c9: 0x20a9, 0x15ca: 0x20a9, 0x15cb: 0x20a9, + 0x15cc: 0x20a9, 0x15cd: 0x20b1, 0x15ce: 0x20b1, 0x15cf: 0x20b9, 0x15d0: 0x20b9, 0x15d1: 0x20b9, + 0x15d2: 0x20b9, 0x15d3: 0x20c1, 0x15d4: 0x20c1, 0x15d5: 0x20c9, 0x15d6: 0x20c9, 0x15d7: 0x20c9, + 0x15d8: 0x20c9, 0x15d9: 0x20d1, 0x15da: 0x20d1, 0x15db: 0x20d1, 0x15dc: 0x20d1, 0x15dd: 0x20d9, + 0x15de: 0x20d9, 0x15df: 0x20d9, 0x15e0: 0x20d9, 0x15e1: 0x20e1, 0x15e2: 0x20e1, 0x15e3: 0x20e1, + 0x15e4: 0x20e1, 0x15e5: 0x20e9, 0x15e6: 0x20e9, 0x15e7: 0x20e9, 0x15e8: 0x20e9, 0x15e9: 0x20f1, + 0x15ea: 0x20f1, 0x15eb: 0x20f9, 0x15ec: 0x20f9, 0x15ed: 0x2101, 0x15ee: 0x2101, 0x15ef: 0x2109, + 0x15f0: 0x2109, 0x15f1: 0x2111, 0x15f2: 0x2111, 0x15f3: 0x2111, 0x15f4: 0x2111, 0x15f5: 0x2119, + 0x15f6: 0x2119, 0x15f7: 0x2119, 0x15f8: 0x2119, 0x15f9: 0x2121, 0x15fa: 0x2121, 0x15fb: 0x2121, + 0x15fc: 0x2121, 0x15fd: 0x2129, 0x15fe: 0x2129, 0x15ff: 0x2129, + // Block 0x58, offset 0x1600 + 0x1600: 0x2129, 0x1601: 0x2131, 0x1602: 0x2131, 0x1603: 0x2131, 0x1604: 0x2131, 0x1605: 0x2139, + 0x1606: 0x2139, 0x1607: 0x2139, 0x1608: 0x2139, 0x1609: 0x2141, 0x160a: 0x2141, 0x160b: 0x2141, + 0x160c: 0x2141, 0x160d: 0x2149, 0x160e: 0x2149, 0x160f: 0x2149, 0x1610: 0x2149, 0x1611: 0x2151, + 0x1612: 0x2151, 0x1613: 0x2151, 0x1614: 0x2151, 0x1615: 0x2159, 0x1616: 0x2159, 0x1617: 0x2159, + 0x1618: 0x2159, 0x1619: 0x2161, 0x161a: 0x2161, 0x161b: 0x2161, 0x161c: 0x2161, 0x161d: 0x2169, + 0x161e: 0x2169, 0x161f: 0x2169, 0x1620: 0x2169, 0x1621: 0x2171, 0x1622: 0x2171, 0x1623: 0x2171, + 0x1624: 0x2171, 0x1625: 0x2179, 0x1626: 0x2179, 0x1627: 0x2179, 0x1628: 0x2179, 0x1629: 0x2181, + 0x162a: 0x2181, 0x162b: 0x2181, 0x162c: 0x2181, 0x162d: 0x2189, 0x162e: 0x2189, 0x162f: 0x1701, + 0x1630: 0x1701, 0x1631: 0x2191, 0x1632: 0x2191, 0x1633: 0x2191, 0x1634: 0x2191, 0x1635: 0x2199, + 0x1636: 0x2199, 0x1637: 0x21a1, 0x1638: 0x21a1, 0x1639: 0x21a9, 0x163a: 0x21a9, 0x163b: 0x21b1, + 0x163c: 0x21b1, 0x163d: 0x0040, 0x163e: 0x0040, 0x163f: 0x03c0, + // Block 0x59, offset 0x1640 + 0x1640: 0x0040, 0x1641: 0x1fca, 0x1642: 0x21ba, 0x1643: 0x2002, 0x1644: 0x203a, 0x1645: 0x2042, + 0x1646: 0x200a, 0x1647: 0x21c2, 0x1648: 0x072a, 0x1649: 0x0732, 0x164a: 0x2012, 0x164b: 0x071a, + 0x164c: 0x1fba, 0x164d: 0x2019, 0x164e: 0x0961, 0x164f: 0x21ca, 0x1650: 0x06e1, 0x1651: 0x0049, + 0x1652: 0x0029, 0x1653: 0x0031, 0x1654: 0x06e9, 0x1655: 0x06f1, 0x1656: 0x06f9, 0x1657: 0x0701, + 0x1658: 0x0709, 0x1659: 0x0711, 0x165a: 0x1fc2, 0x165b: 0x0122, 0x165c: 0x2022, 0x165d: 0x0722, + 0x165e: 0x202a, 0x165f: 0x1fd2, 0x1660: 0x204a, 0x1661: 0x0019, 0x1662: 0x02e9, 0x1663: 0x03d9, + 0x1664: 0x02f1, 0x1665: 0x02f9, 0x1666: 0x03f1, 0x1667: 0x0309, 0x1668: 0x00a9, 0x1669: 0x0311, + 0x166a: 0x00b1, 0x166b: 0x0319, 0x166c: 0x0101, 0x166d: 0x0321, 0x166e: 0x0329, 0x166f: 0x0051, + 0x1670: 0x0339, 0x1671: 0x0751, 0x1672: 0x00b9, 0x1673: 0x0089, 0x1674: 0x0341, 0x1675: 0x0349, + 0x1676: 0x0391, 0x1677: 0x00c1, 0x1678: 0x0109, 0x1679: 0x00c9, 0x167a: 0x04b1, 0x167b: 0x1ff2, + 0x167c: 0x2032, 0x167d: 0x1ffa, 0x167e: 0x21d2, 0x167f: 0x1fda, + // Block 0x5a, offset 0x1680 + 0x1680: 0x0672, 0x1681: 0x0019, 0x1682: 0x02e9, 0x1683: 0x03d9, 0x1684: 0x02f1, 0x1685: 0x02f9, + 0x1686: 0x03f1, 0x1687: 0x0309, 0x1688: 0x00a9, 0x1689: 0x0311, 0x168a: 0x00b1, 0x168b: 0x0319, + 0x168c: 0x0101, 0x168d: 0x0321, 0x168e: 0x0329, 0x168f: 0x0051, 0x1690: 0x0339, 0x1691: 0x0751, + 0x1692: 0x00b9, 0x1693: 0x0089, 0x1694: 0x0341, 0x1695: 0x0349, 0x1696: 0x0391, 0x1697: 0x00c1, + 0x1698: 0x0109, 0x1699: 0x00c9, 0x169a: 0x04b1, 0x169b: 0x1fe2, 0x169c: 0x21da, 0x169d: 0x1fea, + 0x169e: 0x21e2, 0x169f: 0x810d, 0x16a0: 0x812d, 0x16a1: 0x0961, 0x16a2: 0x814d, 0x16a3: 0x814d, + 0x16a4: 0x816d, 0x16a5: 0x818d, 0x16a6: 0x81ad, 0x16a7: 0x81cd, 0x16a8: 0x81ed, 0x16a9: 0x820d, + 0x16aa: 0x822d, 0x16ab: 0x824d, 0x16ac: 0x826d, 0x16ad: 0x828d, 0x16ae: 0x82ad, 0x16af: 0x82cd, + 0x16b0: 0x82ed, 0x16b1: 0x830d, 0x16b2: 0x832d, 0x16b3: 0x834d, 0x16b4: 0x836d, 0x16b5: 0x838d, + 0x16b6: 0x83ad, 0x16b7: 0x83cd, 0x16b8: 0x83ed, 0x16b9: 0x840d, 0x16ba: 0x842d, 0x16bb: 0x844d, + 0x16bc: 0x81ed, 0x16bd: 0x846d, 0x16be: 0x848d, 0x16bf: 0x824d, + // Block 0x5b, offset 0x16c0 + 0x16c0: 0x84ad, 0x16c1: 0x84cd, 0x16c2: 0x84ed, 0x16c3: 0x850d, 0x16c4: 0x852d, 0x16c5: 0x854d, + 0x16c6: 0x856d, 0x16c7: 0x858d, 0x16c8: 0x850d, 0x16c9: 0x85ad, 0x16ca: 0x850d, 0x16cb: 0x85cd, + 0x16cc: 0x85cd, 0x16cd: 0x85ed, 0x16ce: 0x85ed, 0x16cf: 0x860d, 0x16d0: 0x854d, 0x16d1: 0x862d, + 0x16d2: 0x864d, 0x16d3: 0x862d, 0x16d4: 0x866d, 0x16d5: 0x864d, 0x16d6: 0x868d, 0x16d7: 0x868d, + 0x16d8: 0x86ad, 0x16d9: 0x86ad, 0x16da: 0x86cd, 0x16db: 0x86cd, 0x16dc: 0x864d, 0x16dd: 0x814d, + 0x16de: 0x86ed, 0x16df: 0x870d, 0x16e0: 0x0040, 0x16e1: 0x872d, 0x16e2: 0x874d, 0x16e3: 0x876d, + 0x16e4: 0x878d, 0x16e5: 0x876d, 0x16e6: 0x87ad, 0x16e7: 0x87cd, 0x16e8: 0x87ed, 0x16e9: 0x87ed, + 0x16ea: 0x880d, 0x16eb: 0x880d, 0x16ec: 0x882d, 0x16ed: 0x882d, 0x16ee: 0x880d, 0x16ef: 0x880d, + 0x16f0: 0x884d, 0x16f1: 0x886d, 0x16f2: 0x888d, 0x16f3: 0x88ad, 0x16f4: 0x88cd, 0x16f5: 0x88ed, + 0x16f6: 0x88ed, 0x16f7: 0x88ed, 0x16f8: 0x890d, 0x16f9: 0x890d, 0x16fa: 0x890d, 0x16fb: 0x890d, + 0x16fc: 0x87ed, 0x16fd: 0x87ed, 0x16fe: 0x87ed, 0x16ff: 0x0040, + // Block 0x5c, offset 0x1700 + 0x1700: 0x0040, 0x1701: 0x0040, 0x1702: 0x874d, 0x1703: 0x872d, 0x1704: 0x892d, 0x1705: 0x872d, + 0x1706: 0x874d, 0x1707: 0x872d, 0x1708: 0x0040, 0x1709: 0x0040, 0x170a: 0x894d, 0x170b: 0x874d, + 0x170c: 0x896d, 0x170d: 0x892d, 0x170e: 0x896d, 0x170f: 0x874d, 0x1710: 0x0040, 0x1711: 0x0040, + 0x1712: 0x898d, 0x1713: 0x89ad, 0x1714: 0x88ad, 0x1715: 0x896d, 0x1716: 0x892d, 0x1717: 0x896d, + 0x1718: 0x0040, 0x1719: 0x0040, 0x171a: 0x89cd, 0x171b: 0x89ed, 0x171c: 0x89cd, 0x171d: 0x0040, + 0x171e: 0x0040, 0x171f: 0x0040, 0x1720: 0x21e9, 0x1721: 0x21f1, 0x1722: 0x21f9, 0x1723: 0x8a0e, + 0x1724: 0x2201, 0x1725: 0x2209, 0x1726: 0x8a2d, 0x1727: 0x0040, 0x1728: 0x8a4d, 0x1729: 0x8a6d, + 0x172a: 0x8a8d, 0x172b: 0x8a6d, 0x172c: 0x8aad, 0x172d: 0x8acd, 0x172e: 0x8aed, 0x172f: 0x0040, + 0x1730: 0x0040, 0x1731: 0x0040, 0x1732: 0x0040, 0x1733: 0x0040, 0x1734: 0x0040, 0x1735: 0x0040, + 0x1736: 0x0040, 0x1737: 0x0040, 0x1738: 0x0040, 0x1739: 0x0340, 0x173a: 0x0340, 0x173b: 0x0340, + 0x173c: 0x0040, 0x173d: 0x0040, 0x173e: 0x0040, 0x173f: 0x0040, + // Block 0x5d, offset 0x1740 + 0x1740: 0x0008, 0x1741: 0x0008, 0x1742: 0x0008, 0x1743: 0x0008, 0x1744: 0x0008, 0x1745: 0x0008, + 0x1746: 0x0008, 0x1747: 0x0008, 0x1748: 0x0008, 0x1749: 0x0008, 0x174a: 0x0008, 0x174b: 0x0008, + 0x174c: 0x0008, 0x174d: 0x0008, 0x174e: 0x0008, 0x174f: 0x0008, 0x1750: 0x0008, 0x1751: 0x0008, + 0x1752: 0x0008, 0x1753: 0x0008, 0x1754: 0x0008, 0x1755: 0x0008, 0x1756: 0x0008, 0x1757: 0x0008, + 0x1758: 0x0008, 0x1759: 0x0008, 0x175a: 0x0008, 0x175b: 0x0008, 0x175c: 0x0008, 0x175d: 0x0008, + 0x175e: 0x0008, 0x175f: 0x0008, 0x1760: 0x0008, 0x1761: 0x0008, 0x1762: 0x0008, 0x1763: 0x0008, + 0x1764: 0x0040, 0x1765: 0x0040, 0x1766: 0x0040, 0x1767: 0x0040, 0x1768: 0x0040, 0x1769: 0x0040, + 0x176a: 0x0040, 0x176b: 0x0040, 0x176c: 0x0040, 0x176d: 0x0040, 0x176e: 0x0040, 0x176f: 0x0018, + 0x1770: 0x8b3d, 0x1771: 0x8b55, 0x1772: 0x8b6d, 0x1773: 0x8b55, 0x1774: 0x8b85, 0x1775: 0x8b55, + 0x1776: 0x8b6d, 0x1777: 0x8b55, 0x1778: 0x8b3d, 0x1779: 0x8b9d, 0x177a: 0x8bb5, 0x177b: 0x0040, + 0x177c: 0x8bcd, 0x177d: 0x8b9d, 0x177e: 0x8bb5, 0x177f: 0x8b9d, + // Block 0x5e, offset 0x1780 + 0x1780: 0xe13d, 0x1781: 0xe14d, 0x1782: 0xe15d, 0x1783: 0xe14d, 0x1784: 0xe17d, 0x1785: 0xe14d, + 0x1786: 0xe15d, 0x1787: 0xe14d, 0x1788: 0xe13d, 0x1789: 0xe1cd, 0x178a: 0xe1dd, 0x178b: 0x0040, + 0x178c: 0xe1fd, 0x178d: 0xe1cd, 0x178e: 0xe1dd, 0x178f: 0xe1cd, 0x1790: 0xe13d, 0x1791: 0xe14d, + 0x1792: 0xe15d, 0x1793: 0x0040, 0x1794: 0xe17d, 0x1795: 0xe14d, 0x1796: 0x0040, 0x1797: 0x0008, + 0x1798: 0x0008, 0x1799: 0x0008, 0x179a: 0x0008, 0x179b: 0x0008, 0x179c: 0x0008, 0x179d: 0x0008, + 0x179e: 0x0008, 0x179f: 0x0008, 0x17a0: 0x0008, 0x17a1: 0x0008, 0x17a2: 0x0040, 0x17a3: 0x0008, + 0x17a4: 0x0008, 0x17a5: 0x0008, 0x17a6: 0x0008, 0x17a7: 0x0008, 0x17a8: 0x0008, 0x17a9: 0x0008, + 0x17aa: 0x0008, 0x17ab: 0x0008, 0x17ac: 0x0008, 0x17ad: 0x0008, 0x17ae: 0x0008, 0x17af: 0x0008, + 0x17b0: 0x0008, 0x17b1: 0x0008, 0x17b2: 0x0040, 0x17b3: 0x0008, 0x17b4: 0x0008, 0x17b5: 0x0008, + 0x17b6: 0x0008, 0x17b7: 0x0008, 0x17b8: 0x0008, 0x17b9: 0x0008, 0x17ba: 0x0040, 0x17bb: 0x0008, + 0x17bc: 0x0008, 0x17bd: 0x0040, 0x17be: 0x0040, 0x17bf: 0x0040, + // Block 0x5f, offset 0x17c0 + 0x17c0: 0x0008, 0x17c1: 0x2211, 0x17c2: 0x2219, 0x17c3: 0x02e1, 0x17c4: 0x2221, 0x17c5: 0x2229, + 0x17c6: 0x0040, 0x17c7: 0x2231, 0x17c8: 0x2239, 0x17c9: 0x2241, 0x17ca: 0x2249, 0x17cb: 0x2251, + 0x17cc: 0x2259, 0x17cd: 0x2261, 0x17ce: 0x2269, 0x17cf: 0x2271, 0x17d0: 0x2279, 0x17d1: 0x2281, + 0x17d2: 0x2289, 0x17d3: 0x2291, 0x17d4: 0x2299, 0x17d5: 0x0741, 0x17d6: 0x22a1, 0x17d7: 0x22a9, + 0x17d8: 0x22b1, 0x17d9: 0x22b9, 0x17da: 0x22c1, 0x17db: 0x13d9, 0x17dc: 0x8be5, 0x17dd: 0x22c9, + 0x17de: 0x22d1, 0x17df: 0x8c05, 0x17e0: 0x22d9, 0x17e1: 0x8c25, 0x17e2: 0x22e1, 0x17e3: 0x22e9, + 0x17e4: 0x22f1, 0x17e5: 0x0751, 0x17e6: 0x22f9, 0x17e7: 0x8c45, 0x17e8: 0x0949, 0x17e9: 0x2301, + 0x17ea: 0x2309, 0x17eb: 0x2311, 0x17ec: 0x2319, 0x17ed: 0x2321, 0x17ee: 0x2329, 0x17ef: 0x2331, + 0x17f0: 0x2339, 0x17f1: 0x0040, 0x17f2: 0x2341, 0x17f3: 0x2349, 0x17f4: 0x2351, 0x17f5: 0x2359, + 0x17f6: 0x2361, 0x17f7: 0x2369, 0x17f8: 0x2371, 0x17f9: 0x8c65, 0x17fa: 0x8c85, 0x17fb: 0x0040, + 0x17fc: 0x0040, 0x17fd: 0x0040, 0x17fe: 0x0040, 0x17ff: 0x0040, + // Block 0x60, offset 0x1800 + 0x1800: 0x0a08, 0x1801: 0x0a08, 0x1802: 0x0a08, 0x1803: 0x0a08, 0x1804: 0x0a08, 0x1805: 0x0c08, + 0x1806: 0x0808, 0x1807: 0x0c08, 0x1808: 0x0818, 0x1809: 0x0c08, 0x180a: 0x0c08, 0x180b: 0x0808, + 0x180c: 0x0808, 0x180d: 0x0908, 0x180e: 0x0c08, 0x180f: 0x0c08, 0x1810: 0x0c08, 0x1811: 0x0c08, + 0x1812: 0x0c08, 0x1813: 0x0a08, 0x1814: 0x0a08, 0x1815: 0x0a08, 0x1816: 0x0a08, 0x1817: 0x0908, + 0x1818: 0x0a08, 0x1819: 0x0a08, 0x181a: 0x0a08, 0x181b: 0x0a08, 0x181c: 0x0a08, 0x181d: 0x0c08, + 0x181e: 0x0a08, 0x181f: 0x0a08, 0x1820: 0x0a08, 0x1821: 0x0c08, 0x1822: 0x0808, 0x1823: 0x0808, + 0x1824: 0x0c08, 0x1825: 0x3308, 0x1826: 0x3308, 0x1827: 0x0040, 0x1828: 0x0040, 0x1829: 0x0040, + 0x182a: 0x0040, 0x182b: 0x0a18, 0x182c: 0x0a18, 0x182d: 0x0a18, 0x182e: 0x0a18, 0x182f: 0x0c18, + 0x1830: 0x0818, 0x1831: 0x0818, 0x1832: 0x0818, 0x1833: 0x0818, 0x1834: 0x0818, 0x1835: 0x0818, + 0x1836: 0x0818, 0x1837: 0x0040, 0x1838: 0x0040, 0x1839: 0x0040, 0x183a: 0x0040, 0x183b: 0x0040, + 0x183c: 0x0040, 0x183d: 0x0040, 0x183e: 0x0040, 0x183f: 0x0040, + // Block 0x61, offset 0x1840 + 0x1840: 0x0a08, 0x1841: 0x0c08, 0x1842: 0x0a08, 0x1843: 0x0c08, 0x1844: 0x0c08, 0x1845: 0x0c08, + 0x1846: 0x0a08, 0x1847: 0x0a08, 0x1848: 0x0a08, 0x1849: 0x0c08, 0x184a: 0x0a08, 0x184b: 0x0a08, + 0x184c: 0x0c08, 0x184d: 0x0a08, 0x184e: 0x0c08, 0x184f: 0x0c08, 0x1850: 0x0a08, 0x1851: 0x0c08, + 0x1852: 0x0040, 0x1853: 0x0040, 0x1854: 0x0040, 0x1855: 0x0040, 0x1856: 0x0040, 0x1857: 0x0040, + 0x1858: 0x0040, 0x1859: 0x0818, 0x185a: 0x0818, 0x185b: 0x0818, 0x185c: 0x0818, 0x185d: 0x0040, + 0x185e: 0x0040, 0x185f: 0x0040, 0x1860: 0x0040, 0x1861: 0x0040, 0x1862: 0x0040, 0x1863: 0x0040, + 0x1864: 0x0040, 0x1865: 0x0040, 0x1866: 0x0040, 0x1867: 0x0040, 0x1868: 0x0040, 0x1869: 0x0c18, + 0x186a: 0x0c18, 0x186b: 0x0c18, 0x186c: 0x0c18, 0x186d: 0x0a18, 0x186e: 0x0a18, 0x186f: 0x0818, + 0x1870: 0x0040, 0x1871: 0x0040, 0x1872: 0x0040, 0x1873: 0x0040, 0x1874: 0x0040, 0x1875: 0x0040, + 0x1876: 0x0040, 0x1877: 0x0040, 0x1878: 0x0040, 0x1879: 0x0040, 0x187a: 0x0040, 0x187b: 0x0040, + 0x187c: 0x0040, 0x187d: 0x0040, 0x187e: 0x0040, 0x187f: 0x0040, + // Block 0x62, offset 0x1880 + 0x1880: 0x3308, 0x1881: 0x3308, 0x1882: 0x3008, 0x1883: 0x3008, 0x1884: 0x0040, 0x1885: 0x0008, + 0x1886: 0x0008, 0x1887: 0x0008, 0x1888: 0x0008, 0x1889: 0x0008, 0x188a: 0x0008, 0x188b: 0x0008, + 0x188c: 0x0008, 0x188d: 0x0040, 0x188e: 0x0040, 0x188f: 0x0008, 0x1890: 0x0008, 0x1891: 0x0040, + 0x1892: 0x0040, 0x1893: 0x0008, 0x1894: 0x0008, 0x1895: 0x0008, 0x1896: 0x0008, 0x1897: 0x0008, + 0x1898: 0x0008, 0x1899: 0x0008, 0x189a: 0x0008, 0x189b: 0x0008, 0x189c: 0x0008, 0x189d: 0x0008, + 0x189e: 0x0008, 0x189f: 0x0008, 0x18a0: 0x0008, 0x18a1: 0x0008, 0x18a2: 0x0008, 0x18a3: 0x0008, + 0x18a4: 0x0008, 0x18a5: 0x0008, 0x18a6: 0x0008, 0x18a7: 0x0008, 0x18a8: 0x0008, 0x18a9: 0x0040, + 0x18aa: 0x0008, 0x18ab: 0x0008, 0x18ac: 0x0008, 0x18ad: 0x0008, 0x18ae: 0x0008, 0x18af: 0x0008, + 0x18b0: 0x0008, 0x18b1: 0x0040, 0x18b2: 0x0008, 0x18b3: 0x0008, 0x18b4: 0x0040, 0x18b5: 0x0008, + 0x18b6: 0x0008, 0x18b7: 0x0008, 0x18b8: 0x0008, 0x18b9: 0x0008, 0x18ba: 0x0040, 0x18bb: 0x3308, + 0x18bc: 0x3308, 0x18bd: 0x0008, 0x18be: 0x3008, 0x18bf: 0x3008, + // Block 0x63, offset 0x18c0 + 0x18c0: 0x3308, 0x18c1: 0x3008, 0x18c2: 0x3008, 0x18c3: 0x3008, 0x18c4: 0x3008, 0x18c5: 0x0040, + 0x18c6: 0x0040, 0x18c7: 0x3008, 0x18c8: 0x3008, 0x18c9: 0x0040, 0x18ca: 0x0040, 0x18cb: 0x3008, + 0x18cc: 0x3008, 0x18cd: 0x3808, 0x18ce: 0x0040, 0x18cf: 0x0040, 0x18d0: 0x0008, 0x18d1: 0x0040, + 0x18d2: 0x0040, 0x18d3: 0x0040, 0x18d4: 0x0040, 0x18d5: 0x0040, 0x18d6: 0x0040, 0x18d7: 0x3008, + 0x18d8: 0x0040, 0x18d9: 0x0040, 0x18da: 0x0040, 0x18db: 0x0040, 0x18dc: 0x0040, 0x18dd: 0x0008, + 0x18de: 0x0008, 0x18df: 0x0008, 0x18e0: 0x0008, 0x18e1: 0x0008, 0x18e2: 0x3008, 0x18e3: 0x3008, + 0x18e4: 0x0040, 0x18e5: 0x0040, 0x18e6: 0x3308, 0x18e7: 0x3308, 0x18e8: 0x3308, 0x18e9: 0x3308, + 0x18ea: 0x3308, 0x18eb: 0x3308, 0x18ec: 0x3308, 0x18ed: 0x0040, 0x18ee: 0x0040, 0x18ef: 0x0040, + 0x18f0: 0x3308, 0x18f1: 0x3308, 0x18f2: 0x3308, 0x18f3: 0x3308, 0x18f4: 0x3308, 0x18f5: 0x0040, + 0x18f6: 0x0040, 0x18f7: 0x0040, 0x18f8: 0x0040, 0x18f9: 0x0040, 0x18fa: 0x0040, 0x18fb: 0x0040, + 0x18fc: 0x0040, 0x18fd: 0x0040, 0x18fe: 0x0040, 0x18ff: 0x0040, + // Block 0x64, offset 0x1900 + 0x1900: 0x0008, 0x1901: 0x0008, 0x1902: 0x0008, 0x1903: 0x0008, 0x1904: 0x0008, 0x1905: 0x0008, + 0x1906: 0x0008, 0x1907: 0x0040, 0x1908: 0x0040, 0x1909: 0x0008, 0x190a: 0x0040, 0x190b: 0x0040, + 0x190c: 0x0008, 0x190d: 0x0008, 0x190e: 0x0008, 0x190f: 0x0008, 0x1910: 0x0008, 0x1911: 0x0008, + 0x1912: 0x0008, 0x1913: 0x0008, 0x1914: 0x0040, 0x1915: 0x0008, 0x1916: 0x0008, 0x1917: 0x0040, + 0x1918: 0x0008, 0x1919: 0x0008, 0x191a: 0x0008, 0x191b: 0x0008, 0x191c: 0x0008, 0x191d: 0x0008, + 0x191e: 0x0008, 0x191f: 0x0008, 0x1920: 0x0008, 0x1921: 0x0008, 0x1922: 0x0008, 0x1923: 0x0008, + 0x1924: 0x0008, 0x1925: 0x0008, 0x1926: 0x0008, 0x1927: 0x0008, 0x1928: 0x0008, 0x1929: 0x0008, + 0x192a: 0x0008, 0x192b: 0x0008, 0x192c: 0x0008, 0x192d: 0x0008, 0x192e: 0x0008, 0x192f: 0x0008, + 0x1930: 0x3008, 0x1931: 0x3008, 0x1932: 0x3008, 0x1933: 0x3008, 0x1934: 0x3008, 0x1935: 0x3008, + 0x1936: 0x0040, 0x1937: 0x3008, 0x1938: 0x3008, 0x1939: 0x0040, 0x193a: 0x0040, 0x193b: 0x3308, + 0x193c: 0x3308, 0x193d: 0x3808, 0x193e: 0x3b08, 0x193f: 0x0008, + // Block 0x65, offset 0x1940 + 0x1940: 0x0019, 0x1941: 0x02e9, 0x1942: 0x03d9, 0x1943: 0x02f1, 0x1944: 0x02f9, 0x1945: 0x03f1, + 0x1946: 0x0309, 0x1947: 0x00a9, 0x1948: 0x0311, 0x1949: 0x00b1, 0x194a: 0x0319, 0x194b: 0x0101, + 0x194c: 0x0321, 0x194d: 0x0329, 0x194e: 0x0051, 0x194f: 0x0339, 0x1950: 0x0751, 0x1951: 0x00b9, + 0x1952: 0x0089, 0x1953: 0x0341, 0x1954: 0x0349, 0x1955: 0x0391, 0x1956: 0x00c1, 0x1957: 0x0109, + 0x1958: 0x00c9, 0x1959: 0x04b1, 0x195a: 0x0019, 0x195b: 0x02e9, 0x195c: 0x03d9, 0x195d: 0x02f1, + 0x195e: 0x02f9, 0x195f: 0x03f1, 0x1960: 0x0309, 0x1961: 0x00a9, 0x1962: 0x0311, 0x1963: 0x00b1, + 0x1964: 0x0319, 0x1965: 0x0101, 0x1966: 0x0321, 0x1967: 0x0329, 0x1968: 0x0051, 0x1969: 0x0339, + 0x196a: 0x0751, 0x196b: 0x00b9, 0x196c: 0x0089, 0x196d: 0x0341, 0x196e: 0x0349, 0x196f: 0x0391, + 0x1970: 0x00c1, 0x1971: 0x0109, 0x1972: 0x00c9, 0x1973: 0x04b1, 0x1974: 0x0019, 0x1975: 0x02e9, + 0x1976: 0x03d9, 0x1977: 0x02f1, 0x1978: 0x02f9, 0x1979: 0x03f1, 0x197a: 0x0309, 0x197b: 0x00a9, + 0x197c: 0x0311, 0x197d: 0x00b1, 0x197e: 0x0319, 0x197f: 0x0101, + // Block 0x66, offset 0x1980 + 0x1980: 0x0321, 0x1981: 0x0329, 0x1982: 0x0051, 0x1983: 0x0339, 0x1984: 0x0751, 0x1985: 0x00b9, + 0x1986: 0x0089, 0x1987: 0x0341, 0x1988: 0x0349, 0x1989: 0x0391, 0x198a: 0x00c1, 0x198b: 0x0109, + 0x198c: 0x00c9, 0x198d: 0x04b1, 0x198e: 0x0019, 0x198f: 0x02e9, 0x1990: 0x03d9, 0x1991: 0x02f1, + 0x1992: 0x02f9, 0x1993: 0x03f1, 0x1994: 0x0309, 0x1995: 0x0040, 0x1996: 0x0311, 0x1997: 0x00b1, + 0x1998: 0x0319, 0x1999: 0x0101, 0x199a: 0x0321, 0x199b: 0x0329, 0x199c: 0x0051, 0x199d: 0x0339, + 0x199e: 0x0751, 0x199f: 0x00b9, 0x19a0: 0x0089, 0x19a1: 0x0341, 0x19a2: 0x0349, 0x19a3: 0x0391, + 0x19a4: 0x00c1, 0x19a5: 0x0109, 0x19a6: 0x00c9, 0x19a7: 0x04b1, 0x19a8: 0x0019, 0x19a9: 0x02e9, + 0x19aa: 0x03d9, 0x19ab: 0x02f1, 0x19ac: 0x02f9, 0x19ad: 0x03f1, 0x19ae: 0x0309, 0x19af: 0x00a9, + 0x19b0: 0x0311, 0x19b1: 0x00b1, 0x19b2: 0x0319, 0x19b3: 0x0101, 0x19b4: 0x0321, 0x19b5: 0x0329, + 0x19b6: 0x0051, 0x19b7: 0x0339, 0x19b8: 0x0751, 0x19b9: 0x00b9, 0x19ba: 0x0089, 0x19bb: 0x0341, + 0x19bc: 0x0349, 0x19bd: 0x0391, 0x19be: 0x00c1, 0x19bf: 0x0109, + // Block 0x67, offset 0x19c0 + 0x19c0: 0x00c9, 0x19c1: 0x04b1, 0x19c2: 0x0019, 0x19c3: 0x02e9, 0x19c4: 0x03d9, 0x19c5: 0x02f1, + 0x19c6: 0x02f9, 0x19c7: 0x03f1, 0x19c8: 0x0309, 0x19c9: 0x00a9, 0x19ca: 0x0311, 0x19cb: 0x00b1, + 0x19cc: 0x0319, 0x19cd: 0x0101, 0x19ce: 0x0321, 0x19cf: 0x0329, 0x19d0: 0x0051, 0x19d1: 0x0339, + 0x19d2: 0x0751, 0x19d3: 0x00b9, 0x19d4: 0x0089, 0x19d5: 0x0341, 0x19d6: 0x0349, 0x19d7: 0x0391, + 0x19d8: 0x00c1, 0x19d9: 0x0109, 0x19da: 0x00c9, 0x19db: 0x04b1, 0x19dc: 0x0019, 0x19dd: 0x0040, + 0x19de: 0x03d9, 0x19df: 0x02f1, 0x19e0: 0x0040, 0x19e1: 0x0040, 0x19e2: 0x0309, 0x19e3: 0x0040, + 0x19e4: 0x0040, 0x19e5: 0x00b1, 0x19e6: 0x0319, 0x19e7: 0x0040, 0x19e8: 0x0040, 0x19e9: 0x0329, + 0x19ea: 0x0051, 0x19eb: 0x0339, 0x19ec: 0x0751, 0x19ed: 0x0040, 0x19ee: 0x0089, 0x19ef: 0x0341, + 0x19f0: 0x0349, 0x19f1: 0x0391, 0x19f2: 0x00c1, 0x19f3: 0x0109, 0x19f4: 0x00c9, 0x19f5: 0x04b1, + 0x19f6: 0x0019, 0x19f7: 0x02e9, 0x19f8: 0x03d9, 0x19f9: 0x02f1, 0x19fa: 0x0040, 0x19fb: 0x03f1, + 0x19fc: 0x0040, 0x19fd: 0x00a9, 0x19fe: 0x0311, 0x19ff: 0x00b1, + // Block 0x68, offset 0x1a00 + 0x1a00: 0x0319, 0x1a01: 0x0101, 0x1a02: 0x0321, 0x1a03: 0x0329, 0x1a04: 0x0040, 0x1a05: 0x0339, + 0x1a06: 0x0751, 0x1a07: 0x00b9, 0x1a08: 0x0089, 0x1a09: 0x0341, 0x1a0a: 0x0349, 0x1a0b: 0x0391, + 0x1a0c: 0x00c1, 0x1a0d: 0x0109, 0x1a0e: 0x00c9, 0x1a0f: 0x04b1, 0x1a10: 0x0019, 0x1a11: 0x02e9, + 0x1a12: 0x03d9, 0x1a13: 0x02f1, 0x1a14: 0x02f9, 0x1a15: 0x03f1, 0x1a16: 0x0309, 0x1a17: 0x00a9, + 0x1a18: 0x0311, 0x1a19: 0x00b1, 0x1a1a: 0x0319, 0x1a1b: 0x0101, 0x1a1c: 0x0321, 0x1a1d: 0x0329, + 0x1a1e: 0x0051, 0x1a1f: 0x0339, 0x1a20: 0x0751, 0x1a21: 0x00b9, 0x1a22: 0x0089, 0x1a23: 0x0341, + 0x1a24: 0x0349, 0x1a25: 0x0391, 0x1a26: 0x00c1, 0x1a27: 0x0109, 0x1a28: 0x00c9, 0x1a29: 0x04b1, + 0x1a2a: 0x0019, 0x1a2b: 0x02e9, 0x1a2c: 0x03d9, 0x1a2d: 0x02f1, 0x1a2e: 0x02f9, 0x1a2f: 0x03f1, + 0x1a30: 0x0309, 0x1a31: 0x00a9, 0x1a32: 0x0311, 0x1a33: 0x00b1, 0x1a34: 0x0319, 0x1a35: 0x0101, + 0x1a36: 0x0321, 0x1a37: 0x0329, 0x1a38: 0x0051, 0x1a39: 0x0339, 0x1a3a: 0x0751, 0x1a3b: 0x00b9, + 0x1a3c: 0x0089, 0x1a3d: 0x0341, 0x1a3e: 0x0349, 0x1a3f: 0x0391, + // Block 0x69, offset 0x1a40 + 0x1a40: 0x00c1, 0x1a41: 0x0109, 0x1a42: 0x00c9, 0x1a43: 0x04b1, 0x1a44: 0x0019, 0x1a45: 0x02e9, + 0x1a46: 0x0040, 0x1a47: 0x02f1, 0x1a48: 0x02f9, 0x1a49: 0x03f1, 0x1a4a: 0x0309, 0x1a4b: 0x0040, + 0x1a4c: 0x0040, 0x1a4d: 0x00b1, 0x1a4e: 0x0319, 0x1a4f: 0x0101, 0x1a50: 0x0321, 0x1a51: 0x0329, + 0x1a52: 0x0051, 0x1a53: 0x0339, 0x1a54: 0x0751, 0x1a55: 0x0040, 0x1a56: 0x0089, 0x1a57: 0x0341, + 0x1a58: 0x0349, 0x1a59: 0x0391, 0x1a5a: 0x00c1, 0x1a5b: 0x0109, 0x1a5c: 0x00c9, 0x1a5d: 0x0040, + 0x1a5e: 0x0019, 0x1a5f: 0x02e9, 0x1a60: 0x03d9, 0x1a61: 0x02f1, 0x1a62: 0x02f9, 0x1a63: 0x03f1, + 0x1a64: 0x0309, 0x1a65: 0x00a9, 0x1a66: 0x0311, 0x1a67: 0x00b1, 0x1a68: 0x0319, 0x1a69: 0x0101, + 0x1a6a: 0x0321, 0x1a6b: 0x0329, 0x1a6c: 0x0051, 0x1a6d: 0x0339, 0x1a6e: 0x0751, 0x1a6f: 0x00b9, + 0x1a70: 0x0089, 0x1a71: 0x0341, 0x1a72: 0x0349, 0x1a73: 0x0391, 0x1a74: 0x00c1, 0x1a75: 0x0109, + 0x1a76: 0x00c9, 0x1a77: 0x04b1, 0x1a78: 0x0019, 0x1a79: 0x02e9, 0x1a7a: 0x0040, 0x1a7b: 0x02f1, + 0x1a7c: 0x02f9, 0x1a7d: 0x03f1, 0x1a7e: 0x0309, 0x1a7f: 0x0040, + // Block 0x6a, offset 0x1a80 + 0x1a80: 0x0311, 0x1a81: 0x00b1, 0x1a82: 0x0319, 0x1a83: 0x0101, 0x1a84: 0x0321, 0x1a85: 0x0040, + 0x1a86: 0x0051, 0x1a87: 0x0040, 0x1a88: 0x0040, 0x1a89: 0x0040, 0x1a8a: 0x0089, 0x1a8b: 0x0341, + 0x1a8c: 0x0349, 0x1a8d: 0x0391, 0x1a8e: 0x00c1, 0x1a8f: 0x0109, 0x1a90: 0x00c9, 0x1a91: 0x0040, + 0x1a92: 0x0019, 0x1a93: 0x02e9, 0x1a94: 0x03d9, 0x1a95: 0x02f1, 0x1a96: 0x02f9, 0x1a97: 0x03f1, + 0x1a98: 0x0309, 0x1a99: 0x00a9, 0x1a9a: 0x0311, 0x1a9b: 0x00b1, 0x1a9c: 0x0319, 0x1a9d: 0x0101, + 0x1a9e: 0x0321, 0x1a9f: 0x0329, 0x1aa0: 0x0051, 0x1aa1: 0x0339, 0x1aa2: 0x0751, 0x1aa3: 0x00b9, + 0x1aa4: 0x0089, 0x1aa5: 0x0341, 0x1aa6: 0x0349, 0x1aa7: 0x0391, 0x1aa8: 0x00c1, 0x1aa9: 0x0109, + 0x1aaa: 0x00c9, 0x1aab: 0x04b1, 0x1aac: 0x0019, 0x1aad: 0x02e9, 0x1aae: 0x03d9, 0x1aaf: 0x02f1, + 0x1ab0: 0x02f9, 0x1ab1: 0x03f1, 0x1ab2: 0x0309, 0x1ab3: 0x00a9, 0x1ab4: 0x0311, 0x1ab5: 0x00b1, + 0x1ab6: 0x0319, 0x1ab7: 0x0101, 0x1ab8: 0x0321, 0x1ab9: 0x0329, 0x1aba: 0x0051, 0x1abb: 0x0339, + 0x1abc: 0x0751, 0x1abd: 0x00b9, 0x1abe: 0x0089, 0x1abf: 0x0341, + // Block 0x6b, offset 0x1ac0 + 0x1ac0: 0x0349, 0x1ac1: 0x0391, 0x1ac2: 0x00c1, 0x1ac3: 0x0109, 0x1ac4: 0x00c9, 0x1ac5: 0x04b1, + 0x1ac6: 0x0019, 0x1ac7: 0x02e9, 0x1ac8: 0x03d9, 0x1ac9: 0x02f1, 0x1aca: 0x02f9, 0x1acb: 0x03f1, + 0x1acc: 0x0309, 0x1acd: 0x00a9, 0x1ace: 0x0311, 0x1acf: 0x00b1, 0x1ad0: 0x0319, 0x1ad1: 0x0101, + 0x1ad2: 0x0321, 0x1ad3: 0x0329, 0x1ad4: 0x0051, 0x1ad5: 0x0339, 0x1ad6: 0x0751, 0x1ad7: 0x00b9, + 0x1ad8: 0x0089, 0x1ad9: 0x0341, 0x1ada: 0x0349, 0x1adb: 0x0391, 0x1adc: 0x00c1, 0x1add: 0x0109, + 0x1ade: 0x00c9, 0x1adf: 0x04b1, 0x1ae0: 0x0019, 0x1ae1: 0x02e9, 0x1ae2: 0x03d9, 0x1ae3: 0x02f1, + 0x1ae4: 0x02f9, 0x1ae5: 0x03f1, 0x1ae6: 0x0309, 0x1ae7: 0x00a9, 0x1ae8: 0x0311, 0x1ae9: 0x00b1, + 0x1aea: 0x0319, 0x1aeb: 0x0101, 0x1aec: 0x0321, 0x1aed: 0x0329, 0x1aee: 0x0051, 0x1aef: 0x0339, + 0x1af0: 0x0751, 0x1af1: 0x00b9, 0x1af2: 0x0089, 0x1af3: 0x0341, 0x1af4: 0x0349, 0x1af5: 0x0391, + 0x1af6: 0x00c1, 0x1af7: 0x0109, 0x1af8: 0x00c9, 0x1af9: 0x04b1, 0x1afa: 0x0019, 0x1afb: 0x02e9, + 0x1afc: 0x03d9, 0x1afd: 0x02f1, 0x1afe: 0x02f9, 0x1aff: 0x03f1, + // Block 0x6c, offset 0x1b00 + 0x1b00: 0x0309, 0x1b01: 0x00a9, 0x1b02: 0x0311, 0x1b03: 0x00b1, 0x1b04: 0x0319, 0x1b05: 0x0101, + 0x1b06: 0x0321, 0x1b07: 0x0329, 0x1b08: 0x0051, 0x1b09: 0x0339, 0x1b0a: 0x0751, 0x1b0b: 0x00b9, + 0x1b0c: 0x0089, 0x1b0d: 0x0341, 0x1b0e: 0x0349, 0x1b0f: 0x0391, 0x1b10: 0x00c1, 0x1b11: 0x0109, + 0x1b12: 0x00c9, 0x1b13: 0x04b1, 0x1b14: 0x0019, 0x1b15: 0x02e9, 0x1b16: 0x03d9, 0x1b17: 0x02f1, + 0x1b18: 0x02f9, 0x1b19: 0x03f1, 0x1b1a: 0x0309, 0x1b1b: 0x00a9, 0x1b1c: 0x0311, 0x1b1d: 0x00b1, + 0x1b1e: 0x0319, 0x1b1f: 0x0101, 0x1b20: 0x0321, 0x1b21: 0x0329, 0x1b22: 0x0051, 0x1b23: 0x0339, + 0x1b24: 0x0751, 0x1b25: 0x00b9, 0x1b26: 0x0089, 0x1b27: 0x0341, 0x1b28: 0x0349, 0x1b29: 0x0391, + 0x1b2a: 0x00c1, 0x1b2b: 0x0109, 0x1b2c: 0x00c9, 0x1b2d: 0x04b1, 0x1b2e: 0x0019, 0x1b2f: 0x02e9, + 0x1b30: 0x03d9, 0x1b31: 0x02f1, 0x1b32: 0x02f9, 0x1b33: 0x03f1, 0x1b34: 0x0309, 0x1b35: 0x00a9, + 0x1b36: 0x0311, 0x1b37: 0x00b1, 0x1b38: 0x0319, 0x1b39: 0x0101, 0x1b3a: 0x0321, 0x1b3b: 0x0329, + 0x1b3c: 0x0051, 0x1b3d: 0x0339, 0x1b3e: 0x0751, 0x1b3f: 0x00b9, + // Block 0x6d, offset 0x1b40 + 0x1b40: 0x0089, 0x1b41: 0x0341, 0x1b42: 0x0349, 0x1b43: 0x0391, 0x1b44: 0x00c1, 0x1b45: 0x0109, + 0x1b46: 0x00c9, 0x1b47: 0x04b1, 0x1b48: 0x0019, 0x1b49: 0x02e9, 0x1b4a: 0x03d9, 0x1b4b: 0x02f1, + 0x1b4c: 0x02f9, 0x1b4d: 0x03f1, 0x1b4e: 0x0309, 0x1b4f: 0x00a9, 0x1b50: 0x0311, 0x1b51: 0x00b1, + 0x1b52: 0x0319, 0x1b53: 0x0101, 0x1b54: 0x0321, 0x1b55: 0x0329, 0x1b56: 0x0051, 0x1b57: 0x0339, + 0x1b58: 0x0751, 0x1b59: 0x00b9, 0x1b5a: 0x0089, 0x1b5b: 0x0341, 0x1b5c: 0x0349, 0x1b5d: 0x0391, + 0x1b5e: 0x00c1, 0x1b5f: 0x0109, 0x1b60: 0x00c9, 0x1b61: 0x04b1, 0x1b62: 0x0019, 0x1b63: 0x02e9, + 0x1b64: 0x03d9, 0x1b65: 0x02f1, 0x1b66: 0x02f9, 0x1b67: 0x03f1, 0x1b68: 0x0309, 0x1b69: 0x00a9, + 0x1b6a: 0x0311, 0x1b6b: 0x00b1, 0x1b6c: 0x0319, 0x1b6d: 0x0101, 0x1b6e: 0x0321, 0x1b6f: 0x0329, + 0x1b70: 0x0051, 0x1b71: 0x0339, 0x1b72: 0x0751, 0x1b73: 0x00b9, 0x1b74: 0x0089, 0x1b75: 0x0341, + 0x1b76: 0x0349, 0x1b77: 0x0391, 0x1b78: 0x00c1, 0x1b79: 0x0109, 0x1b7a: 0x00c9, 0x1b7b: 0x04b1, + 0x1b7c: 0x0019, 0x1b7d: 0x02e9, 0x1b7e: 0x03d9, 0x1b7f: 0x02f1, + // Block 0x6e, offset 0x1b80 + 0x1b80: 0x02f9, 0x1b81: 0x03f1, 0x1b82: 0x0309, 0x1b83: 0x00a9, 0x1b84: 0x0311, 0x1b85: 0x00b1, + 0x1b86: 0x0319, 0x1b87: 0x0101, 0x1b88: 0x0321, 0x1b89: 0x0329, 0x1b8a: 0x0051, 0x1b8b: 0x0339, + 0x1b8c: 0x0751, 0x1b8d: 0x00b9, 0x1b8e: 0x0089, 0x1b8f: 0x0341, 0x1b90: 0x0349, 0x1b91: 0x0391, + 0x1b92: 0x00c1, 0x1b93: 0x0109, 0x1b94: 0x00c9, 0x1b95: 0x04b1, 0x1b96: 0x0019, 0x1b97: 0x02e9, + 0x1b98: 0x03d9, 0x1b99: 0x02f1, 0x1b9a: 0x02f9, 0x1b9b: 0x03f1, 0x1b9c: 0x0309, 0x1b9d: 0x00a9, + 0x1b9e: 0x0311, 0x1b9f: 0x00b1, 0x1ba0: 0x0319, 0x1ba1: 0x0101, 0x1ba2: 0x0321, 0x1ba3: 0x0329, + 0x1ba4: 0x0051, 0x1ba5: 0x0339, 0x1ba6: 0x0751, 0x1ba7: 0x00b9, 0x1ba8: 0x0089, 0x1ba9: 0x0341, + 0x1baa: 0x0349, 0x1bab: 0x0391, 0x1bac: 0x00c1, 0x1bad: 0x0109, 0x1bae: 0x00c9, 0x1baf: 0x04b1, + 0x1bb0: 0x0019, 0x1bb1: 0x02e9, 0x1bb2: 0x03d9, 0x1bb3: 0x02f1, 0x1bb4: 0x02f9, 0x1bb5: 0x03f1, + 0x1bb6: 0x0309, 0x1bb7: 0x00a9, 0x1bb8: 0x0311, 0x1bb9: 0x00b1, 0x1bba: 0x0319, 0x1bbb: 0x0101, + 0x1bbc: 0x0321, 0x1bbd: 0x0329, 0x1bbe: 0x0051, 0x1bbf: 0x0339, + // Block 0x6f, offset 0x1bc0 + 0x1bc0: 0x0751, 0x1bc1: 0x00b9, 0x1bc2: 0x0089, 0x1bc3: 0x0341, 0x1bc4: 0x0349, 0x1bc5: 0x0391, + 0x1bc6: 0x00c1, 0x1bc7: 0x0109, 0x1bc8: 0x00c9, 0x1bc9: 0x04b1, 0x1bca: 0x0019, 0x1bcb: 0x02e9, + 0x1bcc: 0x03d9, 0x1bcd: 0x02f1, 0x1bce: 0x02f9, 0x1bcf: 0x03f1, 0x1bd0: 0x0309, 0x1bd1: 0x00a9, + 0x1bd2: 0x0311, 0x1bd3: 0x00b1, 0x1bd4: 0x0319, 0x1bd5: 0x0101, 0x1bd6: 0x0321, 0x1bd7: 0x0329, + 0x1bd8: 0x0051, 0x1bd9: 0x0339, 0x1bda: 0x0751, 0x1bdb: 0x00b9, 0x1bdc: 0x0089, 0x1bdd: 0x0341, + 0x1bde: 0x0349, 0x1bdf: 0x0391, 0x1be0: 0x00c1, 0x1be1: 0x0109, 0x1be2: 0x00c9, 0x1be3: 0x04b1, + 0x1be4: 0x23e1, 0x1be5: 0x23e9, 0x1be6: 0x0040, 0x1be7: 0x0040, 0x1be8: 0x23f1, 0x1be9: 0x0399, + 0x1bea: 0x03a1, 0x1beb: 0x03a9, 0x1bec: 0x23f9, 0x1bed: 0x2401, 0x1bee: 0x2409, 0x1bef: 0x04d1, + 0x1bf0: 0x05f9, 0x1bf1: 0x2411, 0x1bf2: 0x2419, 0x1bf3: 0x2421, 0x1bf4: 0x2429, 0x1bf5: 0x2431, + 0x1bf6: 0x2439, 0x1bf7: 0x0799, 0x1bf8: 0x03c1, 0x1bf9: 0x04d1, 0x1bfa: 0x2441, 0x1bfb: 0x2449, + 0x1bfc: 0x2451, 0x1bfd: 0x03b1, 0x1bfe: 0x03b9, 0x1bff: 0x2459, + // Block 0x70, offset 0x1c00 + 0x1c00: 0x0769, 0x1c01: 0x2461, 0x1c02: 0x23f1, 0x1c03: 0x0399, 0x1c04: 0x03a1, 0x1c05: 0x03a9, + 0x1c06: 0x23f9, 0x1c07: 0x2401, 0x1c08: 0x2409, 0x1c09: 0x04d1, 0x1c0a: 0x05f9, 0x1c0b: 0x2411, + 0x1c0c: 0x2419, 0x1c0d: 0x2421, 0x1c0e: 0x2429, 0x1c0f: 0x2431, 0x1c10: 0x2439, 0x1c11: 0x0799, + 0x1c12: 0x03c1, 0x1c13: 0x2441, 0x1c14: 0x2441, 0x1c15: 0x2449, 0x1c16: 0x2451, 0x1c17: 0x03b1, + 0x1c18: 0x03b9, 0x1c19: 0x2459, 0x1c1a: 0x0769, 0x1c1b: 0x2469, 0x1c1c: 0x23f9, 0x1c1d: 0x04d1, + 0x1c1e: 0x2411, 0x1c1f: 0x03b1, 0x1c20: 0x03c1, 0x1c21: 0x0799, 0x1c22: 0x23f1, 0x1c23: 0x0399, + 0x1c24: 0x03a1, 0x1c25: 0x03a9, 0x1c26: 0x23f9, 0x1c27: 0x2401, 0x1c28: 0x2409, 0x1c29: 0x04d1, + 0x1c2a: 0x05f9, 0x1c2b: 0x2411, 0x1c2c: 0x2419, 0x1c2d: 0x2421, 0x1c2e: 0x2429, 0x1c2f: 0x2431, + 0x1c30: 0x2439, 0x1c31: 0x0799, 0x1c32: 0x03c1, 0x1c33: 0x04d1, 0x1c34: 0x2441, 0x1c35: 0x2449, + 0x1c36: 0x2451, 0x1c37: 0x03b1, 0x1c38: 0x03b9, 0x1c39: 0x2459, 0x1c3a: 0x0769, 0x1c3b: 0x2461, + 0x1c3c: 0x23f1, 0x1c3d: 0x0399, 0x1c3e: 0x03a1, 0x1c3f: 0x03a9, + // Block 0x71, offset 0x1c40 + 0x1c40: 0x23f9, 0x1c41: 0x2401, 0x1c42: 0x2409, 0x1c43: 0x04d1, 0x1c44: 0x05f9, 0x1c45: 0x2411, + 0x1c46: 0x2419, 0x1c47: 0x2421, 0x1c48: 0x2429, 0x1c49: 0x2431, 0x1c4a: 0x2439, 0x1c4b: 0x0799, + 0x1c4c: 0x03c1, 0x1c4d: 0x2441, 0x1c4e: 0x2441, 0x1c4f: 0x2449, 0x1c50: 0x2451, 0x1c51: 0x03b1, + 0x1c52: 0x03b9, 0x1c53: 0x2459, 0x1c54: 0x0769, 0x1c55: 0x2469, 0x1c56: 0x23f9, 0x1c57: 0x04d1, + 0x1c58: 0x2411, 0x1c59: 0x03b1, 0x1c5a: 0x03c1, 0x1c5b: 0x0799, 0x1c5c: 0x23f1, 0x1c5d: 0x0399, + 0x1c5e: 0x03a1, 0x1c5f: 0x03a9, 0x1c60: 0x23f9, 0x1c61: 0x2401, 0x1c62: 0x2409, 0x1c63: 0x04d1, + 0x1c64: 0x05f9, 0x1c65: 0x2411, 0x1c66: 0x2419, 0x1c67: 0x2421, 0x1c68: 0x2429, 0x1c69: 0x2431, + 0x1c6a: 0x2439, 0x1c6b: 0x0799, 0x1c6c: 0x03c1, 0x1c6d: 0x04d1, 0x1c6e: 0x2441, 0x1c6f: 0x2449, + 0x1c70: 0x2451, 0x1c71: 0x03b1, 0x1c72: 0x03b9, 0x1c73: 0x2459, 0x1c74: 0x0769, 0x1c75: 0x2461, + 0x1c76: 0x23f1, 0x1c77: 0x0399, 0x1c78: 0x03a1, 0x1c79: 0x03a9, 0x1c7a: 0x23f9, 0x1c7b: 0x2401, + 0x1c7c: 0x2409, 0x1c7d: 0x04d1, 0x1c7e: 0x05f9, 0x1c7f: 0x2411, + // Block 0x72, offset 0x1c80 + 0x1c80: 0x2419, 0x1c81: 0x2421, 0x1c82: 0x2429, 0x1c83: 0x2431, 0x1c84: 0x2439, 0x1c85: 0x0799, + 0x1c86: 0x03c1, 0x1c87: 0x2441, 0x1c88: 0x2441, 0x1c89: 0x2449, 0x1c8a: 0x2451, 0x1c8b: 0x03b1, + 0x1c8c: 0x03b9, 0x1c8d: 0x2459, 0x1c8e: 0x0769, 0x1c8f: 0x2469, 0x1c90: 0x23f9, 0x1c91: 0x04d1, + 0x1c92: 0x2411, 0x1c93: 0x03b1, 0x1c94: 0x03c1, 0x1c95: 0x0799, 0x1c96: 0x23f1, 0x1c97: 0x0399, + 0x1c98: 0x03a1, 0x1c99: 0x03a9, 0x1c9a: 0x23f9, 0x1c9b: 0x2401, 0x1c9c: 0x2409, 0x1c9d: 0x04d1, + 0x1c9e: 0x05f9, 0x1c9f: 0x2411, 0x1ca0: 0x2419, 0x1ca1: 0x2421, 0x1ca2: 0x2429, 0x1ca3: 0x2431, + 0x1ca4: 0x2439, 0x1ca5: 0x0799, 0x1ca6: 0x03c1, 0x1ca7: 0x04d1, 0x1ca8: 0x2441, 0x1ca9: 0x2449, + 0x1caa: 0x2451, 0x1cab: 0x03b1, 0x1cac: 0x03b9, 0x1cad: 0x2459, 0x1cae: 0x0769, 0x1caf: 0x2461, + 0x1cb0: 0x23f1, 0x1cb1: 0x0399, 0x1cb2: 0x03a1, 0x1cb3: 0x03a9, 0x1cb4: 0x23f9, 0x1cb5: 0x2401, + 0x1cb6: 0x2409, 0x1cb7: 0x04d1, 0x1cb8: 0x05f9, 0x1cb9: 0x2411, 0x1cba: 0x2419, 0x1cbb: 0x2421, + 0x1cbc: 0x2429, 0x1cbd: 0x2431, 0x1cbe: 0x2439, 0x1cbf: 0x0799, + // Block 0x73, offset 0x1cc0 + 0x1cc0: 0x03c1, 0x1cc1: 0x2441, 0x1cc2: 0x2441, 0x1cc3: 0x2449, 0x1cc4: 0x2451, 0x1cc5: 0x03b1, + 0x1cc6: 0x03b9, 0x1cc7: 0x2459, 0x1cc8: 0x0769, 0x1cc9: 0x2469, 0x1cca: 0x23f9, 0x1ccb: 0x04d1, + 0x1ccc: 0x2411, 0x1ccd: 0x03b1, 0x1cce: 0x03c1, 0x1ccf: 0x0799, 0x1cd0: 0x23f1, 0x1cd1: 0x0399, + 0x1cd2: 0x03a1, 0x1cd3: 0x03a9, 0x1cd4: 0x23f9, 0x1cd5: 0x2401, 0x1cd6: 0x2409, 0x1cd7: 0x04d1, + 0x1cd8: 0x05f9, 0x1cd9: 0x2411, 0x1cda: 0x2419, 0x1cdb: 0x2421, 0x1cdc: 0x2429, 0x1cdd: 0x2431, + 0x1cde: 0x2439, 0x1cdf: 0x0799, 0x1ce0: 0x03c1, 0x1ce1: 0x04d1, 0x1ce2: 0x2441, 0x1ce3: 0x2449, + 0x1ce4: 0x2451, 0x1ce5: 0x03b1, 0x1ce6: 0x03b9, 0x1ce7: 0x2459, 0x1ce8: 0x0769, 0x1ce9: 0x2461, + 0x1cea: 0x23f1, 0x1ceb: 0x0399, 0x1cec: 0x03a1, 0x1ced: 0x03a9, 0x1cee: 0x23f9, 0x1cef: 0x2401, + 0x1cf0: 0x2409, 0x1cf1: 0x04d1, 0x1cf2: 0x05f9, 0x1cf3: 0x2411, 0x1cf4: 0x2419, 0x1cf5: 0x2421, + 0x1cf6: 0x2429, 0x1cf7: 0x2431, 0x1cf8: 0x2439, 0x1cf9: 0x0799, 0x1cfa: 0x03c1, 0x1cfb: 0x2441, + 0x1cfc: 0x2441, 0x1cfd: 0x2449, 0x1cfe: 0x2451, 0x1cff: 0x03b1, + // Block 0x74, offset 0x1d00 + 0x1d00: 0x03b9, 0x1d01: 0x2459, 0x1d02: 0x0769, 0x1d03: 0x2469, 0x1d04: 0x23f9, 0x1d05: 0x04d1, + 0x1d06: 0x2411, 0x1d07: 0x03b1, 0x1d08: 0x03c1, 0x1d09: 0x0799, 0x1d0a: 0x2471, 0x1d0b: 0x2471, + 0x1d0c: 0x0040, 0x1d0d: 0x0040, 0x1d0e: 0x06e1, 0x1d0f: 0x0049, 0x1d10: 0x0029, 0x1d11: 0x0031, + 0x1d12: 0x06e9, 0x1d13: 0x06f1, 0x1d14: 0x06f9, 0x1d15: 0x0701, 0x1d16: 0x0709, 0x1d17: 0x0711, + 0x1d18: 0x06e1, 0x1d19: 0x0049, 0x1d1a: 0x0029, 0x1d1b: 0x0031, 0x1d1c: 0x06e9, 0x1d1d: 0x06f1, + 0x1d1e: 0x06f9, 0x1d1f: 0x0701, 0x1d20: 0x0709, 0x1d21: 0x0711, 0x1d22: 0x06e1, 0x1d23: 0x0049, + 0x1d24: 0x0029, 0x1d25: 0x0031, 0x1d26: 0x06e9, 0x1d27: 0x06f1, 0x1d28: 0x06f9, 0x1d29: 0x0701, + 0x1d2a: 0x0709, 0x1d2b: 0x0711, 0x1d2c: 0x06e1, 0x1d2d: 0x0049, 0x1d2e: 0x0029, 0x1d2f: 0x0031, + 0x1d30: 0x06e9, 0x1d31: 0x06f1, 0x1d32: 0x06f9, 0x1d33: 0x0701, 0x1d34: 0x0709, 0x1d35: 0x0711, + 0x1d36: 0x06e1, 0x1d37: 0x0049, 0x1d38: 0x0029, 0x1d39: 0x0031, 0x1d3a: 0x06e9, 0x1d3b: 0x06f1, + 0x1d3c: 0x06f9, 0x1d3d: 0x0701, 0x1d3e: 0x0709, 0x1d3f: 0x0711, + // Block 0x75, offset 0x1d40 + 0x1d40: 0x3308, 0x1d41: 0x3308, 0x1d42: 0x3308, 0x1d43: 0x3308, 0x1d44: 0x3308, 0x1d45: 0x3308, + 0x1d46: 0x3308, 0x1d47: 0x0040, 0x1d48: 0x3308, 0x1d49: 0x3308, 0x1d4a: 0x3308, 0x1d4b: 0x3308, + 0x1d4c: 0x3308, 0x1d4d: 0x3308, 0x1d4e: 0x3308, 0x1d4f: 0x3308, 0x1d50: 0x3308, 0x1d51: 0x3308, + 0x1d52: 0x3308, 0x1d53: 0x3308, 0x1d54: 0x3308, 0x1d55: 0x3308, 0x1d56: 0x3308, 0x1d57: 0x3308, + 0x1d58: 0x3308, 0x1d59: 0x0040, 0x1d5a: 0x0040, 0x1d5b: 0x3308, 0x1d5c: 0x3308, 0x1d5d: 0x3308, + 0x1d5e: 0x3308, 0x1d5f: 0x3308, 0x1d60: 0x3308, 0x1d61: 0x3308, 0x1d62: 0x0040, 0x1d63: 0x3308, + 0x1d64: 0x3308, 0x1d65: 0x0040, 0x1d66: 0x3308, 0x1d67: 0x3308, 0x1d68: 0x3308, 0x1d69: 0x3308, + 0x1d6a: 0x3308, 0x1d6b: 0x0040, 0x1d6c: 0x0040, 0x1d6d: 0x0040, 0x1d6e: 0x0040, 0x1d6f: 0x0040, + 0x1d70: 0x2479, 0x1d71: 0x2481, 0x1d72: 0x02a9, 0x1d73: 0x2489, 0x1d74: 0x02b1, 0x1d75: 0x2491, + 0x1d76: 0x2499, 0x1d77: 0x24a1, 0x1d78: 0x24a9, 0x1d79: 0x24b1, 0x1d7a: 0x24b9, 0x1d7b: 0x24c1, + 0x1d7c: 0x02b9, 0x1d7d: 0x24c9, 0x1d7e: 0x24d1, 0x1d7f: 0x02c1, + // Block 0x76, offset 0x1d80 + 0x1d80: 0x02c9, 0x1d81: 0x24d9, 0x1d82: 0x24e1, 0x1d83: 0x24e9, 0x1d84: 0x24f1, 0x1d85: 0x24f9, + 0x1d86: 0x2501, 0x1d87: 0x2509, 0x1d88: 0x2511, 0x1d89: 0x2519, 0x1d8a: 0x2521, 0x1d8b: 0x2529, + 0x1d8c: 0x2531, 0x1d8d: 0x2539, 0x1d8e: 0x2541, 0x1d8f: 0x2549, 0x1d90: 0x2551, 0x1d91: 0x2479, + 0x1d92: 0x2481, 0x1d93: 0x02a9, 0x1d94: 0x2489, 0x1d95: 0x02b1, 0x1d96: 0x2491, 0x1d97: 0x2499, + 0x1d98: 0x24a1, 0x1d99: 0x24a9, 0x1d9a: 0x24b1, 0x1d9b: 0x24b9, 0x1d9c: 0x02b9, 0x1d9d: 0x24c9, + 0x1d9e: 0x02c1, 0x1d9f: 0x24d9, 0x1da0: 0x24e1, 0x1da1: 0x24e9, 0x1da2: 0x24f1, 0x1da3: 0x24f9, + 0x1da4: 0x2501, 0x1da5: 0x02d1, 0x1da6: 0x2509, 0x1da7: 0x2559, 0x1da8: 0x2531, 0x1da9: 0x2561, + 0x1daa: 0x2569, 0x1dab: 0x2571, 0x1dac: 0x2579, 0x1dad: 0x2581, 0x1dae: 0x0040, 0x1daf: 0x0040, + 0x1db0: 0x0040, 0x1db1: 0x0040, 0x1db2: 0x0040, 0x1db3: 0x0040, 0x1db4: 0x0040, 0x1db5: 0x0040, + 0x1db6: 0x0040, 0x1db7: 0x0040, 0x1db8: 0x0040, 0x1db9: 0x0040, 0x1dba: 0x0040, 0x1dbb: 0x0040, + 0x1dbc: 0x0040, 0x1dbd: 0x0040, 0x1dbe: 0x0040, 0x1dbf: 0x0040, + // Block 0x77, offset 0x1dc0 + 0x1dc0: 0xe115, 0x1dc1: 0xe115, 0x1dc2: 0xe135, 0x1dc3: 0xe135, 0x1dc4: 0xe115, 0x1dc5: 0xe115, + 0x1dc6: 0xe175, 0x1dc7: 0xe175, 0x1dc8: 0xe115, 0x1dc9: 0xe115, 0x1dca: 0xe135, 0x1dcb: 0xe135, + 0x1dcc: 0xe115, 0x1dcd: 0xe115, 0x1dce: 0xe1f5, 0x1dcf: 0xe1f5, 0x1dd0: 0xe115, 0x1dd1: 0xe115, + 0x1dd2: 0xe135, 0x1dd3: 0xe135, 0x1dd4: 0xe115, 0x1dd5: 0xe115, 0x1dd6: 0xe175, 0x1dd7: 0xe175, + 0x1dd8: 0xe115, 0x1dd9: 0xe115, 0x1dda: 0xe135, 0x1ddb: 0xe135, 0x1ddc: 0xe115, 0x1ddd: 0xe115, + 0x1dde: 0x8ca5, 0x1ddf: 0x8ca5, 0x1de0: 0x04b5, 0x1de1: 0x04b5, 0x1de2: 0x0a08, 0x1de3: 0x0a08, + 0x1de4: 0x0a08, 0x1de5: 0x0a08, 0x1de6: 0x0a08, 0x1de7: 0x0a08, 0x1de8: 0x0a08, 0x1de9: 0x0a08, + 0x1dea: 0x0a08, 0x1deb: 0x0a08, 0x1dec: 0x0a08, 0x1ded: 0x0a08, 0x1dee: 0x0a08, 0x1def: 0x0a08, + 0x1df0: 0x0a08, 0x1df1: 0x0a08, 0x1df2: 0x0a08, 0x1df3: 0x0a08, 0x1df4: 0x0a08, 0x1df5: 0x0a08, + 0x1df6: 0x0a08, 0x1df7: 0x0a08, 0x1df8: 0x0a08, 0x1df9: 0x0a08, 0x1dfa: 0x0a08, 0x1dfb: 0x0a08, + 0x1dfc: 0x0a08, 0x1dfd: 0x0a08, 0x1dfe: 0x0a08, 0x1dff: 0x0a08, + // Block 0x78, offset 0x1e00 + 0x1e00: 0x20b1, 0x1e01: 0x20b9, 0x1e02: 0x20d9, 0x1e03: 0x20f1, 0x1e04: 0x0040, 0x1e05: 0x2189, + 0x1e06: 0x2109, 0x1e07: 0x20e1, 0x1e08: 0x2131, 0x1e09: 0x2191, 0x1e0a: 0x2161, 0x1e0b: 0x2169, + 0x1e0c: 0x2171, 0x1e0d: 0x2179, 0x1e0e: 0x2111, 0x1e0f: 0x2141, 0x1e10: 0x2151, 0x1e11: 0x2121, + 0x1e12: 0x2159, 0x1e13: 0x2101, 0x1e14: 0x2119, 0x1e15: 0x20c9, 0x1e16: 0x20d1, 0x1e17: 0x20e9, + 0x1e18: 0x20f9, 0x1e19: 0x2129, 0x1e1a: 0x2139, 0x1e1b: 0x2149, 0x1e1c: 0x2589, 0x1e1d: 0x1689, + 0x1e1e: 0x2591, 0x1e1f: 0x2599, 0x1e20: 0x0040, 0x1e21: 0x20b9, 0x1e22: 0x20d9, 0x1e23: 0x0040, + 0x1e24: 0x2181, 0x1e25: 0x0040, 0x1e26: 0x0040, 0x1e27: 0x20e1, 0x1e28: 0x0040, 0x1e29: 0x2191, + 0x1e2a: 0x2161, 0x1e2b: 0x2169, 0x1e2c: 0x2171, 0x1e2d: 0x2179, 0x1e2e: 0x2111, 0x1e2f: 0x2141, + 0x1e30: 0x2151, 0x1e31: 0x2121, 0x1e32: 0x2159, 0x1e33: 0x0040, 0x1e34: 0x2119, 0x1e35: 0x20c9, + 0x1e36: 0x20d1, 0x1e37: 0x20e9, 0x1e38: 0x0040, 0x1e39: 0x2129, 0x1e3a: 0x0040, 0x1e3b: 0x2149, + 0x1e3c: 0x0040, 0x1e3d: 0x0040, 0x1e3e: 0x0040, 0x1e3f: 0x0040, + // Block 0x79, offset 0x1e40 + 0x1e40: 0x0040, 0x1e41: 0x0040, 0x1e42: 0x20d9, 0x1e43: 0x0040, 0x1e44: 0x0040, 0x1e45: 0x0040, + 0x1e46: 0x0040, 0x1e47: 0x20e1, 0x1e48: 0x0040, 0x1e49: 0x2191, 0x1e4a: 0x0040, 0x1e4b: 0x2169, + 0x1e4c: 0x0040, 0x1e4d: 0x2179, 0x1e4e: 0x2111, 0x1e4f: 0x2141, 0x1e50: 0x0040, 0x1e51: 0x2121, + 0x1e52: 0x2159, 0x1e53: 0x0040, 0x1e54: 0x2119, 0x1e55: 0x0040, 0x1e56: 0x0040, 0x1e57: 0x20e9, + 0x1e58: 0x0040, 0x1e59: 0x2129, 0x1e5a: 0x0040, 0x1e5b: 0x2149, 0x1e5c: 0x0040, 0x1e5d: 0x1689, + 0x1e5e: 0x0040, 0x1e5f: 0x2599, 0x1e60: 0x0040, 0x1e61: 0x20b9, 0x1e62: 0x20d9, 0x1e63: 0x0040, + 0x1e64: 0x2181, 0x1e65: 0x0040, 0x1e66: 0x0040, 0x1e67: 0x20e1, 0x1e68: 0x2131, 0x1e69: 0x2191, + 0x1e6a: 0x2161, 0x1e6b: 0x0040, 0x1e6c: 0x2171, 0x1e6d: 0x2179, 0x1e6e: 0x2111, 0x1e6f: 0x2141, + 0x1e70: 0x2151, 0x1e71: 0x2121, 0x1e72: 0x2159, 0x1e73: 0x0040, 0x1e74: 0x2119, 0x1e75: 0x20c9, + 0x1e76: 0x20d1, 0x1e77: 0x20e9, 0x1e78: 0x0040, 0x1e79: 0x2129, 0x1e7a: 0x2139, 0x1e7b: 0x2149, + 0x1e7c: 0x2589, 0x1e7d: 0x0040, 0x1e7e: 0x2591, 0x1e7f: 0x0040, + // Block 0x7a, offset 0x1e80 + 0x1e80: 0x20b1, 0x1e81: 0x20b9, 0x1e82: 0x20d9, 0x1e83: 0x20f1, 0x1e84: 0x2181, 0x1e85: 0x2189, + 0x1e86: 0x2109, 0x1e87: 0x20e1, 0x1e88: 0x2131, 0x1e89: 0x2191, 0x1e8a: 0x0040, 0x1e8b: 0x2169, + 0x1e8c: 0x2171, 0x1e8d: 0x2179, 0x1e8e: 0x2111, 0x1e8f: 0x2141, 0x1e90: 0x2151, 0x1e91: 0x2121, + 0x1e92: 0x2159, 0x1e93: 0x2101, 0x1e94: 0x2119, 0x1e95: 0x20c9, 0x1e96: 0x20d1, 0x1e97: 0x20e9, + 0x1e98: 0x20f9, 0x1e99: 0x2129, 0x1e9a: 0x2139, 0x1e9b: 0x2149, 0x1e9c: 0x0040, 0x1e9d: 0x0040, + 0x1e9e: 0x0040, 0x1e9f: 0x0040, 0x1ea0: 0x0040, 0x1ea1: 0x20b9, 0x1ea2: 0x20d9, 0x1ea3: 0x20f1, + 0x1ea4: 0x0040, 0x1ea5: 0x2189, 0x1ea6: 0x2109, 0x1ea7: 0x20e1, 0x1ea8: 0x2131, 0x1ea9: 0x2191, + 0x1eaa: 0x0040, 0x1eab: 0x2169, 0x1eac: 0x2171, 0x1ead: 0x2179, 0x1eae: 0x2111, 0x1eaf: 0x2141, + 0x1eb0: 0x2151, 0x1eb1: 0x2121, 0x1eb2: 0x2159, 0x1eb3: 0x2101, 0x1eb4: 0x2119, 0x1eb5: 0x20c9, + 0x1eb6: 0x20d1, 0x1eb7: 0x20e9, 0x1eb8: 0x20f9, 0x1eb9: 0x2129, 0x1eba: 0x2139, 0x1ebb: 0x2149, + 0x1ebc: 0x0040, 0x1ebd: 0x0040, 0x1ebe: 0x0040, 0x1ebf: 0x0040, + // Block 0x7b, offset 0x1ec0 + 0x1ec0: 0x0040, 0x1ec1: 0x25a2, 0x1ec2: 0x25aa, 0x1ec3: 0x25b2, 0x1ec4: 0x25ba, 0x1ec5: 0x25c2, + 0x1ec6: 0x25ca, 0x1ec7: 0x25d2, 0x1ec8: 0x25da, 0x1ec9: 0x25e2, 0x1eca: 0x25ea, 0x1ecb: 0x0018, + 0x1ecc: 0x0018, 0x1ecd: 0x0018, 0x1ece: 0x0018, 0x1ecf: 0x0018, 0x1ed0: 0x25f2, 0x1ed1: 0x25fa, + 0x1ed2: 0x2602, 0x1ed3: 0x260a, 0x1ed4: 0x2612, 0x1ed5: 0x261a, 0x1ed6: 0x2622, 0x1ed7: 0x262a, + 0x1ed8: 0x2632, 0x1ed9: 0x263a, 0x1eda: 0x2642, 0x1edb: 0x264a, 0x1edc: 0x2652, 0x1edd: 0x265a, + 0x1ede: 0x2662, 0x1edf: 0x266a, 0x1ee0: 0x2672, 0x1ee1: 0x267a, 0x1ee2: 0x2682, 0x1ee3: 0x268a, + 0x1ee4: 0x2692, 0x1ee5: 0x269a, 0x1ee6: 0x26a2, 0x1ee7: 0x26aa, 0x1ee8: 0x26b2, 0x1ee9: 0x26ba, + 0x1eea: 0x26c1, 0x1eeb: 0x03d9, 0x1eec: 0x00b9, 0x1eed: 0x1239, 0x1eee: 0x26c9, 0x1eef: 0x0018, + 0x1ef0: 0x0019, 0x1ef1: 0x02e9, 0x1ef2: 0x03d9, 0x1ef3: 0x02f1, 0x1ef4: 0x02f9, 0x1ef5: 0x03f1, + 0x1ef6: 0x0309, 0x1ef7: 0x00a9, 0x1ef8: 0x0311, 0x1ef9: 0x00b1, 0x1efa: 0x0319, 0x1efb: 0x0101, + 0x1efc: 0x0321, 0x1efd: 0x0329, 0x1efe: 0x0051, 0x1eff: 0x0339, + // Block 0x7c, offset 0x1f00 + 0x1f00: 0x0751, 0x1f01: 0x00b9, 0x1f02: 0x0089, 0x1f03: 0x0341, 0x1f04: 0x0349, 0x1f05: 0x0391, + 0x1f06: 0x00c1, 0x1f07: 0x0109, 0x1f08: 0x00c9, 0x1f09: 0x04b1, 0x1f0a: 0x26d1, 0x1f0b: 0x11f9, + 0x1f0c: 0x26d9, 0x1f0d: 0x04d9, 0x1f0e: 0x26e1, 0x1f0f: 0x26e9, 0x1f10: 0x0018, 0x1f11: 0x0018, + 0x1f12: 0x0018, 0x1f13: 0x0018, 0x1f14: 0x0018, 0x1f15: 0x0018, 0x1f16: 0x0018, 0x1f17: 0x0018, + 0x1f18: 0x0018, 0x1f19: 0x0018, 0x1f1a: 0x0018, 0x1f1b: 0x0018, 0x1f1c: 0x0018, 0x1f1d: 0x0018, + 0x1f1e: 0x0018, 0x1f1f: 0x0018, 0x1f20: 0x0018, 0x1f21: 0x0018, 0x1f22: 0x0018, 0x1f23: 0x0018, + 0x1f24: 0x0018, 0x1f25: 0x0018, 0x1f26: 0x0018, 0x1f27: 0x0018, 0x1f28: 0x0018, 0x1f29: 0x0018, + 0x1f2a: 0x26f1, 0x1f2b: 0x26f9, 0x1f2c: 0x2701, 0x1f2d: 0x0018, 0x1f2e: 0x0018, 0x1f2f: 0x0018, + 0x1f30: 0x0018, 0x1f31: 0x0018, 0x1f32: 0x0018, 0x1f33: 0x0018, 0x1f34: 0x0018, 0x1f35: 0x0018, + 0x1f36: 0x0018, 0x1f37: 0x0018, 0x1f38: 0x0018, 0x1f39: 0x0018, 0x1f3a: 0x0018, 0x1f3b: 0x0018, + 0x1f3c: 0x0018, 0x1f3d: 0x0018, 0x1f3e: 0x0018, 0x1f3f: 0x0018, + // Block 0x7d, offset 0x1f40 + 0x1f40: 0x2711, 0x1f41: 0x2719, 0x1f42: 0x2721, 0x1f43: 0x0040, 0x1f44: 0x0040, 0x1f45: 0x0040, + 0x1f46: 0x0040, 0x1f47: 0x0040, 0x1f48: 0x0040, 0x1f49: 0x0040, 0x1f4a: 0x0040, 0x1f4b: 0x0040, + 0x1f4c: 0x0040, 0x1f4d: 0x0040, 0x1f4e: 0x0040, 0x1f4f: 0x0040, 0x1f50: 0x2729, 0x1f51: 0x2731, + 0x1f52: 0x2739, 0x1f53: 0x2741, 0x1f54: 0x2749, 0x1f55: 0x2751, 0x1f56: 0x2759, 0x1f57: 0x2761, + 0x1f58: 0x2769, 0x1f59: 0x2771, 0x1f5a: 0x2779, 0x1f5b: 0x2781, 0x1f5c: 0x2789, 0x1f5d: 0x2791, + 0x1f5e: 0x2799, 0x1f5f: 0x27a1, 0x1f60: 0x27a9, 0x1f61: 0x27b1, 0x1f62: 0x27b9, 0x1f63: 0x27c1, + 0x1f64: 0x27c9, 0x1f65: 0x27d1, 0x1f66: 0x27d9, 0x1f67: 0x27e1, 0x1f68: 0x27e9, 0x1f69: 0x27f1, + 0x1f6a: 0x27f9, 0x1f6b: 0x2801, 0x1f6c: 0x2809, 0x1f6d: 0x2811, 0x1f6e: 0x2819, 0x1f6f: 0x2821, + 0x1f70: 0x2829, 0x1f71: 0x2831, 0x1f72: 0x2839, 0x1f73: 0x2841, 0x1f74: 0x2849, 0x1f75: 0x2851, + 0x1f76: 0x2859, 0x1f77: 0x2861, 0x1f78: 0x2869, 0x1f79: 0x2871, 0x1f7a: 0x2879, 0x1f7b: 0x2881, + 0x1f7c: 0x0040, 0x1f7d: 0x0040, 0x1f7e: 0x0040, 0x1f7f: 0x0040, + // Block 0x7e, offset 0x1f80 + 0x1f80: 0x28e1, 0x1f81: 0x28e9, 0x1f82: 0x28f1, 0x1f83: 0x8cbd, 0x1f84: 0x28f9, 0x1f85: 0x2901, + 0x1f86: 0x2909, 0x1f87: 0x2911, 0x1f88: 0x2919, 0x1f89: 0x2921, 0x1f8a: 0x2929, 0x1f8b: 0x2931, + 0x1f8c: 0x2939, 0x1f8d: 0x8cdd, 0x1f8e: 0x2941, 0x1f8f: 0x2949, 0x1f90: 0x2951, 0x1f91: 0x2959, + 0x1f92: 0x8cfd, 0x1f93: 0x2961, 0x1f94: 0x2969, 0x1f95: 0x2799, 0x1f96: 0x8d1d, 0x1f97: 0x2971, + 0x1f98: 0x2979, 0x1f99: 0x2981, 0x1f9a: 0x2989, 0x1f9b: 0x2991, 0x1f9c: 0x8d3d, 0x1f9d: 0x2999, + 0x1f9e: 0x29a1, 0x1f9f: 0x29a9, 0x1fa0: 0x29b1, 0x1fa1: 0x29b9, 0x1fa2: 0x2871, 0x1fa3: 0x29c1, + 0x1fa4: 0x29c9, 0x1fa5: 0x29d1, 0x1fa6: 0x29d9, 0x1fa7: 0x29e1, 0x1fa8: 0x29e9, 0x1fa9: 0x29f1, + 0x1faa: 0x29f9, 0x1fab: 0x2a01, 0x1fac: 0x2a09, 0x1fad: 0x2a11, 0x1fae: 0x2a19, 0x1faf: 0x2a21, + 0x1fb0: 0x2a29, 0x1fb1: 0x2a31, 0x1fb2: 0x2a31, 0x1fb3: 0x2a31, 0x1fb4: 0x8d5d, 0x1fb5: 0x2a39, + 0x1fb6: 0x2a41, 0x1fb7: 0x2a49, 0x1fb8: 0x8d7d, 0x1fb9: 0x2a51, 0x1fba: 0x2a59, 0x1fbb: 0x2a61, + 0x1fbc: 0x2a69, 0x1fbd: 0x2a71, 0x1fbe: 0x2a79, 0x1fbf: 0x2a81, + // Block 0x7f, offset 0x1fc0 + 0x1fc0: 0x2a89, 0x1fc1: 0x2a91, 0x1fc2: 0x2a99, 0x1fc3: 0x2aa1, 0x1fc4: 0x2aa9, 0x1fc5: 0x2ab1, + 0x1fc6: 0x2ab1, 0x1fc7: 0x2ab9, 0x1fc8: 0x2ac1, 0x1fc9: 0x2ac9, 0x1fca: 0x2ad1, 0x1fcb: 0x2ad9, + 0x1fcc: 0x2ae1, 0x1fcd: 0x2ae9, 0x1fce: 0x2af1, 0x1fcf: 0x2af9, 0x1fd0: 0x2b01, 0x1fd1: 0x2b09, + 0x1fd2: 0x2b11, 0x1fd3: 0x2b19, 0x1fd4: 0x2b21, 0x1fd5: 0x2b29, 0x1fd6: 0x2b31, 0x1fd7: 0x2b39, + 0x1fd8: 0x2b41, 0x1fd9: 0x8d9d, 0x1fda: 0x2b49, 0x1fdb: 0x2b51, 0x1fdc: 0x2b59, 0x1fdd: 0x2751, + 0x1fde: 0x2b61, 0x1fdf: 0x2b69, 0x1fe0: 0x8dbd, 0x1fe1: 0x8ddd, 0x1fe2: 0x2b71, 0x1fe3: 0x2b79, + 0x1fe4: 0x2b81, 0x1fe5: 0x2b89, 0x1fe6: 0x2b91, 0x1fe7: 0x2b99, 0x1fe8: 0x2040, 0x1fe9: 0x2ba1, + 0x1fea: 0x2ba9, 0x1feb: 0x2ba9, 0x1fec: 0x8dfd, 0x1fed: 0x2bb1, 0x1fee: 0x2bb9, 0x1fef: 0x2bc1, + 0x1ff0: 0x2bc9, 0x1ff1: 0x8e1d, 0x1ff2: 0x2bd1, 0x1ff3: 0x2bd9, 0x1ff4: 0x2040, 0x1ff5: 0x2be1, + 0x1ff6: 0x2be9, 0x1ff7: 0x2bf1, 0x1ff8: 0x2bf9, 0x1ff9: 0x2c01, 0x1ffa: 0x2c09, 0x1ffb: 0x8e3d, + 0x1ffc: 0x2c11, 0x1ffd: 0x8e5d, 0x1ffe: 0x2c19, 0x1fff: 0x2c21, + // Block 0x80, offset 0x2000 + 0x2000: 0x2c29, 0x2001: 0x2c31, 0x2002: 0x2c39, 0x2003: 0x2c41, 0x2004: 0x2c49, 0x2005: 0x2c51, + 0x2006: 0x2c59, 0x2007: 0x2c61, 0x2008: 0x2c69, 0x2009: 0x8e7d, 0x200a: 0x2c71, 0x200b: 0x2c79, + 0x200c: 0x2c81, 0x200d: 0x2c89, 0x200e: 0x2c91, 0x200f: 0x8e9d, 0x2010: 0x2c99, 0x2011: 0x8ebd, + 0x2012: 0x8edd, 0x2013: 0x2ca1, 0x2014: 0x2ca9, 0x2015: 0x2ca9, 0x2016: 0x2cb1, 0x2017: 0x8efd, + 0x2018: 0x8f1d, 0x2019: 0x2cb9, 0x201a: 0x2cc1, 0x201b: 0x2cc9, 0x201c: 0x2cd1, 0x201d: 0x2cd9, + 0x201e: 0x2ce1, 0x201f: 0x2ce9, 0x2020: 0x2cf1, 0x2021: 0x2cf9, 0x2022: 0x2d01, 0x2023: 0x2d09, + 0x2024: 0x8f3d, 0x2025: 0x2d11, 0x2026: 0x2d19, 0x2027: 0x2d21, 0x2028: 0x2d29, 0x2029: 0x2d21, + 0x202a: 0x2d31, 0x202b: 0x2d39, 0x202c: 0x2d41, 0x202d: 0x2d49, 0x202e: 0x2d51, 0x202f: 0x2d59, + 0x2030: 0x2d61, 0x2031: 0x2d69, 0x2032: 0x2d71, 0x2033: 0x2d79, 0x2034: 0x2d81, 0x2035: 0x2d89, + 0x2036: 0x2d91, 0x2037: 0x2d99, 0x2038: 0x8f5d, 0x2039: 0x2da1, 0x203a: 0x2da9, 0x203b: 0x2db1, + 0x203c: 0x2db9, 0x203d: 0x2dc1, 0x203e: 0x8f7d, 0x203f: 0x2dc9, + // Block 0x81, offset 0x2040 + 0x2040: 0x2dd1, 0x2041: 0x2dd9, 0x2042: 0x2de1, 0x2043: 0x2de9, 0x2044: 0x2df1, 0x2045: 0x2df9, + 0x2046: 0x2e01, 0x2047: 0x2e09, 0x2048: 0x2e11, 0x2049: 0x2e19, 0x204a: 0x8f9d, 0x204b: 0x2e21, + 0x204c: 0x2e29, 0x204d: 0x2e31, 0x204e: 0x2e39, 0x204f: 0x2e41, 0x2050: 0x2e49, 0x2051: 0x2e51, + 0x2052: 0x2e59, 0x2053: 0x2e61, 0x2054: 0x2e69, 0x2055: 0x2e71, 0x2056: 0x2e79, 0x2057: 0x2e81, + 0x2058: 0x2e89, 0x2059: 0x2e91, 0x205a: 0x2e99, 0x205b: 0x2ea1, 0x205c: 0x2ea9, 0x205d: 0x8fbd, + 0x205e: 0x2eb1, 0x205f: 0x2eb9, 0x2060: 0x2ec1, 0x2061: 0x2ec9, 0x2062: 0x2ed1, 0x2063: 0x8fdd, + 0x2064: 0x2ed9, 0x2065: 0x2ee1, 0x2066: 0x2ee9, 0x2067: 0x2ef1, 0x2068: 0x2ef9, 0x2069: 0x2f01, + 0x206a: 0x2f09, 0x206b: 0x2f11, 0x206c: 0x7f0d, 0x206d: 0x2f19, 0x206e: 0x2f21, 0x206f: 0x2f29, + 0x2070: 0x8ffd, 0x2071: 0x2f31, 0x2072: 0x2f39, 0x2073: 0x2f41, 0x2074: 0x2f49, 0x2075: 0x2f51, + 0x2076: 0x2f59, 0x2077: 0x901d, 0x2078: 0x903d, 0x2079: 0x905d, 0x207a: 0x2f61, 0x207b: 0x907d, + 0x207c: 0x2f69, 0x207d: 0x2f71, 0x207e: 0x2f79, 0x207f: 0x2f81, + // Block 0x82, offset 0x2080 + 0x2080: 0x2f89, 0x2081: 0x2f91, 0x2082: 0x2f99, 0x2083: 0x2fa1, 0x2084: 0x2fa9, 0x2085: 0x2fb1, + 0x2086: 0x909d, 0x2087: 0x2fb9, 0x2088: 0x2fc1, 0x2089: 0x2fc9, 0x208a: 0x2fd1, 0x208b: 0x2fd9, + 0x208c: 0x2fe1, 0x208d: 0x90bd, 0x208e: 0x2fe9, 0x208f: 0x2ff1, 0x2090: 0x90dd, 0x2091: 0x90fd, + 0x2092: 0x2ff9, 0x2093: 0x3001, 0x2094: 0x3009, 0x2095: 0x3011, 0x2096: 0x3019, 0x2097: 0x3021, + 0x2098: 0x3029, 0x2099: 0x3031, 0x209a: 0x3039, 0x209b: 0x911d, 0x209c: 0x3041, 0x209d: 0x913d, + 0x209e: 0x3049, 0x209f: 0x2040, 0x20a0: 0x3051, 0x20a1: 0x3059, 0x20a2: 0x3061, 0x20a3: 0x915d, + 0x20a4: 0x3069, 0x20a5: 0x3071, 0x20a6: 0x917d, 0x20a7: 0x919d, 0x20a8: 0x3079, 0x20a9: 0x3081, + 0x20aa: 0x3089, 0x20ab: 0x3091, 0x20ac: 0x3099, 0x20ad: 0x3099, 0x20ae: 0x30a1, 0x20af: 0x30a9, + 0x20b0: 0x30b1, 0x20b1: 0x30b9, 0x20b2: 0x30c1, 0x20b3: 0x30c9, 0x20b4: 0x30d1, 0x20b5: 0x91bd, + 0x20b6: 0x30d9, 0x20b7: 0x91dd, 0x20b8: 0x30e1, 0x20b9: 0x91fd, 0x20ba: 0x30e9, 0x20bb: 0x921d, + 0x20bc: 0x923d, 0x20bd: 0x925d, 0x20be: 0x30f1, 0x20bf: 0x30f9, + // Block 0x83, offset 0x20c0 + 0x20c0: 0x3101, 0x20c1: 0x927d, 0x20c2: 0x929d, 0x20c3: 0x92bd, 0x20c4: 0x92dd, 0x20c5: 0x3109, + 0x20c6: 0x3111, 0x20c7: 0x3111, 0x20c8: 0x3119, 0x20c9: 0x3121, 0x20ca: 0x3129, 0x20cb: 0x3131, + 0x20cc: 0x3139, 0x20cd: 0x92fd, 0x20ce: 0x3141, 0x20cf: 0x3149, 0x20d0: 0x3151, 0x20d1: 0x3159, + 0x20d2: 0x931d, 0x20d3: 0x3161, 0x20d4: 0x933d, 0x20d5: 0x935d, 0x20d6: 0x3169, 0x20d7: 0x3171, + 0x20d8: 0x3179, 0x20d9: 0x3181, 0x20da: 0x3189, 0x20db: 0x3191, 0x20dc: 0x937d, 0x20dd: 0x939d, + 0x20de: 0x93bd, 0x20df: 0x2040, 0x20e0: 0x3199, 0x20e1: 0x93dd, 0x20e2: 0x31a1, 0x20e3: 0x31a9, + 0x20e4: 0x31b1, 0x20e5: 0x93fd, 0x20e6: 0x31b9, 0x20e7: 0x31c1, 0x20e8: 0x31c9, 0x20e9: 0x31d1, + 0x20ea: 0x31d9, 0x20eb: 0x941d, 0x20ec: 0x31e1, 0x20ed: 0x31e9, 0x20ee: 0x31f1, 0x20ef: 0x31f9, + 0x20f0: 0x3201, 0x20f1: 0x3209, 0x20f2: 0x943d, 0x20f3: 0x945d, 0x20f4: 0x3211, 0x20f5: 0x947d, + 0x20f6: 0x3219, 0x20f7: 0x949d, 0x20f8: 0x3221, 0x20f9: 0x3229, 0x20fa: 0x3231, 0x20fb: 0x94bd, + 0x20fc: 0x94dd, 0x20fd: 0x3239, 0x20fe: 0x94fd, 0x20ff: 0x3241, + // Block 0x84, offset 0x2100 + 0x2100: 0x951d, 0x2101: 0x3249, 0x2102: 0x3251, 0x2103: 0x3259, 0x2104: 0x3261, 0x2105: 0x3269, + 0x2106: 0x3271, 0x2107: 0x953d, 0x2108: 0x955d, 0x2109: 0x957d, 0x210a: 0x959d, 0x210b: 0x2ca1, + 0x210c: 0x3279, 0x210d: 0x3281, 0x210e: 0x3289, 0x210f: 0x3291, 0x2110: 0x3299, 0x2111: 0x32a1, + 0x2112: 0x32a9, 0x2113: 0x32b1, 0x2114: 0x32b9, 0x2115: 0x32c1, 0x2116: 0x32c9, 0x2117: 0x95bd, + 0x2118: 0x32d1, 0x2119: 0x32d9, 0x211a: 0x32e1, 0x211b: 0x32e9, 0x211c: 0x32f1, 0x211d: 0x32f9, + 0x211e: 0x3301, 0x211f: 0x3309, 0x2120: 0x3311, 0x2121: 0x3319, 0x2122: 0x3321, 0x2123: 0x3329, + 0x2124: 0x95dd, 0x2125: 0x95fd, 0x2126: 0x961d, 0x2127: 0x3331, 0x2128: 0x3339, 0x2129: 0x3341, + 0x212a: 0x3349, 0x212b: 0x963d, 0x212c: 0x3351, 0x212d: 0x965d, 0x212e: 0x3359, 0x212f: 0x3361, + 0x2130: 0x967d, 0x2131: 0x969d, 0x2132: 0x3369, 0x2133: 0x3371, 0x2134: 0x3379, 0x2135: 0x3381, + 0x2136: 0x3389, 0x2137: 0x3391, 0x2138: 0x3399, 0x2139: 0x33a1, 0x213a: 0x33a9, 0x213b: 0x33b1, + 0x213c: 0x33b9, 0x213d: 0x33c1, 0x213e: 0x33c9, 0x213f: 0x2040, + // Block 0x85, offset 0x2140 + 0x2140: 0x33d1, 0x2141: 0x33d9, 0x2142: 0x33e1, 0x2143: 0x33e9, 0x2144: 0x33f1, 0x2145: 0x96bd, + 0x2146: 0x33f9, 0x2147: 0x3401, 0x2148: 0x3409, 0x2149: 0x3411, 0x214a: 0x3419, 0x214b: 0x96dd, + 0x214c: 0x96fd, 0x214d: 0x3421, 0x214e: 0x3429, 0x214f: 0x3431, 0x2150: 0x3439, 0x2151: 0x3441, + 0x2152: 0x3449, 0x2153: 0x971d, 0x2154: 0x3451, 0x2155: 0x3459, 0x2156: 0x3461, 0x2157: 0x3469, + 0x2158: 0x973d, 0x2159: 0x975d, 0x215a: 0x3471, 0x215b: 0x3479, 0x215c: 0x3481, 0x215d: 0x977d, + 0x215e: 0x3489, 0x215f: 0x3491, 0x2160: 0x684d, 0x2161: 0x979d, 0x2162: 0x3499, 0x2163: 0x34a1, + 0x2164: 0x34a9, 0x2165: 0x97bd, 0x2166: 0x34b1, 0x2167: 0x34b9, 0x2168: 0x34c1, 0x2169: 0x34c9, + 0x216a: 0x34d1, 0x216b: 0x34d9, 0x216c: 0x34e1, 0x216d: 0x97dd, 0x216e: 0x34e9, 0x216f: 0x34f1, + 0x2170: 0x34f9, 0x2171: 0x97fd, 0x2172: 0x3501, 0x2173: 0x3509, 0x2174: 0x3511, 0x2175: 0x3519, + 0x2176: 0x7b6d, 0x2177: 0x981d, 0x2178: 0x3521, 0x2179: 0x3529, 0x217a: 0x3531, 0x217b: 0x983d, + 0x217c: 0x3539, 0x217d: 0x985d, 0x217e: 0x3541, 0x217f: 0x3541, + // Block 0x86, offset 0x2180 + 0x2180: 0x3549, 0x2181: 0x987d, 0x2182: 0x3551, 0x2183: 0x3559, 0x2184: 0x3561, 0x2185: 0x3569, + 0x2186: 0x3571, 0x2187: 0x3579, 0x2188: 0x3581, 0x2189: 0x989d, 0x218a: 0x3589, 0x218b: 0x3591, + 0x218c: 0x3599, 0x218d: 0x35a1, 0x218e: 0x35a9, 0x218f: 0x35b1, 0x2190: 0x98bd, 0x2191: 0x35b9, + 0x2192: 0x98dd, 0x2193: 0x98fd, 0x2194: 0x991d, 0x2195: 0x35c1, 0x2196: 0x35c9, 0x2197: 0x35d1, + 0x2198: 0x35d9, 0x2199: 0x35e1, 0x219a: 0x35e9, 0x219b: 0x35f1, 0x219c: 0x35f9, 0x219d: 0x993d, + 0x219e: 0x0040, 0x219f: 0x0040, 0x21a0: 0x0040, 0x21a1: 0x0040, 0x21a2: 0x0040, 0x21a3: 0x0040, + 0x21a4: 0x0040, 0x21a5: 0x0040, 0x21a6: 0x0040, 0x21a7: 0x0040, 0x21a8: 0x0040, 0x21a9: 0x0040, + 0x21aa: 0x0040, 0x21ab: 0x0040, 0x21ac: 0x0040, 0x21ad: 0x0040, 0x21ae: 0x0040, 0x21af: 0x0040, + 0x21b0: 0x0040, 0x21b1: 0x0040, 0x21b2: 0x0040, 0x21b3: 0x0040, 0x21b4: 0x0040, 0x21b5: 0x0040, + 0x21b6: 0x0040, 0x21b7: 0x0040, 0x21b8: 0x0040, 0x21b9: 0x0040, 0x21ba: 0x0040, 0x21bb: 0x0040, + 0x21bc: 0x0040, 0x21bd: 0x0040, 0x21be: 0x0040, 0x21bf: 0x0040, +} + +// idnaIndex: 39 blocks, 2496 entries, 4992 bytes +// Block 0 is the zero block. +var idnaIndex = [2496]uint16{ + // Block 0x0, offset 0x0 + // Block 0x1, offset 0x40 + // Block 0x2, offset 0x80 + // Block 0x3, offset 0xc0 + 0xc2: 0x01, 0xc3: 0x85, 0xc4: 0x02, 0xc5: 0x03, 0xc6: 0x04, 0xc7: 0x05, + 0xc8: 0x06, 0xc9: 0x86, 0xca: 0x87, 0xcb: 0x07, 0xcc: 0x88, 0xcd: 0x08, 0xce: 0x09, 0xcf: 0x0a, + 0xd0: 0x89, 0xd1: 0x0b, 0xd2: 0x0c, 0xd3: 0x0d, 0xd4: 0x0e, 0xd5: 0x8a, 0xd6: 0x8b, 0xd7: 0x8c, + 0xd8: 0x0f, 0xd9: 0x10, 0xda: 0x8d, 0xdb: 0x11, 0xdc: 0x12, 0xdd: 0x8e, 0xde: 0x8f, 0xdf: 0x90, + 0xe0: 0x02, 0xe1: 0x03, 0xe2: 0x04, 0xe3: 0x05, 0xe4: 0x06, 0xe5: 0x07, 0xe6: 0x07, 0xe7: 0x07, + 0xe8: 0x07, 0xe9: 0x07, 0xea: 0x08, 0xeb: 0x07, 0xec: 0x07, 0xed: 0x09, 0xee: 0x0a, 0xef: 0x0b, + 0xf0: 0x20, 0xf1: 0x21, 0xf2: 0x21, 0xf3: 0x23, 0xf4: 0x24, + // Block 0x4, offset 0x100 + 0x120: 0x91, 0x121: 0x13, 0x122: 0x14, 0x123: 0x92, 0x124: 0x93, 0x125: 0x15, 0x126: 0x16, 0x127: 0x17, + 0x128: 0x18, 0x129: 0x19, 0x12a: 0x1a, 0x12b: 0x1b, 0x12c: 0x1c, 0x12d: 0x1d, 0x12e: 0x1e, 0x12f: 0x94, + 0x130: 0x95, 0x131: 0x1f, 0x132: 0x20, 0x133: 0x21, 0x134: 0x96, 0x135: 0x22, 0x136: 0x97, 0x137: 0x98, + 0x138: 0x99, 0x139: 0x9a, 0x13a: 0x23, 0x13b: 0x9b, 0x13c: 0x9c, 0x13d: 0x24, 0x13e: 0x25, 0x13f: 0x9d, + // Block 0x5, offset 0x140 + 0x140: 0x9e, 0x141: 0x9f, 0x142: 0xa0, 0x143: 0xa1, 0x144: 0xa2, 0x145: 0xa3, 0x146: 0xa4, 0x147: 0xa5, + 0x148: 0xa6, 0x149: 0xa7, 0x14a: 0xa8, 0x14b: 0xa9, 0x14c: 0xaa, 0x14d: 0xab, 0x14e: 0xac, 0x14f: 0xad, + 0x150: 0xae, 0x151: 0xa6, 0x152: 0xa6, 0x153: 0xa6, 0x154: 0xa6, 0x155: 0xa6, 0x156: 0xa6, 0x157: 0xa6, + 0x158: 0xa6, 0x159: 0xaf, 0x15a: 0xb0, 0x15b: 0xb1, 0x15c: 0xb2, 0x15d: 0xb3, 0x15e: 0xb4, 0x15f: 0xb5, + 0x160: 0xb6, 0x161: 0xb7, 0x162: 0xb8, 0x163: 0xb9, 0x164: 0xba, 0x165: 0xbb, 0x166: 0xbc, 0x167: 0xbd, + 0x168: 0xbe, 0x169: 0xbf, 0x16a: 0xc0, 0x16b: 0xc1, 0x16c: 0xc2, 0x16d: 0xc3, 0x16e: 0xc4, 0x16f: 0xc5, + 0x170: 0xc6, 0x171: 0xc7, 0x172: 0xc8, 0x173: 0xc9, 0x174: 0x26, 0x175: 0x27, 0x176: 0x28, 0x177: 0x88, + 0x178: 0x29, 0x179: 0x29, 0x17a: 0x2a, 0x17b: 0x29, 0x17c: 0xca, 0x17d: 0x2b, 0x17e: 0x2c, 0x17f: 0x2d, + // Block 0x6, offset 0x180 + 0x180: 0x2e, 0x181: 0x2f, 0x182: 0x30, 0x183: 0xcb, 0x184: 0x31, 0x185: 0x32, 0x186: 0xcc, 0x187: 0xa2, + 0x188: 0xcd, 0x189: 0xce, 0x18a: 0xa2, 0x18b: 0xa2, 0x18c: 0xcf, 0x18d: 0xa2, 0x18e: 0xa2, 0x18f: 0xa2, + 0x190: 0xd0, 0x191: 0x33, 0x192: 0x34, 0x193: 0x35, 0x194: 0xa2, 0x195: 0xa2, 0x196: 0xa2, 0x197: 0xa2, + 0x198: 0xa2, 0x199: 0xa2, 0x19a: 0xa2, 0x19b: 0xa2, 0x19c: 0xa2, 0x19d: 0xa2, 0x19e: 0xa2, 0x19f: 0xa2, + 0x1a0: 0xa2, 0x1a1: 0xa2, 0x1a2: 0xa2, 0x1a3: 0xa2, 0x1a4: 0xa2, 0x1a5: 0xa2, 0x1a6: 0xa2, 0x1a7: 0xa2, + 0x1a8: 0xd1, 0x1a9: 0xd2, 0x1aa: 0xa2, 0x1ab: 0xd3, 0x1ac: 0xa2, 0x1ad: 0xd4, 0x1ae: 0xd5, 0x1af: 0xa2, + 0x1b0: 0xd6, 0x1b1: 0x36, 0x1b2: 0x29, 0x1b3: 0x37, 0x1b4: 0xd7, 0x1b5: 0xd8, 0x1b6: 0xd9, 0x1b7: 0xda, + 0x1b8: 0xdb, 0x1b9: 0xdc, 0x1ba: 0xdd, 0x1bb: 0xde, 0x1bc: 0xdf, 0x1bd: 0xe0, 0x1be: 0xe1, 0x1bf: 0x38, + // Block 0x7, offset 0x1c0 + 0x1c0: 0x39, 0x1c1: 0xe2, 0x1c2: 0xe3, 0x1c3: 0xe4, 0x1c4: 0xe5, 0x1c5: 0x3a, 0x1c6: 0x3b, 0x1c7: 0xe6, + 0x1c8: 0xe7, 0x1c9: 0x3c, 0x1ca: 0x3d, 0x1cb: 0x3e, 0x1cc: 0xe8, 0x1cd: 0xe9, 0x1ce: 0x3f, 0x1cf: 0x40, + 0x1d0: 0xa6, 0x1d1: 0xa6, 0x1d2: 0xa6, 0x1d3: 0xa6, 0x1d4: 0xa6, 0x1d5: 0xa6, 0x1d6: 0xa6, 0x1d7: 0xa6, + 0x1d8: 0xa6, 0x1d9: 0xa6, 0x1da: 0xa6, 0x1db: 0xa6, 0x1dc: 0xa6, 0x1dd: 0xa6, 0x1de: 0xa6, 0x1df: 0xa6, + 0x1e0: 0xa6, 0x1e1: 0xa6, 0x1e2: 0xa6, 0x1e3: 0xa6, 0x1e4: 0xa6, 0x1e5: 0xa6, 0x1e6: 0xa6, 0x1e7: 0xa6, + 0x1e8: 0xa6, 0x1e9: 0xa6, 0x1ea: 0xa6, 0x1eb: 0xa6, 0x1ec: 0xa6, 0x1ed: 0xa6, 0x1ee: 0xa6, 0x1ef: 0xa6, + 0x1f0: 0xa6, 0x1f1: 0xa6, 0x1f2: 0xa6, 0x1f3: 0xa6, 0x1f4: 0xa6, 0x1f5: 0xa6, 0x1f6: 0xa6, 0x1f7: 0xa6, + 0x1f8: 0xa6, 0x1f9: 0xa6, 0x1fa: 0xa6, 0x1fb: 0xa6, 0x1fc: 0xa6, 0x1fd: 0xa6, 0x1fe: 0xa6, 0x1ff: 0xa6, + // Block 0x8, offset 0x200 + 0x200: 0xa6, 0x201: 0xa6, 0x202: 0xa6, 0x203: 0xa6, 0x204: 0xa6, 0x205: 0xa6, 0x206: 0xa6, 0x207: 0xa6, + 0x208: 0xa6, 0x209: 0xa6, 0x20a: 0xa6, 0x20b: 0xa6, 0x20c: 0xa6, 0x20d: 0xa6, 0x20e: 0xa6, 0x20f: 0xa6, + 0x210: 0xa6, 0x211: 0xa6, 0x212: 0xa6, 0x213: 0xa6, 0x214: 0xa6, 0x215: 0xa6, 0x216: 0xa6, 0x217: 0xa6, + 0x218: 0xa6, 0x219: 0xa6, 0x21a: 0xa6, 0x21b: 0xa6, 0x21c: 0xa6, 0x21d: 0xa6, 0x21e: 0xa6, 0x21f: 0xa6, + 0x220: 0xa6, 0x221: 0xa6, 0x222: 0xa6, 0x223: 0xa6, 0x224: 0xa6, 0x225: 0xa6, 0x226: 0xa6, 0x227: 0xa6, + 0x228: 0xa6, 0x229: 0xa6, 0x22a: 0xa6, 0x22b: 0xa6, 0x22c: 0xa6, 0x22d: 0xa6, 0x22e: 0xa6, 0x22f: 0xa6, + 0x230: 0xa6, 0x231: 0xa6, 0x232: 0xa6, 0x233: 0xa6, 0x234: 0xa6, 0x235: 0xa6, 0x236: 0xa6, 0x237: 0xa2, + 0x238: 0xa6, 0x239: 0xa6, 0x23a: 0xa6, 0x23b: 0xa6, 0x23c: 0xa6, 0x23d: 0xa6, 0x23e: 0xa6, 0x23f: 0xa6, + // Block 0x9, offset 0x240 + 0x240: 0xa6, 0x241: 0xa6, 0x242: 0xa6, 0x243: 0xa6, 0x244: 0xa6, 0x245: 0xa6, 0x246: 0xa6, 0x247: 0xa6, + 0x248: 0xa6, 0x249: 0xa6, 0x24a: 0xa6, 0x24b: 0xa6, 0x24c: 0xa6, 0x24d: 0xa6, 0x24e: 0xa6, 0x24f: 0xa6, + 0x250: 0xa6, 0x251: 0xa6, 0x252: 0xa6, 0x253: 0xa6, 0x254: 0xa6, 0x255: 0xa6, 0x256: 0xa6, 0x257: 0xa6, + 0x258: 0xa6, 0x259: 0xa6, 0x25a: 0xa6, 0x25b: 0xa6, 0x25c: 0xa6, 0x25d: 0xa6, 0x25e: 0xa6, 0x25f: 0xa6, + 0x260: 0xa6, 0x261: 0xa6, 0x262: 0xa6, 0x263: 0xa6, 0x264: 0xa6, 0x265: 0xa6, 0x266: 0xa6, 0x267: 0xa6, + 0x268: 0xa6, 0x269: 0xa6, 0x26a: 0xa6, 0x26b: 0xa6, 0x26c: 0xa6, 0x26d: 0xa6, 0x26e: 0xa6, 0x26f: 0xa6, + 0x270: 0xa6, 0x271: 0xa6, 0x272: 0xa6, 0x273: 0xa6, 0x274: 0xa6, 0x275: 0xa6, 0x276: 0xa6, 0x277: 0xa6, + 0x278: 0xa6, 0x279: 0xa6, 0x27a: 0xa6, 0x27b: 0xa6, 0x27c: 0xa6, 0x27d: 0xa6, 0x27e: 0xa6, 0x27f: 0xa6, + // Block 0xa, offset 0x280 + 0x280: 0xa6, 0x281: 0xa6, 0x282: 0xa6, 0x283: 0xa6, 0x284: 0xa6, 0x285: 0xa6, 0x286: 0xa6, 0x287: 0xa6, + 0x288: 0xa6, 0x289: 0xa6, 0x28a: 0xa6, 0x28b: 0xa6, 0x28c: 0xa6, 0x28d: 0xa6, 0x28e: 0xa6, 0x28f: 0xa6, + 0x290: 0xa6, 0x291: 0xa6, 0x292: 0xea, 0x293: 0xeb, 0x294: 0xa6, 0x295: 0xa6, 0x296: 0xa6, 0x297: 0xa6, + 0x298: 0xec, 0x299: 0x41, 0x29a: 0x42, 0x29b: 0xed, 0x29c: 0x43, 0x29d: 0x44, 0x29e: 0x45, 0x29f: 0x46, + 0x2a0: 0xee, 0x2a1: 0xef, 0x2a2: 0xf0, 0x2a3: 0xf1, 0x2a4: 0xf2, 0x2a5: 0xf3, 0x2a6: 0xf4, 0x2a7: 0xf5, + 0x2a8: 0xf6, 0x2a9: 0xf7, 0x2aa: 0xf8, 0x2ab: 0xf9, 0x2ac: 0xfa, 0x2ad: 0xfb, 0x2ae: 0xfc, 0x2af: 0xfd, + 0x2b0: 0xa6, 0x2b1: 0xa6, 0x2b2: 0xa6, 0x2b3: 0xa6, 0x2b4: 0xa6, 0x2b5: 0xa6, 0x2b6: 0xa6, 0x2b7: 0xa6, + 0x2b8: 0xa6, 0x2b9: 0xa6, 0x2ba: 0xa6, 0x2bb: 0xa6, 0x2bc: 0xa6, 0x2bd: 0xa6, 0x2be: 0xa6, 0x2bf: 0xa6, + // Block 0xb, offset 0x2c0 + 0x2c0: 0xa6, 0x2c1: 0xa6, 0x2c2: 0xa6, 0x2c3: 0xa6, 0x2c4: 0xa6, 0x2c5: 0xa6, 0x2c6: 0xa6, 0x2c7: 0xa6, + 0x2c8: 0xa6, 0x2c9: 0xa6, 0x2ca: 0xa6, 0x2cb: 0xa6, 0x2cc: 0xa6, 0x2cd: 0xa6, 0x2ce: 0xa6, 0x2cf: 0xa6, + 0x2d0: 0xa6, 0x2d1: 0xa6, 0x2d2: 0xa6, 0x2d3: 0xa6, 0x2d4: 0xa6, 0x2d5: 0xa6, 0x2d6: 0xa6, 0x2d7: 0xa6, + 0x2d8: 0xa6, 0x2d9: 0xa6, 0x2da: 0xa6, 0x2db: 0xa6, 0x2dc: 0xa6, 0x2dd: 0xa6, 0x2de: 0xfe, 0x2df: 0xff, + // Block 0xc, offset 0x300 + 0x300: 0x100, 0x301: 0x100, 0x302: 0x100, 0x303: 0x100, 0x304: 0x100, 0x305: 0x100, 0x306: 0x100, 0x307: 0x100, + 0x308: 0x100, 0x309: 0x100, 0x30a: 0x100, 0x30b: 0x100, 0x30c: 0x100, 0x30d: 0x100, 0x30e: 0x100, 0x30f: 0x100, + 0x310: 0x100, 0x311: 0x100, 0x312: 0x100, 0x313: 0x100, 0x314: 0x100, 0x315: 0x100, 0x316: 0x100, 0x317: 0x100, + 0x318: 0x100, 0x319: 0x100, 0x31a: 0x100, 0x31b: 0x100, 0x31c: 0x100, 0x31d: 0x100, 0x31e: 0x100, 0x31f: 0x100, + 0x320: 0x100, 0x321: 0x100, 0x322: 0x100, 0x323: 0x100, 0x324: 0x100, 0x325: 0x100, 0x326: 0x100, 0x327: 0x100, + 0x328: 0x100, 0x329: 0x100, 0x32a: 0x100, 0x32b: 0x100, 0x32c: 0x100, 0x32d: 0x100, 0x32e: 0x100, 0x32f: 0x100, + 0x330: 0x100, 0x331: 0x100, 0x332: 0x100, 0x333: 0x100, 0x334: 0x100, 0x335: 0x100, 0x336: 0x100, 0x337: 0x100, + 0x338: 0x100, 0x339: 0x100, 0x33a: 0x100, 0x33b: 0x100, 0x33c: 0x100, 0x33d: 0x100, 0x33e: 0x100, 0x33f: 0x100, + // Block 0xd, offset 0x340 + 0x340: 0x100, 0x341: 0x100, 0x342: 0x100, 0x343: 0x100, 0x344: 0x100, 0x345: 0x100, 0x346: 0x100, 0x347: 0x100, + 0x348: 0x100, 0x349: 0x100, 0x34a: 0x100, 0x34b: 0x100, 0x34c: 0x100, 0x34d: 0x100, 0x34e: 0x100, 0x34f: 0x100, + 0x350: 0x100, 0x351: 0x100, 0x352: 0x100, 0x353: 0x100, 0x354: 0x100, 0x355: 0x100, 0x356: 0x100, 0x357: 0x100, + 0x358: 0x100, 0x359: 0x100, 0x35a: 0x100, 0x35b: 0x100, 0x35c: 0x100, 0x35d: 0x100, 0x35e: 0x100, 0x35f: 0x100, + 0x360: 0x100, 0x361: 0x100, 0x362: 0x100, 0x363: 0x100, 0x364: 0x101, 0x365: 0x102, 0x366: 0x103, 0x367: 0x104, + 0x368: 0x47, 0x369: 0x105, 0x36a: 0x106, 0x36b: 0x48, 0x36c: 0x49, 0x36d: 0x4a, 0x36e: 0x4b, 0x36f: 0x4c, + 0x370: 0x107, 0x371: 0x4d, 0x372: 0x4e, 0x373: 0x4f, 0x374: 0x50, 0x375: 0x51, 0x376: 0x108, 0x377: 0x52, + 0x378: 0x53, 0x379: 0x54, 0x37a: 0x55, 0x37b: 0x56, 0x37c: 0x57, 0x37d: 0x58, 0x37e: 0x59, 0x37f: 0x5a, + // Block 0xe, offset 0x380 + 0x380: 0x109, 0x381: 0x10a, 0x382: 0xa6, 0x383: 0x10b, 0x384: 0x10c, 0x385: 0xa2, 0x386: 0x10d, 0x387: 0x10e, + 0x388: 0x100, 0x389: 0x100, 0x38a: 0x10f, 0x38b: 0x110, 0x38c: 0x111, 0x38d: 0x112, 0x38e: 0x113, 0x38f: 0x114, + 0x390: 0x115, 0x391: 0xa6, 0x392: 0x116, 0x393: 0x117, 0x394: 0x118, 0x395: 0x5b, 0x396: 0x5c, 0x397: 0x100, + 0x398: 0xa6, 0x399: 0xa6, 0x39a: 0xa6, 0x39b: 0xa6, 0x39c: 0x119, 0x39d: 0x11a, 0x39e: 0x5d, 0x39f: 0x100, + 0x3a0: 0x11b, 0x3a1: 0x11c, 0x3a2: 0x11d, 0x3a3: 0x11e, 0x3a4: 0x11f, 0x3a5: 0x100, 0x3a6: 0x120, 0x3a7: 0x121, + 0x3a8: 0x122, 0x3a9: 0x123, 0x3aa: 0x124, 0x3ab: 0x5e, 0x3ac: 0x125, 0x3ad: 0x126, 0x3ae: 0x5f, 0x3af: 0x100, + 0x3b0: 0x127, 0x3b1: 0x128, 0x3b2: 0x129, 0x3b3: 0x12a, 0x3b4: 0x12b, 0x3b5: 0x100, 0x3b6: 0x100, 0x3b7: 0x100, + 0x3b8: 0x100, 0x3b9: 0x12c, 0x3ba: 0x12d, 0x3bb: 0x12e, 0x3bc: 0x12f, 0x3bd: 0x130, 0x3be: 0x131, 0x3bf: 0x132, + // Block 0xf, offset 0x3c0 + 0x3c0: 0x133, 0x3c1: 0x134, 0x3c2: 0x135, 0x3c3: 0x136, 0x3c4: 0x137, 0x3c5: 0x138, 0x3c6: 0x139, 0x3c7: 0x13a, + 0x3c8: 0x13b, 0x3c9: 0x13c, 0x3ca: 0x13d, 0x3cb: 0x13e, 0x3cc: 0x60, 0x3cd: 0x61, 0x3ce: 0x100, 0x3cf: 0x100, + 0x3d0: 0x13f, 0x3d1: 0x140, 0x3d2: 0x141, 0x3d3: 0x142, 0x3d4: 0x100, 0x3d5: 0x100, 0x3d6: 0x143, 0x3d7: 0x144, + 0x3d8: 0x145, 0x3d9: 0x146, 0x3da: 0x147, 0x3db: 0x148, 0x3dc: 0x149, 0x3dd: 0x14a, 0x3de: 0x100, 0x3df: 0x100, + 0x3e0: 0x14b, 0x3e1: 0x100, 0x3e2: 0x14c, 0x3e3: 0x14d, 0x3e4: 0x62, 0x3e5: 0x14e, 0x3e6: 0x14f, 0x3e7: 0x150, + 0x3e8: 0x151, 0x3e9: 0x152, 0x3ea: 0x153, 0x3eb: 0x154, 0x3ec: 0x155, 0x3ed: 0x100, 0x3ee: 0x100, 0x3ef: 0x100, + 0x3f0: 0x156, 0x3f1: 0x157, 0x3f2: 0x158, 0x3f3: 0x100, 0x3f4: 0x159, 0x3f5: 0x15a, 0x3f6: 0x15b, 0x3f7: 0x100, + 0x3f8: 0x100, 0x3f9: 0x100, 0x3fa: 0x100, 0x3fb: 0x15c, 0x3fc: 0x15d, 0x3fd: 0x15e, 0x3fe: 0x15f, 0x3ff: 0x160, + // Block 0x10, offset 0x400 + 0x400: 0xa6, 0x401: 0xa6, 0x402: 0xa6, 0x403: 0xa6, 0x404: 0xa6, 0x405: 0xa6, 0x406: 0xa6, 0x407: 0xa6, + 0x408: 0xa6, 0x409: 0xa6, 0x40a: 0xa6, 0x40b: 0xa6, 0x40c: 0xa6, 0x40d: 0xa6, 0x40e: 0x161, 0x40f: 0x100, + 0x410: 0xa2, 0x411: 0x162, 0x412: 0xa6, 0x413: 0xa6, 0x414: 0xa6, 0x415: 0x163, 0x416: 0x100, 0x417: 0x100, + 0x418: 0x100, 0x419: 0x100, 0x41a: 0x100, 0x41b: 0x100, 0x41c: 0x100, 0x41d: 0x100, 0x41e: 0x100, 0x41f: 0x100, + 0x420: 0x100, 0x421: 0x100, 0x422: 0x100, 0x423: 0x100, 0x424: 0x100, 0x425: 0x100, 0x426: 0x100, 0x427: 0x100, + 0x428: 0x100, 0x429: 0x100, 0x42a: 0x100, 0x42b: 0x100, 0x42c: 0x100, 0x42d: 0x100, 0x42e: 0x100, 0x42f: 0x100, + 0x430: 0x100, 0x431: 0x100, 0x432: 0x100, 0x433: 0x100, 0x434: 0x100, 0x435: 0x100, 0x436: 0x100, 0x437: 0x100, + 0x438: 0x100, 0x439: 0x100, 0x43a: 0x100, 0x43b: 0x100, 0x43c: 0x100, 0x43d: 0x100, 0x43e: 0x164, 0x43f: 0x165, + // Block 0x11, offset 0x440 + 0x440: 0xa6, 0x441: 0xa6, 0x442: 0xa6, 0x443: 0xa6, 0x444: 0xa6, 0x445: 0xa6, 0x446: 0xa6, 0x447: 0xa6, + 0x448: 0xa6, 0x449: 0xa6, 0x44a: 0xa6, 0x44b: 0xa6, 0x44c: 0xa6, 0x44d: 0xa6, 0x44e: 0xa6, 0x44f: 0xa6, + 0x450: 0x166, 0x451: 0x167, 0x452: 0x100, 0x453: 0x100, 0x454: 0x100, 0x455: 0x100, 0x456: 0x100, 0x457: 0x100, + 0x458: 0x100, 0x459: 0x100, 0x45a: 0x100, 0x45b: 0x100, 0x45c: 0x100, 0x45d: 0x100, 0x45e: 0x100, 0x45f: 0x100, + 0x460: 0x100, 0x461: 0x100, 0x462: 0x100, 0x463: 0x100, 0x464: 0x100, 0x465: 0x100, 0x466: 0x100, 0x467: 0x100, + 0x468: 0x100, 0x469: 0x100, 0x46a: 0x100, 0x46b: 0x100, 0x46c: 0x100, 0x46d: 0x100, 0x46e: 0x100, 0x46f: 0x100, + 0x470: 0x100, 0x471: 0x100, 0x472: 0x100, 0x473: 0x100, 0x474: 0x100, 0x475: 0x100, 0x476: 0x100, 0x477: 0x100, + 0x478: 0x100, 0x479: 0x100, 0x47a: 0x100, 0x47b: 0x100, 0x47c: 0x100, 0x47d: 0x100, 0x47e: 0x100, 0x47f: 0x100, + // Block 0x12, offset 0x480 + 0x480: 0x100, 0x481: 0x100, 0x482: 0x100, 0x483: 0x100, 0x484: 0x100, 0x485: 0x100, 0x486: 0x100, 0x487: 0x100, + 0x488: 0x100, 0x489: 0x100, 0x48a: 0x100, 0x48b: 0x100, 0x48c: 0x100, 0x48d: 0x100, 0x48e: 0x100, 0x48f: 0x100, + 0x490: 0xa6, 0x491: 0xa6, 0x492: 0xa6, 0x493: 0xa6, 0x494: 0xa6, 0x495: 0xa6, 0x496: 0xa6, 0x497: 0xa6, + 0x498: 0xa6, 0x499: 0x14a, 0x49a: 0x100, 0x49b: 0x100, 0x49c: 0x100, 0x49d: 0x100, 0x49e: 0x100, 0x49f: 0x100, + 0x4a0: 0x100, 0x4a1: 0x100, 0x4a2: 0x100, 0x4a3: 0x100, 0x4a4: 0x100, 0x4a5: 0x100, 0x4a6: 0x100, 0x4a7: 0x100, + 0x4a8: 0x100, 0x4a9: 0x100, 0x4aa: 0x100, 0x4ab: 0x100, 0x4ac: 0x100, 0x4ad: 0x100, 0x4ae: 0x100, 0x4af: 0x100, + 0x4b0: 0x100, 0x4b1: 0x100, 0x4b2: 0x100, 0x4b3: 0x100, 0x4b4: 0x100, 0x4b5: 0x100, 0x4b6: 0x100, 0x4b7: 0x100, + 0x4b8: 0x100, 0x4b9: 0x100, 0x4ba: 0x100, 0x4bb: 0x100, 0x4bc: 0x100, 0x4bd: 0x100, 0x4be: 0x100, 0x4bf: 0x100, + // Block 0x13, offset 0x4c0 + 0x4c0: 0x100, 0x4c1: 0x100, 0x4c2: 0x100, 0x4c3: 0x100, 0x4c4: 0x100, 0x4c5: 0x100, 0x4c6: 0x100, 0x4c7: 0x100, + 0x4c8: 0x100, 0x4c9: 0x100, 0x4ca: 0x100, 0x4cb: 0x100, 0x4cc: 0x100, 0x4cd: 0x100, 0x4ce: 0x100, 0x4cf: 0x100, + 0x4d0: 0x100, 0x4d1: 0x100, 0x4d2: 0x100, 0x4d3: 0x100, 0x4d4: 0x100, 0x4d5: 0x100, 0x4d6: 0x100, 0x4d7: 0x100, + 0x4d8: 0x100, 0x4d9: 0x100, 0x4da: 0x100, 0x4db: 0x100, 0x4dc: 0x100, 0x4dd: 0x100, 0x4de: 0x100, 0x4df: 0x100, + 0x4e0: 0xa6, 0x4e1: 0xa6, 0x4e2: 0xa6, 0x4e3: 0xa6, 0x4e4: 0xa6, 0x4e5: 0xa6, 0x4e6: 0xa6, 0x4e7: 0xa6, + 0x4e8: 0x154, 0x4e9: 0x168, 0x4ea: 0x169, 0x4eb: 0x16a, 0x4ec: 0x16b, 0x4ed: 0x16c, 0x4ee: 0x16d, 0x4ef: 0x100, + 0x4f0: 0x100, 0x4f1: 0x100, 0x4f2: 0x100, 0x4f3: 0x100, 0x4f4: 0x100, 0x4f5: 0x100, 0x4f6: 0x100, 0x4f7: 0x100, + 0x4f8: 0x100, 0x4f9: 0x16e, 0x4fa: 0x16f, 0x4fb: 0x100, 0x4fc: 0xa6, 0x4fd: 0x170, 0x4fe: 0x171, 0x4ff: 0x172, + // Block 0x14, offset 0x500 + 0x500: 0xa6, 0x501: 0xa6, 0x502: 0xa6, 0x503: 0xa6, 0x504: 0xa6, 0x505: 0xa6, 0x506: 0xa6, 0x507: 0xa6, + 0x508: 0xa6, 0x509: 0xa6, 0x50a: 0xa6, 0x50b: 0xa6, 0x50c: 0xa6, 0x50d: 0xa6, 0x50e: 0xa6, 0x50f: 0xa6, + 0x510: 0xa6, 0x511: 0xa6, 0x512: 0xa6, 0x513: 0xa6, 0x514: 0xa6, 0x515: 0xa6, 0x516: 0xa6, 0x517: 0xa6, + 0x518: 0xa6, 0x519: 0xa6, 0x51a: 0xa6, 0x51b: 0xa6, 0x51c: 0xa6, 0x51d: 0xa6, 0x51e: 0xa6, 0x51f: 0x173, + 0x520: 0xa6, 0x521: 0xa6, 0x522: 0xa6, 0x523: 0xa6, 0x524: 0xa6, 0x525: 0xa6, 0x526: 0xa6, 0x527: 0xa6, + 0x528: 0xa6, 0x529: 0xa6, 0x52a: 0xa6, 0x52b: 0xa6, 0x52c: 0xa6, 0x52d: 0xa6, 0x52e: 0xa6, 0x52f: 0xa6, + 0x530: 0xa6, 0x531: 0xa6, 0x532: 0xa6, 0x533: 0x174, 0x534: 0x175, 0x535: 0x100, 0x536: 0x100, 0x537: 0x100, + 0x538: 0x100, 0x539: 0x100, 0x53a: 0x100, 0x53b: 0x100, 0x53c: 0x100, 0x53d: 0x100, 0x53e: 0x100, 0x53f: 0x100, + // Block 0x15, offset 0x540 + 0x540: 0x100, 0x541: 0x100, 0x542: 0x100, 0x543: 0x100, 0x544: 0x100, 0x545: 0x100, 0x546: 0x100, 0x547: 0x100, + 0x548: 0x100, 0x549: 0x100, 0x54a: 0x100, 0x54b: 0x100, 0x54c: 0x100, 0x54d: 0x100, 0x54e: 0x100, 0x54f: 0x100, + 0x550: 0x100, 0x551: 0x100, 0x552: 0x100, 0x553: 0x100, 0x554: 0x100, 0x555: 0x100, 0x556: 0x100, 0x557: 0x100, + 0x558: 0x100, 0x559: 0x100, 0x55a: 0x100, 0x55b: 0x100, 0x55c: 0x100, 0x55d: 0x100, 0x55e: 0x100, 0x55f: 0x100, + 0x560: 0x100, 0x561: 0x100, 0x562: 0x100, 0x563: 0x100, 0x564: 0x100, 0x565: 0x100, 0x566: 0x100, 0x567: 0x100, + 0x568: 0x100, 0x569: 0x100, 0x56a: 0x100, 0x56b: 0x100, 0x56c: 0x100, 0x56d: 0x100, 0x56e: 0x100, 0x56f: 0x100, + 0x570: 0x100, 0x571: 0x100, 0x572: 0x100, 0x573: 0x100, 0x574: 0x100, 0x575: 0x100, 0x576: 0x100, 0x577: 0x100, + 0x578: 0x100, 0x579: 0x100, 0x57a: 0x100, 0x57b: 0x100, 0x57c: 0x100, 0x57d: 0x100, 0x57e: 0x100, 0x57f: 0x176, + // Block 0x16, offset 0x580 + 0x580: 0xa6, 0x581: 0xa6, 0x582: 0xa6, 0x583: 0xa6, 0x584: 0x177, 0x585: 0x178, 0x586: 0xa6, 0x587: 0xa6, + 0x588: 0xa6, 0x589: 0xa6, 0x58a: 0xa6, 0x58b: 0x179, 0x58c: 0x100, 0x58d: 0x100, 0x58e: 0x100, 0x58f: 0x100, + 0x590: 0x100, 0x591: 0x100, 0x592: 0x100, 0x593: 0x100, 0x594: 0x100, 0x595: 0x100, 0x596: 0x100, 0x597: 0x100, + 0x598: 0x100, 0x599: 0x100, 0x59a: 0x100, 0x59b: 0x100, 0x59c: 0x100, 0x59d: 0x100, 0x59e: 0x100, 0x59f: 0x100, + 0x5a0: 0x100, 0x5a1: 0x100, 0x5a2: 0x100, 0x5a3: 0x100, 0x5a4: 0x100, 0x5a5: 0x100, 0x5a6: 0x100, 0x5a7: 0x100, + 0x5a8: 0x100, 0x5a9: 0x100, 0x5aa: 0x100, 0x5ab: 0x100, 0x5ac: 0x100, 0x5ad: 0x100, 0x5ae: 0x100, 0x5af: 0x100, + 0x5b0: 0xa6, 0x5b1: 0x17a, 0x5b2: 0x17b, 0x5b3: 0x100, 0x5b4: 0x100, 0x5b5: 0x100, 0x5b6: 0x100, 0x5b7: 0x100, + 0x5b8: 0x100, 0x5b9: 0x100, 0x5ba: 0x100, 0x5bb: 0x100, 0x5bc: 0x100, 0x5bd: 0x100, 0x5be: 0x100, 0x5bf: 0x100, + // Block 0x17, offset 0x5c0 + 0x5c0: 0x100, 0x5c1: 0x100, 0x5c2: 0x100, 0x5c3: 0x100, 0x5c4: 0x100, 0x5c5: 0x100, 0x5c6: 0x100, 0x5c7: 0x100, + 0x5c8: 0x100, 0x5c9: 0x100, 0x5ca: 0x100, 0x5cb: 0x100, 0x5cc: 0x100, 0x5cd: 0x100, 0x5ce: 0x100, 0x5cf: 0x100, + 0x5d0: 0x100, 0x5d1: 0x100, 0x5d2: 0x100, 0x5d3: 0x100, 0x5d4: 0x100, 0x5d5: 0x100, 0x5d6: 0x100, 0x5d7: 0x100, + 0x5d8: 0x100, 0x5d9: 0x100, 0x5da: 0x100, 0x5db: 0x100, 0x5dc: 0x100, 0x5dd: 0x100, 0x5de: 0x100, 0x5df: 0x100, + 0x5e0: 0x100, 0x5e1: 0x100, 0x5e2: 0x100, 0x5e3: 0x100, 0x5e4: 0x100, 0x5e5: 0x100, 0x5e6: 0x100, 0x5e7: 0x100, + 0x5e8: 0x100, 0x5e9: 0x100, 0x5ea: 0x100, 0x5eb: 0x100, 0x5ec: 0x100, 0x5ed: 0x100, 0x5ee: 0x100, 0x5ef: 0x100, + 0x5f0: 0x100, 0x5f1: 0x100, 0x5f2: 0x100, 0x5f3: 0x100, 0x5f4: 0x100, 0x5f5: 0x100, 0x5f6: 0x100, 0x5f7: 0x100, + 0x5f8: 0x100, 0x5f9: 0x100, 0x5fa: 0x100, 0x5fb: 0x100, 0x5fc: 0x17c, 0x5fd: 0x17d, 0x5fe: 0xa2, 0x5ff: 0x17e, + // Block 0x18, offset 0x600 + 0x600: 0xa2, 0x601: 0xa2, 0x602: 0xa2, 0x603: 0x17f, 0x604: 0x180, 0x605: 0x181, 0x606: 0x182, 0x607: 0x183, + 0x608: 0xa2, 0x609: 0x184, 0x60a: 0x100, 0x60b: 0x185, 0x60c: 0xa2, 0x60d: 0x186, 0x60e: 0x100, 0x60f: 0x100, + 0x610: 0x63, 0x611: 0x64, 0x612: 0x65, 0x613: 0x66, 0x614: 0x67, 0x615: 0x68, 0x616: 0x69, 0x617: 0x6a, + 0x618: 0x6b, 0x619: 0x6c, 0x61a: 0x6d, 0x61b: 0x6e, 0x61c: 0x6f, 0x61d: 0x70, 0x61e: 0x71, 0x61f: 0x72, + 0x620: 0xa2, 0x621: 0xa2, 0x622: 0xa2, 0x623: 0xa2, 0x624: 0xa2, 0x625: 0xa2, 0x626: 0xa2, 0x627: 0xa2, + 0x628: 0x187, 0x629: 0x188, 0x62a: 0x189, 0x62b: 0x100, 0x62c: 0x100, 0x62d: 0x100, 0x62e: 0x100, 0x62f: 0x100, + 0x630: 0x100, 0x631: 0x100, 0x632: 0x100, 0x633: 0x100, 0x634: 0x100, 0x635: 0x100, 0x636: 0x100, 0x637: 0x100, + 0x638: 0x100, 0x639: 0x100, 0x63a: 0x100, 0x63b: 0x100, 0x63c: 0x18a, 0x63d: 0x100, 0x63e: 0x100, 0x63f: 0x100, + // Block 0x19, offset 0x640 + 0x640: 0x73, 0x641: 0x74, 0x642: 0x18b, 0x643: 0x100, 0x644: 0x18c, 0x645: 0x18d, 0x646: 0x100, 0x647: 0x100, + 0x648: 0x100, 0x649: 0x100, 0x64a: 0x18e, 0x64b: 0x18f, 0x64c: 0x100, 0x64d: 0x100, 0x64e: 0x100, 0x64f: 0x100, + 0x650: 0x100, 0x651: 0x100, 0x652: 0x100, 0x653: 0x190, 0x654: 0x100, 0x655: 0x100, 0x656: 0x100, 0x657: 0x100, + 0x658: 0x100, 0x659: 0x100, 0x65a: 0x100, 0x65b: 0x100, 0x65c: 0x100, 0x65d: 0x100, 0x65e: 0x100, 0x65f: 0x191, + 0x660: 0x127, 0x661: 0x127, 0x662: 0x127, 0x663: 0x192, 0x664: 0x75, 0x665: 0x193, 0x666: 0x100, 0x667: 0x100, + 0x668: 0x100, 0x669: 0x100, 0x66a: 0x100, 0x66b: 0x100, 0x66c: 0x100, 0x66d: 0x100, 0x66e: 0x100, 0x66f: 0x100, + 0x670: 0x100, 0x671: 0x194, 0x672: 0x195, 0x673: 0x100, 0x674: 0x196, 0x675: 0x100, 0x676: 0x100, 0x677: 0x100, + 0x678: 0x76, 0x679: 0x77, 0x67a: 0x78, 0x67b: 0x197, 0x67c: 0x100, 0x67d: 0x100, 0x67e: 0x100, 0x67f: 0x100, + // Block 0x1a, offset 0x680 + 0x680: 0x198, 0x681: 0xa2, 0x682: 0x199, 0x683: 0x19a, 0x684: 0x79, 0x685: 0x7a, 0x686: 0x19b, 0x687: 0x19c, + 0x688: 0x7b, 0x689: 0x19d, 0x68a: 0x100, 0x68b: 0x100, 0x68c: 0xa2, 0x68d: 0xa2, 0x68e: 0xa2, 0x68f: 0xa2, + 0x690: 0xa2, 0x691: 0xa2, 0x692: 0xa2, 0x693: 0xa2, 0x694: 0xa2, 0x695: 0xa2, 0x696: 0xa2, 0x697: 0xa2, + 0x698: 0xa2, 0x699: 0xa2, 0x69a: 0xa2, 0x69b: 0x19e, 0x69c: 0xa2, 0x69d: 0x19f, 0x69e: 0xa2, 0x69f: 0x1a0, + 0x6a0: 0x1a1, 0x6a1: 0x1a2, 0x6a2: 0x1a3, 0x6a3: 0x100, 0x6a4: 0xa2, 0x6a5: 0xa2, 0x6a6: 0xa2, 0x6a7: 0xa2, + 0x6a8: 0xa2, 0x6a9: 0x1a4, 0x6aa: 0x1a5, 0x6ab: 0x1a6, 0x6ac: 0xa2, 0x6ad: 0xa2, 0x6ae: 0x1a7, 0x6af: 0x1a8, + 0x6b0: 0x100, 0x6b1: 0x100, 0x6b2: 0x100, 0x6b3: 0x100, 0x6b4: 0x100, 0x6b5: 0x100, 0x6b6: 0x100, 0x6b7: 0x100, + 0x6b8: 0x100, 0x6b9: 0x100, 0x6ba: 0x100, 0x6bb: 0x100, 0x6bc: 0x100, 0x6bd: 0x100, 0x6be: 0x100, 0x6bf: 0x100, + // Block 0x1b, offset 0x6c0 + 0x6c0: 0xa6, 0x6c1: 0xa6, 0x6c2: 0xa6, 0x6c3: 0xa6, 0x6c4: 0xa6, 0x6c5: 0xa6, 0x6c6: 0xa6, 0x6c7: 0xa6, + 0x6c8: 0xa6, 0x6c9: 0xa6, 0x6ca: 0xa6, 0x6cb: 0xa6, 0x6cc: 0xa6, 0x6cd: 0xa6, 0x6ce: 0xa6, 0x6cf: 0xa6, + 0x6d0: 0xa6, 0x6d1: 0xa6, 0x6d2: 0xa6, 0x6d3: 0xa6, 0x6d4: 0xa6, 0x6d5: 0xa6, 0x6d6: 0xa6, 0x6d7: 0xa6, + 0x6d8: 0xa6, 0x6d9: 0xa6, 0x6da: 0xa6, 0x6db: 0x1a9, 0x6dc: 0xa6, 0x6dd: 0xa6, 0x6de: 0xa6, 0x6df: 0xa6, + 0x6e0: 0xa6, 0x6e1: 0xa6, 0x6e2: 0xa6, 0x6e3: 0xa6, 0x6e4: 0xa6, 0x6e5: 0xa6, 0x6e6: 0xa6, 0x6e7: 0xa6, + 0x6e8: 0xa6, 0x6e9: 0xa6, 0x6ea: 0xa6, 0x6eb: 0xa6, 0x6ec: 0xa6, 0x6ed: 0xa6, 0x6ee: 0xa6, 0x6ef: 0xa6, + 0x6f0: 0xa6, 0x6f1: 0xa6, 0x6f2: 0xa6, 0x6f3: 0xa6, 0x6f4: 0xa6, 0x6f5: 0xa6, 0x6f6: 0xa6, 0x6f7: 0xa6, + 0x6f8: 0xa6, 0x6f9: 0xa6, 0x6fa: 0xa6, 0x6fb: 0xa6, 0x6fc: 0xa6, 0x6fd: 0xa6, 0x6fe: 0xa6, 0x6ff: 0xa6, + // Block 0x1c, offset 0x700 + 0x700: 0xa6, 0x701: 0xa6, 0x702: 0xa6, 0x703: 0xa6, 0x704: 0xa6, 0x705: 0xa6, 0x706: 0xa6, 0x707: 0xa6, + 0x708: 0xa6, 0x709: 0xa6, 0x70a: 0xa6, 0x70b: 0xa6, 0x70c: 0xa6, 0x70d: 0xa6, 0x70e: 0xa6, 0x70f: 0xa6, + 0x710: 0xa6, 0x711: 0xa6, 0x712: 0xa6, 0x713: 0xa6, 0x714: 0xa6, 0x715: 0xa6, 0x716: 0xa6, 0x717: 0xa6, + 0x718: 0xa6, 0x719: 0xa6, 0x71a: 0xa6, 0x71b: 0xa6, 0x71c: 0x1aa, 0x71d: 0xa6, 0x71e: 0xa6, 0x71f: 0xa6, + 0x720: 0x1ab, 0x721: 0xa6, 0x722: 0xa6, 0x723: 0xa6, 0x724: 0xa6, 0x725: 0xa6, 0x726: 0xa6, 0x727: 0xa6, + 0x728: 0xa6, 0x729: 0xa6, 0x72a: 0xa6, 0x72b: 0xa6, 0x72c: 0xa6, 0x72d: 0xa6, 0x72e: 0xa6, 0x72f: 0xa6, + 0x730: 0xa6, 0x731: 0xa6, 0x732: 0xa6, 0x733: 0xa6, 0x734: 0xa6, 0x735: 0xa6, 0x736: 0xa6, 0x737: 0xa6, + 0x738: 0xa6, 0x739: 0xa6, 0x73a: 0xa6, 0x73b: 0xa6, 0x73c: 0xa6, 0x73d: 0xa6, 0x73e: 0xa6, 0x73f: 0xa6, + // Block 0x1d, offset 0x740 + 0x740: 0xa6, 0x741: 0xa6, 0x742: 0xa6, 0x743: 0xa6, 0x744: 0xa6, 0x745: 0xa6, 0x746: 0xa6, 0x747: 0xa6, + 0x748: 0xa6, 0x749: 0xa6, 0x74a: 0xa6, 0x74b: 0xa6, 0x74c: 0xa6, 0x74d: 0xa6, 0x74e: 0xa6, 0x74f: 0xa6, + 0x750: 0xa6, 0x751: 0xa6, 0x752: 0xa6, 0x753: 0xa6, 0x754: 0xa6, 0x755: 0xa6, 0x756: 0xa6, 0x757: 0xa6, + 0x758: 0xa6, 0x759: 0xa6, 0x75a: 0xa6, 0x75b: 0xa6, 0x75c: 0xa6, 0x75d: 0xa6, 0x75e: 0xa6, 0x75f: 0xa6, + 0x760: 0xa6, 0x761: 0xa6, 0x762: 0xa6, 0x763: 0xa6, 0x764: 0xa6, 0x765: 0xa6, 0x766: 0xa6, 0x767: 0xa6, + 0x768: 0xa6, 0x769: 0xa6, 0x76a: 0xa6, 0x76b: 0xa6, 0x76c: 0xa6, 0x76d: 0xa6, 0x76e: 0xa6, 0x76f: 0xa6, + 0x770: 0xa6, 0x771: 0xa6, 0x772: 0xa6, 0x773: 0xa6, 0x774: 0xa6, 0x775: 0xa6, 0x776: 0xa6, 0x777: 0xa6, + 0x778: 0xa6, 0x779: 0xa6, 0x77a: 0x1ac, 0x77b: 0xa6, 0x77c: 0xa6, 0x77d: 0xa6, 0x77e: 0xa6, 0x77f: 0xa6, + // Block 0x1e, offset 0x780 + 0x780: 0xa6, 0x781: 0xa6, 0x782: 0xa6, 0x783: 0xa6, 0x784: 0xa6, 0x785: 0xa6, 0x786: 0xa6, 0x787: 0xa6, + 0x788: 0xa6, 0x789: 0xa6, 0x78a: 0xa6, 0x78b: 0xa6, 0x78c: 0xa6, 0x78d: 0xa6, 0x78e: 0xa6, 0x78f: 0xa6, + 0x790: 0xa6, 0x791: 0xa6, 0x792: 0xa6, 0x793: 0xa6, 0x794: 0xa6, 0x795: 0xa6, 0x796: 0xa6, 0x797: 0xa6, + 0x798: 0xa6, 0x799: 0xa6, 0x79a: 0xa6, 0x79b: 0xa6, 0x79c: 0xa6, 0x79d: 0xa6, 0x79e: 0xa6, 0x79f: 0xa6, + 0x7a0: 0xa6, 0x7a1: 0xa6, 0x7a2: 0xa6, 0x7a3: 0xa6, 0x7a4: 0xa6, 0x7a5: 0xa6, 0x7a6: 0xa6, 0x7a7: 0xa6, + 0x7a8: 0xa6, 0x7a9: 0xa6, 0x7aa: 0xa6, 0x7ab: 0xa6, 0x7ac: 0xa6, 0x7ad: 0xa6, 0x7ae: 0xa6, 0x7af: 0x1ad, + 0x7b0: 0x100, 0x7b1: 0x100, 0x7b2: 0x100, 0x7b3: 0x100, 0x7b4: 0x100, 0x7b5: 0x100, 0x7b6: 0x100, 0x7b7: 0x100, + 0x7b8: 0x100, 0x7b9: 0x100, 0x7ba: 0x100, 0x7bb: 0x100, 0x7bc: 0x100, 0x7bd: 0x100, 0x7be: 0x100, 0x7bf: 0x100, + // Block 0x1f, offset 0x7c0 + 0x7c0: 0x100, 0x7c1: 0x100, 0x7c2: 0x100, 0x7c3: 0x100, 0x7c4: 0x100, 0x7c5: 0x100, 0x7c6: 0x100, 0x7c7: 0x100, + 0x7c8: 0x100, 0x7c9: 0x100, 0x7ca: 0x100, 0x7cb: 0x100, 0x7cc: 0x100, 0x7cd: 0x100, 0x7ce: 0x100, 0x7cf: 0x100, + 0x7d0: 0x100, 0x7d1: 0x100, 0x7d2: 0x100, 0x7d3: 0x100, 0x7d4: 0x100, 0x7d5: 0x100, 0x7d6: 0x100, 0x7d7: 0x100, + 0x7d8: 0x100, 0x7d9: 0x100, 0x7da: 0x100, 0x7db: 0x100, 0x7dc: 0x100, 0x7dd: 0x100, 0x7de: 0x100, 0x7df: 0x100, + 0x7e0: 0x7c, 0x7e1: 0x7d, 0x7e2: 0x7e, 0x7e3: 0x7f, 0x7e4: 0x80, 0x7e5: 0x81, 0x7e6: 0x82, 0x7e7: 0x83, + 0x7e8: 0x84, 0x7e9: 0x100, 0x7ea: 0x100, 0x7eb: 0x100, 0x7ec: 0x100, 0x7ed: 0x100, 0x7ee: 0x100, 0x7ef: 0x100, + 0x7f0: 0x100, 0x7f1: 0x100, 0x7f2: 0x100, 0x7f3: 0x100, 0x7f4: 0x100, 0x7f5: 0x100, 0x7f6: 0x100, 0x7f7: 0x100, + 0x7f8: 0x100, 0x7f9: 0x100, 0x7fa: 0x100, 0x7fb: 0x100, 0x7fc: 0x100, 0x7fd: 0x100, 0x7fe: 0x100, 0x7ff: 0x100, + // Block 0x20, offset 0x800 + 0x800: 0xa6, 0x801: 0xa6, 0x802: 0xa6, 0x803: 0xa6, 0x804: 0xa6, 0x805: 0xa6, 0x806: 0xa6, 0x807: 0xa6, + 0x808: 0xa6, 0x809: 0xa6, 0x80a: 0xa6, 0x80b: 0xa6, 0x80c: 0xa6, 0x80d: 0x1ae, 0x80e: 0xa6, 0x80f: 0xa6, + 0x810: 0xa6, 0x811: 0xa6, 0x812: 0xa6, 0x813: 0xa6, 0x814: 0xa6, 0x815: 0xa6, 0x816: 0xa6, 0x817: 0xa6, + 0x818: 0xa6, 0x819: 0xa6, 0x81a: 0xa6, 0x81b: 0xa6, 0x81c: 0xa6, 0x81d: 0xa6, 0x81e: 0xa6, 0x81f: 0xa6, + 0x820: 0xa6, 0x821: 0xa6, 0x822: 0xa6, 0x823: 0xa6, 0x824: 0xa6, 0x825: 0xa6, 0x826: 0xa6, 0x827: 0xa6, + 0x828: 0xa6, 0x829: 0xa6, 0x82a: 0xa6, 0x82b: 0xa6, 0x82c: 0xa6, 0x82d: 0xa6, 0x82e: 0xa6, 0x82f: 0xa6, + 0x830: 0xa6, 0x831: 0xa6, 0x832: 0xa6, 0x833: 0xa6, 0x834: 0xa6, 0x835: 0xa6, 0x836: 0xa6, 0x837: 0xa6, + 0x838: 0xa6, 0x839: 0xa6, 0x83a: 0xa6, 0x83b: 0xa6, 0x83c: 0xa6, 0x83d: 0xa6, 0x83e: 0xa6, 0x83f: 0xa6, + // Block 0x21, offset 0x840 + 0x840: 0xa6, 0x841: 0xa6, 0x842: 0xa6, 0x843: 0xa6, 0x844: 0xa6, 0x845: 0xa6, 0x846: 0xa6, 0x847: 0xa6, + 0x848: 0xa6, 0x849: 0xa6, 0x84a: 0xa6, 0x84b: 0xa6, 0x84c: 0xa6, 0x84d: 0xa6, 0x84e: 0x1af, 0x84f: 0x100, + 0x850: 0x100, 0x851: 0x100, 0x852: 0x100, 0x853: 0x100, 0x854: 0x100, 0x855: 0x100, 0x856: 0x100, 0x857: 0x100, + 0x858: 0x100, 0x859: 0x100, 0x85a: 0x100, 0x85b: 0x100, 0x85c: 0x100, 0x85d: 0x100, 0x85e: 0x100, 0x85f: 0x100, + 0x860: 0x100, 0x861: 0x100, 0x862: 0x100, 0x863: 0x100, 0x864: 0x100, 0x865: 0x100, 0x866: 0x100, 0x867: 0x100, + 0x868: 0x100, 0x869: 0x100, 0x86a: 0x100, 0x86b: 0x100, 0x86c: 0x100, 0x86d: 0x100, 0x86e: 0x100, 0x86f: 0x100, + 0x870: 0x100, 0x871: 0x100, 0x872: 0x100, 0x873: 0x100, 0x874: 0x100, 0x875: 0x100, 0x876: 0x100, 0x877: 0x100, + 0x878: 0x100, 0x879: 0x100, 0x87a: 0x100, 0x87b: 0x100, 0x87c: 0x100, 0x87d: 0x100, 0x87e: 0x100, 0x87f: 0x100, + // Block 0x22, offset 0x880 + 0x890: 0x0c, 0x891: 0x0d, 0x892: 0x0e, 0x893: 0x0f, 0x894: 0x10, 0x895: 0x0a, 0x896: 0x11, 0x897: 0x07, + 0x898: 0x12, 0x899: 0x0a, 0x89a: 0x13, 0x89b: 0x14, 0x89c: 0x15, 0x89d: 0x16, 0x89e: 0x17, 0x89f: 0x18, + 0x8a0: 0x07, 0x8a1: 0x07, 0x8a2: 0x07, 0x8a3: 0x07, 0x8a4: 0x07, 0x8a5: 0x07, 0x8a6: 0x07, 0x8a7: 0x07, + 0x8a8: 0x07, 0x8a9: 0x07, 0x8aa: 0x19, 0x8ab: 0x1a, 0x8ac: 0x1b, 0x8ad: 0x07, 0x8ae: 0x1c, 0x8af: 0x1d, + 0x8b0: 0x07, 0x8b1: 0x1e, 0x8b2: 0x1f, 0x8b3: 0x0a, 0x8b4: 0x0a, 0x8b5: 0x0a, 0x8b6: 0x0a, 0x8b7: 0x0a, + 0x8b8: 0x0a, 0x8b9: 0x0a, 0x8ba: 0x0a, 0x8bb: 0x0a, 0x8bc: 0x0a, 0x8bd: 0x0a, 0x8be: 0x0a, 0x8bf: 0x0a, + // Block 0x23, offset 0x8c0 + 0x8c0: 0x0a, 0x8c1: 0x0a, 0x8c2: 0x0a, 0x8c3: 0x0a, 0x8c4: 0x0a, 0x8c5: 0x0a, 0x8c6: 0x0a, 0x8c7: 0x0a, + 0x8c8: 0x0a, 0x8c9: 0x0a, 0x8ca: 0x0a, 0x8cb: 0x0a, 0x8cc: 0x0a, 0x8cd: 0x0a, 0x8ce: 0x0a, 0x8cf: 0x0a, + 0x8d0: 0x0a, 0x8d1: 0x0a, 0x8d2: 0x0a, 0x8d3: 0x0a, 0x8d4: 0x0a, 0x8d5: 0x0a, 0x8d6: 0x0a, 0x8d7: 0x0a, + 0x8d8: 0x0a, 0x8d9: 0x0a, 0x8da: 0x0a, 0x8db: 0x0a, 0x8dc: 0x0a, 0x8dd: 0x0a, 0x8de: 0x0a, 0x8df: 0x0a, + 0x8e0: 0x0a, 0x8e1: 0x0a, 0x8e2: 0x0a, 0x8e3: 0x0a, 0x8e4: 0x0a, 0x8e5: 0x0a, 0x8e6: 0x0a, 0x8e7: 0x0a, + 0x8e8: 0x0a, 0x8e9: 0x0a, 0x8ea: 0x0a, 0x8eb: 0x0a, 0x8ec: 0x0a, 0x8ed: 0x0a, 0x8ee: 0x0a, 0x8ef: 0x0a, + 0x8f0: 0x0a, 0x8f1: 0x0a, 0x8f2: 0x0a, 0x8f3: 0x0a, 0x8f4: 0x0a, 0x8f5: 0x0a, 0x8f6: 0x0a, 0x8f7: 0x0a, + 0x8f8: 0x0a, 0x8f9: 0x0a, 0x8fa: 0x0a, 0x8fb: 0x0a, 0x8fc: 0x0a, 0x8fd: 0x0a, 0x8fe: 0x0a, 0x8ff: 0x0a, + // Block 0x24, offset 0x900 + 0x900: 0x1b0, 0x901: 0x1b1, 0x902: 0x100, 0x903: 0x100, 0x904: 0x1b2, 0x905: 0x1b2, 0x906: 0x1b2, 0x907: 0x1b3, + 0x908: 0x100, 0x909: 0x100, 0x90a: 0x100, 0x90b: 0x100, 0x90c: 0x100, 0x90d: 0x100, 0x90e: 0x100, 0x90f: 0x100, + 0x910: 0x100, 0x911: 0x100, 0x912: 0x100, 0x913: 0x100, 0x914: 0x100, 0x915: 0x100, 0x916: 0x100, 0x917: 0x100, + 0x918: 0x100, 0x919: 0x100, 0x91a: 0x100, 0x91b: 0x100, 0x91c: 0x100, 0x91d: 0x100, 0x91e: 0x100, 0x91f: 0x100, + 0x920: 0x100, 0x921: 0x100, 0x922: 0x100, 0x923: 0x100, 0x924: 0x100, 0x925: 0x100, 0x926: 0x100, 0x927: 0x100, + 0x928: 0x100, 0x929: 0x100, 0x92a: 0x100, 0x92b: 0x100, 0x92c: 0x100, 0x92d: 0x100, 0x92e: 0x100, 0x92f: 0x100, + 0x930: 0x100, 0x931: 0x100, 0x932: 0x100, 0x933: 0x100, 0x934: 0x100, 0x935: 0x100, 0x936: 0x100, 0x937: 0x100, + 0x938: 0x100, 0x939: 0x100, 0x93a: 0x100, 0x93b: 0x100, 0x93c: 0x100, 0x93d: 0x100, 0x93e: 0x100, 0x93f: 0x100, + // Block 0x25, offset 0x940 + 0x940: 0x0a, 0x941: 0x0a, 0x942: 0x0a, 0x943: 0x0a, 0x944: 0x0a, 0x945: 0x0a, 0x946: 0x0a, 0x947: 0x0a, + 0x948: 0x0a, 0x949: 0x0a, 0x94a: 0x0a, 0x94b: 0x0a, 0x94c: 0x0a, 0x94d: 0x0a, 0x94e: 0x0a, 0x94f: 0x0a, + 0x950: 0x0a, 0x951: 0x0a, 0x952: 0x0a, 0x953: 0x0a, 0x954: 0x0a, 0x955: 0x0a, 0x956: 0x0a, 0x957: 0x0a, + 0x958: 0x0a, 0x959: 0x0a, 0x95a: 0x0a, 0x95b: 0x0a, 0x95c: 0x0a, 0x95d: 0x0a, 0x95e: 0x0a, 0x95f: 0x0a, + 0x960: 0x22, 0x961: 0x0a, 0x962: 0x0a, 0x963: 0x0a, 0x964: 0x0a, 0x965: 0x0a, 0x966: 0x0a, 0x967: 0x0a, + 0x968: 0x0a, 0x969: 0x0a, 0x96a: 0x0a, 0x96b: 0x0a, 0x96c: 0x0a, 0x96d: 0x0a, 0x96e: 0x0a, 0x96f: 0x0a, + 0x970: 0x0a, 0x971: 0x0a, 0x972: 0x0a, 0x973: 0x0a, 0x974: 0x0a, 0x975: 0x0a, 0x976: 0x0a, 0x977: 0x0a, + 0x978: 0x0a, 0x979: 0x0a, 0x97a: 0x0a, 0x97b: 0x0a, 0x97c: 0x0a, 0x97d: 0x0a, 0x97e: 0x0a, 0x97f: 0x0a, + // Block 0x26, offset 0x980 + 0x980: 0x0a, 0x981: 0x0a, 0x982: 0x0a, 0x983: 0x0a, 0x984: 0x0a, 0x985: 0x0a, 0x986: 0x0a, 0x987: 0x0a, + 0x988: 0x0a, 0x989: 0x0a, 0x98a: 0x0a, 0x98b: 0x0a, 0x98c: 0x0a, 0x98d: 0x0a, 0x98e: 0x0a, 0x98f: 0x0a, +} + +// idnaSparseOffset: 303 entries, 606 bytes +var idnaSparseOffset = []uint16{0x0, 0x8, 0x19, 0x25, 0x27, 0x2c, 0x33, 0x3e, 0x4a, 0x4e, 0x5d, 0x62, 0x6c, 0x78, 0x7e, 0x87, 0x97, 0xa6, 0xb1, 0xbe, 0xcf, 0xd9, 0xe0, 0xed, 0xfe, 0x105, 0x110, 0x11f, 0x12d, 0x137, 0x139, 0x13e, 0x141, 0x144, 0x146, 0x152, 0x15d, 0x165, 0x16b, 0x171, 0x176, 0x17b, 0x17e, 0x182, 0x188, 0x18d, 0x198, 0x1a2, 0x1a8, 0x1b9, 0x1c4, 0x1c7, 0x1cf, 0x1d2, 0x1df, 0x1e7, 0x1eb, 0x1f2, 0x1fa, 0x20a, 0x216, 0x219, 0x223, 0x22f, 0x23b, 0x247, 0x24f, 0x254, 0x261, 0x272, 0x27d, 0x282, 0x28b, 0x293, 0x299, 0x29e, 0x2a1, 0x2a5, 0x2ab, 0x2af, 0x2b3, 0x2b7, 0x2bc, 0x2c4, 0x2cb, 0x2d6, 0x2e0, 0x2e4, 0x2e7, 0x2ed, 0x2f1, 0x2f3, 0x2f6, 0x2f8, 0x2fb, 0x305, 0x308, 0x317, 0x31b, 0x31f, 0x321, 0x32a, 0x32e, 0x333, 0x338, 0x33e, 0x34e, 0x354, 0x358, 0x367, 0x36c, 0x374, 0x37e, 0x389, 0x391, 0x3a2, 0x3ab, 0x3bb, 0x3c8, 0x3d4, 0x3d9, 0x3e6, 0x3ea, 0x3ef, 0x3f1, 0x3f3, 0x3f7, 0x3f9, 0x3fd, 0x406, 0x40c, 0x410, 0x420, 0x42a, 0x42f, 0x432, 0x438, 0x43f, 0x444, 0x448, 0x44e, 0x453, 0x45c, 0x461, 0x467, 0x46e, 0x475, 0x47c, 0x480, 0x483, 0x488, 0x494, 0x49a, 0x49f, 0x4a6, 0x4ae, 0x4b3, 0x4b7, 0x4c7, 0x4ce, 0x4d2, 0x4d6, 0x4dd, 0x4df, 0x4e2, 0x4e5, 0x4e9, 0x4f2, 0x4f6, 0x4fe, 0x501, 0x509, 0x514, 0x523, 0x52f, 0x535, 0x542, 0x54e, 0x556, 0x55f, 0x56a, 0x571, 0x580, 0x58d, 0x591, 0x59e, 0x5a7, 0x5ab, 0x5ba, 0x5c2, 0x5cd, 0x5d6, 0x5dc, 0x5e4, 0x5ed, 0x5f9, 0x5fc, 0x608, 0x60b, 0x614, 0x617, 0x61c, 0x625, 0x62a, 0x637, 0x642, 0x64b, 0x656, 0x659, 0x65c, 0x666, 0x66f, 0x67b, 0x688, 0x695, 0x6a3, 0x6aa, 0x6b5, 0x6bc, 0x6c0, 0x6c4, 0x6c7, 0x6cc, 0x6cf, 0x6d2, 0x6d6, 0x6d9, 0x6de, 0x6e5, 0x6e8, 0x6f0, 0x6f4, 0x6ff, 0x702, 0x705, 0x708, 0x70e, 0x714, 0x71d, 0x720, 0x723, 0x726, 0x72e, 0x733, 0x73c, 0x73f, 0x744, 0x74e, 0x752, 0x756, 0x759, 0x75c, 0x760, 0x76f, 0x77b, 0x77f, 0x784, 0x789, 0x78e, 0x792, 0x797, 0x7a0, 0x7a5, 0x7a9, 0x7af, 0x7b5, 0x7ba, 0x7c0, 0x7c6, 0x7d0, 0x7d6, 0x7df, 0x7e2, 0x7e5, 0x7e9, 0x7ed, 0x7f1, 0x7f7, 0x7fd, 0x802, 0x805, 0x815, 0x81c, 0x820, 0x827, 0x82b, 0x831, 0x838, 0x83f, 0x845, 0x84e, 0x852, 0x860, 0x863, 0x866, 0x86a, 0x86e, 0x871, 0x875, 0x878, 0x87d, 0x87f, 0x881} + +// idnaSparseValues: 2180 entries, 8720 bytes +var idnaSparseValues = [2180]valueRange{ + // Block 0x0, offset 0x0 + {value: 0x0000, lo: 0x07}, + {value: 0xe105, lo: 0x80, hi: 0x96}, + {value: 0x0018, lo: 0x97, hi: 0x97}, + {value: 0xe105, lo: 0x98, hi: 0x9e}, + {value: 0x001f, lo: 0x9f, hi: 0x9f}, + {value: 0x0008, lo: 0xa0, hi: 0xb6}, + {value: 0x0018, lo: 0xb7, hi: 0xb7}, + {value: 0x0008, lo: 0xb8, hi: 0xbf}, + // Block 0x1, offset 0x8 + {value: 0x0000, lo: 0x10}, + {value: 0x0008, lo: 0x80, hi: 0x80}, + {value: 0xe01d, lo: 0x81, hi: 0x81}, + {value: 0x0008, lo: 0x82, hi: 0x82}, + {value: 0x0335, lo: 0x83, hi: 0x83}, + {value: 0x034d, lo: 0x84, hi: 0x84}, + {value: 0x0365, lo: 0x85, hi: 0x85}, + {value: 0xe00d, lo: 0x86, hi: 0x86}, + {value: 0x0008, lo: 0x87, hi: 0x87}, + {value: 0xe00d, lo: 0x88, hi: 0x88}, + {value: 0x0008, lo: 0x89, hi: 0x89}, + {value: 0xe00d, lo: 0x8a, hi: 0x8a}, + {value: 0x0008, lo: 0x8b, hi: 0x8b}, + {value: 0xe00d, lo: 0x8c, hi: 0x8c}, + {value: 0x0008, lo: 0x8d, hi: 0x8d}, + {value: 0xe00d, lo: 0x8e, hi: 0x8e}, + {value: 0x0008, lo: 0x8f, hi: 0xbf}, + // Block 0x2, offset 0x19 + {value: 0x0000, lo: 0x0b}, + {value: 0x0008, lo: 0x80, hi: 0xaf}, + {value: 0x00a9, lo: 0xb0, hi: 0xb0}, + {value: 0x037d, lo: 0xb1, hi: 0xb1}, + {value: 0x00b1, lo: 0xb2, hi: 0xb2}, + {value: 0x00b9, lo: 0xb3, hi: 0xb3}, + {value: 0x034d, lo: 0xb4, hi: 0xb4}, + {value: 0x0395, lo: 0xb5, hi: 0xb5}, + {value: 0xe1bd, lo: 0xb6, hi: 0xb6}, + {value: 0x00c1, lo: 0xb7, hi: 0xb7}, + {value: 0x00c9, lo: 0xb8, hi: 0xb8}, + {value: 0x0008, lo: 0xb9, hi: 0xbf}, + // Block 0x3, offset 0x25 + {value: 0x0000, lo: 0x01}, + {value: 0x3308, lo: 0x80, hi: 0xbf}, + // Block 0x4, offset 0x27 + {value: 0x0000, lo: 0x04}, + {value: 0x03f5, lo: 0x80, hi: 0x8f}, + {value: 0xe105, lo: 0x90, hi: 0x9f}, + {value: 0x049d, lo: 0xa0, hi: 0xaf}, + {value: 0x0008, lo: 0xb0, hi: 0xbf}, + // Block 0x5, offset 0x2c + {value: 0x0000, lo: 0x06}, + {value: 0xe185, lo: 0x80, hi: 0x8f}, + {value: 0x0545, lo: 0x90, hi: 0x96}, + {value: 0x0040, lo: 0x97, hi: 0x98}, + {value: 0x0008, lo: 0x99, hi: 0x99}, + {value: 0x0018, lo: 0x9a, hi: 0x9f}, + {value: 0x0008, lo: 0xa0, hi: 0xbf}, + // Block 0x6, offset 0x33 + {value: 0x0000, lo: 0x0a}, + {value: 0x0008, lo: 0x80, hi: 0x86}, + {value: 0x0131, lo: 0x87, hi: 0x87}, + {value: 0x0008, lo: 0x88, hi: 0x88}, + {value: 0x0018, lo: 0x89, hi: 0x8a}, + {value: 0x0040, lo: 0x8b, hi: 0x8c}, + {value: 0x0018, lo: 0x8d, hi: 0x8f}, + {value: 0x0040, lo: 0x90, hi: 0x90}, + {value: 0x3308, lo: 0x91, hi: 0xbd}, + {value: 0x0818, lo: 0xbe, hi: 0xbe}, + {value: 0x3308, lo: 0xbf, hi: 0xbf}, + // Block 0x7, offset 0x3e + {value: 0x0000, lo: 0x0b}, + {value: 0x0818, lo: 0x80, hi: 0x80}, + {value: 0x3308, lo: 0x81, hi: 0x82}, + {value: 0x0818, lo: 0x83, hi: 0x83}, + {value: 0x3308, lo: 0x84, hi: 0x85}, + {value: 0x0818, lo: 0x86, hi: 0x86}, + {value: 0x3308, lo: 0x87, hi: 0x87}, + {value: 0x0040, lo: 0x88, hi: 0x8f}, + {value: 0x0808, lo: 0x90, hi: 0xaa}, + {value: 0x0040, lo: 0xab, hi: 0xae}, + {value: 0x0808, lo: 0xaf, hi: 0xb4}, + {value: 0x0040, lo: 0xb5, hi: 0xbf}, + // Block 0x8, offset 0x4a + {value: 0x0000, lo: 0x03}, + {value: 0x0a08, lo: 0x80, hi: 0x87}, + {value: 0x0c08, lo: 0x88, hi: 0x99}, + {value: 0x0a08, lo: 0x9a, hi: 0xbf}, + // Block 0x9, offset 0x4e + {value: 0x0000, lo: 0x0e}, + {value: 0x3308, lo: 0x80, hi: 0x8a}, + {value: 0x0040, lo: 0x8b, hi: 0x8c}, + {value: 0x0c08, lo: 0x8d, hi: 0x8d}, + {value: 0x0a08, lo: 0x8e, hi: 0x98}, + {value: 0x0c08, lo: 0x99, hi: 0x9b}, + {value: 0x0a08, lo: 0x9c, hi: 0xaa}, + {value: 0x0c08, lo: 0xab, hi: 0xac}, + {value: 0x0a08, lo: 0xad, hi: 0xb0}, + {value: 0x0c08, lo: 0xb1, hi: 0xb1}, + {value: 0x0a08, lo: 0xb2, hi: 0xb2}, + {value: 0x0c08, lo: 0xb3, hi: 0xb4}, + {value: 0x0a08, lo: 0xb5, hi: 0xb7}, + {value: 0x0c08, lo: 0xb8, hi: 0xb9}, + {value: 0x0a08, lo: 0xba, hi: 0xbf}, + // Block 0xa, offset 0x5d + {value: 0x0000, lo: 0x04}, + {value: 0x0808, lo: 0x80, hi: 0xa5}, + {value: 0x3308, lo: 0xa6, hi: 0xb0}, + {value: 0x0808, lo: 0xb1, hi: 0xb1}, + {value: 0x0040, lo: 0xb2, hi: 0xbf}, + // Block 0xb, offset 0x62 + {value: 0x0000, lo: 0x09}, + {value: 0x0808, lo: 0x80, hi: 0x89}, + {value: 0x0a08, lo: 0x8a, hi: 0xaa}, + {value: 0x3308, lo: 0xab, hi: 0xb3}, + {value: 0x0808, lo: 0xb4, hi: 0xb5}, + {value: 0x0018, lo: 0xb6, hi: 0xb9}, + {value: 0x0818, lo: 0xba, hi: 0xba}, + {value: 0x0040, lo: 0xbb, hi: 0xbc}, + {value: 0x3308, lo: 0xbd, hi: 0xbd}, + {value: 0x0818, lo: 0xbe, hi: 0xbf}, + // Block 0xc, offset 0x6c + {value: 0x0000, lo: 0x0b}, + {value: 0x0808, lo: 0x80, hi: 0x95}, + {value: 0x3308, lo: 0x96, hi: 0x99}, + {value: 0x0808, lo: 0x9a, hi: 0x9a}, + {value: 0x3308, lo: 0x9b, hi: 0xa3}, + {value: 0x0808, lo: 0xa4, hi: 0xa4}, + {value: 0x3308, lo: 0xa5, hi: 0xa7}, + {value: 0x0808, lo: 0xa8, hi: 0xa8}, + {value: 0x3308, lo: 0xa9, hi: 0xad}, + {value: 0x0040, lo: 0xae, hi: 0xaf}, + {value: 0x0818, lo: 0xb0, hi: 0xbe}, + {value: 0x0040, lo: 0xbf, hi: 0xbf}, + // Block 0xd, offset 0x78 + {value: 0x0000, lo: 0x05}, + {value: 0x0a08, lo: 0x80, hi: 0x88}, + {value: 0x0808, lo: 0x89, hi: 0x89}, + {value: 0x3308, lo: 0x8a, hi: 0xa1}, + {value: 0x0840, lo: 0xa2, hi: 0xa2}, + {value: 0x3308, lo: 0xa3, hi: 0xbf}, + // Block 0xe, offset 0x7e + {value: 0x0000, lo: 0x08}, + {value: 0x3308, lo: 0x80, hi: 0x82}, + {value: 0x3008, lo: 0x83, hi: 0x83}, + {value: 0x0008, lo: 0x84, hi: 0xb9}, + {value: 0x3308, lo: 0xba, hi: 0xba}, + {value: 0x3008, lo: 0xbb, hi: 0xbb}, + {value: 0x3308, lo: 0xbc, hi: 0xbc}, + {value: 0x0008, lo: 0xbd, hi: 0xbd}, + {value: 0x3008, lo: 0xbe, hi: 0xbf}, + // Block 0xf, offset 0x87 + {value: 0x0000, lo: 0x0f}, + {value: 0x3308, lo: 0x80, hi: 0x80}, + {value: 0x3008, lo: 0x81, hi: 0x82}, + {value: 0x0040, lo: 0x83, hi: 0x85}, + {value: 0x3008, lo: 0x86, hi: 0x88}, + {value: 0x0040, lo: 0x89, hi: 0x89}, + {value: 0x3008, lo: 0x8a, hi: 0x8c}, + {value: 0x3b08, lo: 0x8d, hi: 0x8d}, + {value: 0x0040, lo: 0x8e, hi: 0x8f}, + {value: 0x0008, lo: 0x90, hi: 0x90}, + {value: 0x0040, lo: 0x91, hi: 0x96}, + {value: 0x3008, lo: 0x97, hi: 0x97}, + {value: 0x0040, lo: 0x98, hi: 0xa5}, + {value: 0x0008, lo: 0xa6, hi: 0xaf}, + {value: 0x0018, lo: 0xb0, hi: 0xba}, + {value: 0x0040, lo: 0xbb, hi: 0xbf}, + // Block 0x10, offset 0x97 + {value: 0x0000, lo: 0x0e}, + {value: 0x3308, lo: 0x80, hi: 0x80}, + {value: 0x3008, lo: 0x81, hi: 0x83}, + {value: 0x3308, lo: 0x84, hi: 0x84}, + {value: 0x0008, lo: 0x85, hi: 0x8c}, + {value: 0x0040, lo: 0x8d, hi: 0x8d}, + {value: 0x0008, lo: 0x8e, hi: 0x90}, + {value: 0x0040, lo: 0x91, hi: 0x91}, + {value: 0x0008, lo: 0x92, hi: 0xa8}, + {value: 0x0040, lo: 0xa9, hi: 0xa9}, + {value: 0x0008, lo: 0xaa, hi: 0xb9}, + {value: 0x0040, lo: 0xba, hi: 0xbb}, + {value: 0x3308, lo: 0xbc, hi: 0xbc}, + {value: 0x0008, lo: 0xbd, hi: 0xbd}, + {value: 0x3308, lo: 0xbe, hi: 0xbf}, + // Block 0x11, offset 0xa6 + {value: 0x0000, lo: 0x0a}, + {value: 0x3308, lo: 0x80, hi: 0x81}, + {value: 0x3008, lo: 0x82, hi: 0x83}, + {value: 0x0008, lo: 0x84, hi: 0x8c}, + {value: 0x0040, lo: 0x8d, hi: 0x8d}, + {value: 0x0008, lo: 0x8e, hi: 0x90}, + {value: 0x0040, lo: 0x91, hi: 0x91}, + {value: 0x0008, lo: 0x92, hi: 0xba}, + {value: 0x3b08, lo: 0xbb, hi: 0xbc}, + {value: 0x0008, lo: 0xbd, hi: 0xbd}, + {value: 0x3008, lo: 0xbe, hi: 0xbf}, + // Block 0x12, offset 0xb1 + {value: 0x0000, lo: 0x0c}, + {value: 0x0040, lo: 0x80, hi: 0x80}, + {value: 0x3308, lo: 0x81, hi: 0x81}, + {value: 0x3008, lo: 0x82, hi: 0x83}, + {value: 0x0040, lo: 0x84, hi: 0x84}, + {value: 0x0008, lo: 0x85, hi: 0x96}, + {value: 0x0040, lo: 0x97, hi: 0x99}, + {value: 0x0008, lo: 0x9a, hi: 0xb1}, + {value: 0x0040, lo: 0xb2, hi: 0xb2}, + {value: 0x0008, lo: 0xb3, hi: 0xbb}, + {value: 0x0040, lo: 0xbc, hi: 0xbc}, + {value: 0x0008, lo: 0xbd, hi: 0xbd}, + {value: 0x0040, lo: 0xbe, hi: 0xbf}, + // Block 0x13, offset 0xbe + {value: 0x0000, lo: 0x10}, + {value: 0x0008, lo: 0x80, hi: 0x86}, + {value: 0x0040, lo: 0x87, hi: 0x89}, + {value: 0x3b08, lo: 0x8a, hi: 0x8a}, + {value: 0x0040, lo: 0x8b, hi: 0x8e}, + {value: 0x3008, lo: 0x8f, hi: 0x91}, + {value: 0x3308, lo: 0x92, hi: 0x94}, + {value: 0x0040, lo: 0x95, hi: 0x95}, + {value: 0x3308, lo: 0x96, hi: 0x96}, + {value: 0x0040, lo: 0x97, hi: 0x97}, + {value: 0x3008, lo: 0x98, hi: 0x9f}, + {value: 0x0040, lo: 0xa0, hi: 0xa5}, + {value: 0x0008, lo: 0xa6, hi: 0xaf}, + {value: 0x0040, lo: 0xb0, hi: 0xb1}, + {value: 0x3008, lo: 0xb2, hi: 0xb3}, + {value: 0x0018, lo: 0xb4, hi: 0xb4}, + {value: 0x0040, lo: 0xb5, hi: 0xbf}, + // Block 0x14, offset 0xcf + {value: 0x0000, lo: 0x09}, + {value: 0x0040, lo: 0x80, hi: 0x80}, + {value: 0x0008, lo: 0x81, hi: 0xb0}, + {value: 0x3308, lo: 0xb1, hi: 0xb1}, + {value: 0x0008, lo: 0xb2, hi: 0xb2}, + {value: 0x01f1, lo: 0xb3, hi: 0xb3}, + {value: 0x3308, lo: 0xb4, hi: 0xb9}, + {value: 0x3b08, lo: 0xba, hi: 0xba}, + {value: 0x0040, lo: 0xbb, hi: 0xbe}, + {value: 0x0018, lo: 0xbf, hi: 0xbf}, + // Block 0x15, offset 0xd9 + {value: 0x0000, lo: 0x06}, + {value: 0x0008, lo: 0x80, hi: 0x86}, + {value: 0x3308, lo: 0x87, hi: 0x8e}, + {value: 0x0018, lo: 0x8f, hi: 0x8f}, + {value: 0x0008, lo: 0x90, hi: 0x99}, + {value: 0x0018, lo: 0x9a, hi: 0x9b}, + {value: 0x0040, lo: 0x9c, hi: 0xbf}, + // Block 0x16, offset 0xe0 + {value: 0x0000, lo: 0x0c}, + {value: 0x0008, lo: 0x80, hi: 0x84}, + {value: 0x0040, lo: 0x85, hi: 0x85}, + {value: 0x0008, lo: 0x86, hi: 0x86}, + {value: 0x0040, lo: 0x87, hi: 0x87}, + {value: 0x3308, lo: 0x88, hi: 0x8e}, + {value: 0x0040, lo: 0x8f, hi: 0x8f}, + {value: 0x0008, lo: 0x90, hi: 0x99}, + {value: 0x0040, lo: 0x9a, hi: 0x9b}, + {value: 0x0201, lo: 0x9c, hi: 0x9c}, + {value: 0x0209, lo: 0x9d, hi: 0x9d}, + {value: 0x0008, lo: 0x9e, hi: 0x9f}, + {value: 0x0040, lo: 0xa0, hi: 0xbf}, + // Block 0x17, offset 0xed + {value: 0x0000, lo: 0x10}, + {value: 0x0008, lo: 0x80, hi: 0x80}, + {value: 0x0018, lo: 0x81, hi: 0x8a}, + {value: 0x0008, lo: 0x8b, hi: 0x8b}, + {value: 0xe03d, lo: 0x8c, hi: 0x8c}, + {value: 0x0018, lo: 0x8d, hi: 0x97}, + {value: 0x3308, lo: 0x98, hi: 0x99}, + {value: 0x0018, lo: 0x9a, hi: 0x9f}, + {value: 0x0008, lo: 0xa0, hi: 0xa9}, + {value: 0x0018, lo: 0xaa, hi: 0xb4}, + {value: 0x3308, lo: 0xb5, hi: 0xb5}, + {value: 0x0018, lo: 0xb6, hi: 0xb6}, + {value: 0x3308, lo: 0xb7, hi: 0xb7}, + {value: 0x0018, lo: 0xb8, hi: 0xb8}, + {value: 0x3308, lo: 0xb9, hi: 0xb9}, + {value: 0x0018, lo: 0xba, hi: 0xbd}, + {value: 0x3008, lo: 0xbe, hi: 0xbf}, + // Block 0x18, offset 0xfe + {value: 0x0000, lo: 0x06}, + {value: 0x0018, lo: 0x80, hi: 0x85}, + {value: 0x3308, lo: 0x86, hi: 0x86}, + {value: 0x0018, lo: 0x87, hi: 0x8c}, + {value: 0x0040, lo: 0x8d, hi: 0x8d}, + {value: 0x0018, lo: 0x8e, hi: 0x9a}, + {value: 0x0040, lo: 0x9b, hi: 0xbf}, + // Block 0x19, offset 0x105 + {value: 0x0000, lo: 0x0a}, + {value: 0x0008, lo: 0x80, hi: 0xaa}, + {value: 0x3008, lo: 0xab, hi: 0xac}, + {value: 0x3308, lo: 0xad, hi: 0xb0}, + {value: 0x3008, lo: 0xb1, hi: 0xb1}, + {value: 0x3308, lo: 0xb2, hi: 0xb7}, + {value: 0x3008, lo: 0xb8, hi: 0xb8}, + {value: 0x3b08, lo: 0xb9, hi: 0xba}, + {value: 0x3008, lo: 0xbb, hi: 0xbc}, + {value: 0x3308, lo: 0xbd, hi: 0xbe}, + {value: 0x0008, lo: 0xbf, hi: 0xbf}, + // Block 0x1a, offset 0x110 + {value: 0x0000, lo: 0x0e}, + {value: 0x0008, lo: 0x80, hi: 0x89}, + {value: 0x0018, lo: 0x8a, hi: 0x8f}, + {value: 0x0008, lo: 0x90, hi: 0x95}, + {value: 0x3008, lo: 0x96, hi: 0x97}, + {value: 0x3308, lo: 0x98, hi: 0x99}, + {value: 0x0008, lo: 0x9a, hi: 0x9d}, + {value: 0x3308, lo: 0x9e, hi: 0xa0}, + {value: 0x0008, lo: 0xa1, hi: 0xa1}, + {value: 0x3008, lo: 0xa2, hi: 0xa4}, + {value: 0x0008, lo: 0xa5, hi: 0xa6}, + {value: 0x3008, lo: 0xa7, hi: 0xad}, + {value: 0x0008, lo: 0xae, hi: 0xb0}, + {value: 0x3308, lo: 0xb1, hi: 0xb4}, + {value: 0x0008, lo: 0xb5, hi: 0xbf}, + // Block 0x1b, offset 0x11f + {value: 0x0000, lo: 0x0d}, + {value: 0x0008, lo: 0x80, hi: 0x81}, + {value: 0x3308, lo: 0x82, hi: 0x82}, + {value: 0x3008, lo: 0x83, hi: 0x84}, + {value: 0x3308, lo: 0x85, hi: 0x86}, + {value: 0x3008, lo: 0x87, hi: 0x8c}, + {value: 0x3308, lo: 0x8d, hi: 0x8d}, + {value: 0x0008, lo: 0x8e, hi: 0x8e}, + {value: 0x3008, lo: 0x8f, hi: 0x8f}, + {value: 0x0008, lo: 0x90, hi: 0x99}, + {value: 0x3008, lo: 0x9a, hi: 0x9c}, + {value: 0x3308, lo: 0x9d, hi: 0x9d}, + {value: 0x0018, lo: 0x9e, hi: 0x9f}, + {value: 0x0040, lo: 0xa0, hi: 0xbf}, + // Block 0x1c, offset 0x12d + {value: 0x0000, lo: 0x09}, + {value: 0x0040, lo: 0x80, hi: 0x86}, + {value: 0x055d, lo: 0x87, hi: 0x87}, + {value: 0x0040, lo: 0x88, hi: 0x8c}, + {value: 0x055d, lo: 0x8d, hi: 0x8d}, + {value: 0x0040, lo: 0x8e, hi: 0x8f}, + {value: 0x0008, lo: 0x90, hi: 0xba}, + {value: 0x0018, lo: 0xbb, hi: 0xbb}, + {value: 0xe105, lo: 0xbc, hi: 0xbc}, + {value: 0x0008, lo: 0xbd, hi: 0xbf}, + // Block 0x1d, offset 0x137 + {value: 0x0000, lo: 0x01}, + {value: 0x0018, lo: 0x80, hi: 0xbf}, + // Block 0x1e, offset 0x139 + {value: 0x0000, lo: 0x04}, + {value: 0x0018, lo: 0x80, hi: 0x9e}, + {value: 0x0040, lo: 0x9f, hi: 0xa0}, + {value: 0x2018, lo: 0xa1, hi: 0xb5}, + {value: 0x0018, lo: 0xb6, hi: 0xbf}, + // Block 0x1f, offset 0x13e + {value: 0x0000, lo: 0x02}, + {value: 0x0018, lo: 0x80, hi: 0xa7}, + {value: 0x2018, lo: 0xa8, hi: 0xbf}, + // Block 0x20, offset 0x141 + {value: 0x0000, lo: 0x02}, + {value: 0x2018, lo: 0x80, hi: 0x82}, + {value: 0x0018, lo: 0x83, hi: 0xbf}, + // Block 0x21, offset 0x144 + {value: 0x0000, lo: 0x01}, + {value: 0x0008, lo: 0x80, hi: 0xbf}, + // Block 0x22, offset 0x146 + {value: 0x0000, lo: 0x0b}, + {value: 0x0008, lo: 0x80, hi: 0x88}, + {value: 0x0040, lo: 0x89, hi: 0x89}, + {value: 0x0008, lo: 0x8a, hi: 0x8d}, + {value: 0x0040, lo: 0x8e, hi: 0x8f}, + {value: 0x0008, lo: 0x90, hi: 0x96}, + {value: 0x0040, lo: 0x97, hi: 0x97}, + {value: 0x0008, lo: 0x98, hi: 0x98}, + {value: 0x0040, lo: 0x99, hi: 0x99}, + {value: 0x0008, lo: 0x9a, hi: 0x9d}, + {value: 0x0040, lo: 0x9e, hi: 0x9f}, + {value: 0x0008, lo: 0xa0, hi: 0xbf}, + // Block 0x23, offset 0x152 + {value: 0x0000, lo: 0x0a}, + {value: 0x0008, lo: 0x80, hi: 0x88}, + {value: 0x0040, lo: 0x89, hi: 0x89}, + {value: 0x0008, lo: 0x8a, hi: 0x8d}, + {value: 0x0040, lo: 0x8e, hi: 0x8f}, + {value: 0x0008, lo: 0x90, hi: 0xb0}, + {value: 0x0040, lo: 0xb1, hi: 0xb1}, + {value: 0x0008, lo: 0xb2, hi: 0xb5}, + {value: 0x0040, lo: 0xb6, hi: 0xb7}, + {value: 0x0008, lo: 0xb8, hi: 0xbe}, + {value: 0x0040, lo: 0xbf, hi: 0xbf}, + // Block 0x24, offset 0x15d + {value: 0x0000, lo: 0x07}, + {value: 0x0008, lo: 0x80, hi: 0x80}, + {value: 0x0040, lo: 0x81, hi: 0x81}, + {value: 0x0008, lo: 0x82, hi: 0x85}, + {value: 0x0040, lo: 0x86, hi: 0x87}, + {value: 0x0008, lo: 0x88, hi: 0x96}, + {value: 0x0040, lo: 0x97, hi: 0x97}, + {value: 0x0008, lo: 0x98, hi: 0xbf}, + // Block 0x25, offset 0x165 + {value: 0x0000, lo: 0x05}, + {value: 0x0008, lo: 0x80, hi: 0x90}, + {value: 0x0040, lo: 0x91, hi: 0x91}, + {value: 0x0008, lo: 0x92, hi: 0x95}, + {value: 0x0040, lo: 0x96, hi: 0x97}, + {value: 0x0008, lo: 0x98, hi: 0xbf}, + // Block 0x26, offset 0x16b + {value: 0x0000, lo: 0x05}, + {value: 0x0008, lo: 0x80, hi: 0x9a}, + {value: 0x0040, lo: 0x9b, hi: 0x9c}, + {value: 0x3308, lo: 0x9d, hi: 0x9f}, + {value: 0x0018, lo: 0xa0, hi: 0xbc}, + {value: 0x0040, lo: 0xbd, hi: 0xbf}, + // Block 0x27, offset 0x171 + {value: 0x0000, lo: 0x04}, + {value: 0x0008, lo: 0x80, hi: 0x8f}, + {value: 0x0018, lo: 0x90, hi: 0x99}, + {value: 0x0040, lo: 0x9a, hi: 0x9f}, + {value: 0x0008, lo: 0xa0, hi: 0xbf}, + // Block 0x28, offset 0x176 + {value: 0x0000, lo: 0x04}, + {value: 0x0008, lo: 0x80, hi: 0xb5}, + {value: 0x0040, lo: 0xb6, hi: 0xb7}, + {value: 0xe045, lo: 0xb8, hi: 0xbd}, + {value: 0x0040, lo: 0xbe, hi: 0xbf}, + // Block 0x29, offset 0x17b + {value: 0x0000, lo: 0x02}, + {value: 0x0018, lo: 0x80, hi: 0x80}, + {value: 0x0008, lo: 0x81, hi: 0xbf}, + // Block 0x2a, offset 0x17e + {value: 0x0000, lo: 0x03}, + {value: 0x0008, lo: 0x80, hi: 0xac}, + {value: 0x0018, lo: 0xad, hi: 0xae}, + {value: 0x0008, lo: 0xaf, hi: 0xbf}, + // Block 0x2b, offset 0x182 + {value: 0x0000, lo: 0x05}, + {value: 0x0040, lo: 0x80, hi: 0x80}, + {value: 0x0008, lo: 0x81, hi: 0x9a}, + {value: 0x0018, lo: 0x9b, hi: 0x9c}, + {value: 0x0040, lo: 0x9d, hi: 0x9f}, + {value: 0x0008, lo: 0xa0, hi: 0xbf}, + // Block 0x2c, offset 0x188 + {value: 0x0000, lo: 0x04}, + {value: 0x0008, lo: 0x80, hi: 0xaa}, + {value: 0x0018, lo: 0xab, hi: 0xb0}, + {value: 0x0008, lo: 0xb1, hi: 0xb8}, + {value: 0x0040, lo: 0xb9, hi: 0xbf}, + // Block 0x2d, offset 0x18d + {value: 0x0000, lo: 0x0a}, + {value: 0x0008, lo: 0x80, hi: 0x91}, + {value: 0x3308, lo: 0x92, hi: 0x93}, + {value: 0x3b08, lo: 0x94, hi: 0x94}, + {value: 0x3808, lo: 0x95, hi: 0x95}, + {value: 0x0040, lo: 0x96, hi: 0x9e}, + {value: 0x0008, lo: 0x9f, hi: 0xb1}, + {value: 0x3308, lo: 0xb2, hi: 0xb3}, + {value: 0x3808, lo: 0xb4, hi: 0xb4}, + {value: 0x0018, lo: 0xb5, hi: 0xb6}, + {value: 0x0040, lo: 0xb7, hi: 0xbf}, + // Block 0x2e, offset 0x198 + {value: 0x0000, lo: 0x09}, + {value: 0x0008, lo: 0x80, hi: 0x91}, + {value: 0x3308, lo: 0x92, hi: 0x93}, + {value: 0x0040, lo: 0x94, hi: 0x9f}, + {value: 0x0008, lo: 0xa0, hi: 0xac}, + {value: 0x0040, lo: 0xad, hi: 0xad}, + {value: 0x0008, lo: 0xae, hi: 0xb0}, + {value: 0x0040, lo: 0xb1, hi: 0xb1}, + {value: 0x3308, lo: 0xb2, hi: 0xb3}, + {value: 0x0040, lo: 0xb4, hi: 0xbf}, + // Block 0x2f, offset 0x1a2 + {value: 0x0000, lo: 0x05}, + {value: 0x0008, lo: 0x80, hi: 0xb3}, + {value: 0x3340, lo: 0xb4, hi: 0xb5}, + {value: 0x3008, lo: 0xb6, hi: 0xb6}, + {value: 0x3308, lo: 0xb7, hi: 0xbd}, + {value: 0x3008, lo: 0xbe, hi: 0xbf}, + // Block 0x30, offset 0x1a8 + {value: 0x0000, lo: 0x10}, + {value: 0x3008, lo: 0x80, hi: 0x85}, + {value: 0x3308, lo: 0x86, hi: 0x86}, + {value: 0x3008, lo: 0x87, hi: 0x88}, + {value: 0x3308, lo: 0x89, hi: 0x91}, + {value: 0x3b08, lo: 0x92, hi: 0x92}, + {value: 0x3308, lo: 0x93, hi: 0x93}, + {value: 0x0018, lo: 0x94, hi: 0x96}, + {value: 0x0008, lo: 0x97, hi: 0x97}, + {value: 0x0018, lo: 0x98, hi: 0x9b}, + {value: 0x0008, lo: 0x9c, hi: 0x9c}, + {value: 0x3308, lo: 0x9d, hi: 0x9d}, + {value: 0x0040, lo: 0x9e, hi: 0x9f}, + {value: 0x0008, lo: 0xa0, hi: 0xa9}, + {value: 0x0040, lo: 0xaa, hi: 0xaf}, + {value: 0x0018, lo: 0xb0, hi: 0xb9}, + {value: 0x0040, lo: 0xba, hi: 0xbf}, + // Block 0x31, offset 0x1b9 + {value: 0x0000, lo: 0x0a}, + {value: 0x0018, lo: 0x80, hi: 0x85}, + {value: 0x0040, lo: 0x86, hi: 0x86}, + {value: 0x0218, lo: 0x87, hi: 0x87}, + {value: 0x0018, lo: 0x88, hi: 0x8a}, + {value: 0x33c0, lo: 0x8b, hi: 0x8d}, + {value: 0x0040, lo: 0x8e, hi: 0x8e}, + {value: 0x33c0, lo: 0x8f, hi: 0x8f}, + {value: 0x0008, lo: 0x90, hi: 0x99}, + {value: 0x0040, lo: 0x9a, hi: 0x9f}, + {value: 0x0208, lo: 0xa0, hi: 0xbf}, + // Block 0x32, offset 0x1c4 + {value: 0x0000, lo: 0x02}, + {value: 0x0208, lo: 0x80, hi: 0xb8}, + {value: 0x0040, lo: 0xb9, hi: 0xbf}, + // Block 0x33, offset 0x1c7 + {value: 0x0000, lo: 0x07}, + {value: 0x0008, lo: 0x80, hi: 0x84}, + {value: 0x3308, lo: 0x85, hi: 0x86}, + {value: 0x0208, lo: 0x87, hi: 0xa8}, + {value: 0x3308, lo: 0xa9, hi: 0xa9}, + {value: 0x0208, lo: 0xaa, hi: 0xaa}, + {value: 0x0040, lo: 0xab, hi: 0xaf}, + {value: 0x0008, lo: 0xb0, hi: 0xbf}, + // Block 0x34, offset 0x1cf + {value: 0x0000, lo: 0x02}, + {value: 0x0008, lo: 0x80, hi: 0xb5}, + {value: 0x0040, lo: 0xb6, hi: 0xbf}, + // Block 0x35, offset 0x1d2 + {value: 0x0000, lo: 0x0c}, + {value: 0x0008, lo: 0x80, hi: 0x9e}, + {value: 0x0040, lo: 0x9f, hi: 0x9f}, + {value: 0x3308, lo: 0xa0, hi: 0xa2}, + {value: 0x3008, lo: 0xa3, hi: 0xa6}, + {value: 0x3308, lo: 0xa7, hi: 0xa8}, + {value: 0x3008, lo: 0xa9, hi: 0xab}, + {value: 0x0040, lo: 0xac, hi: 0xaf}, + {value: 0x3008, lo: 0xb0, hi: 0xb1}, + {value: 0x3308, lo: 0xb2, hi: 0xb2}, + {value: 0x3008, lo: 0xb3, hi: 0xb8}, + {value: 0x3308, lo: 0xb9, hi: 0xbb}, + {value: 0x0040, lo: 0xbc, hi: 0xbf}, + // Block 0x36, offset 0x1df + {value: 0x0000, lo: 0x07}, + {value: 0x0018, lo: 0x80, hi: 0x80}, + {value: 0x0040, lo: 0x81, hi: 0x83}, + {value: 0x0018, lo: 0x84, hi: 0x85}, + {value: 0x0008, lo: 0x86, hi: 0xad}, + {value: 0x0040, lo: 0xae, hi: 0xaf}, + {value: 0x0008, lo: 0xb0, hi: 0xb4}, + {value: 0x0040, lo: 0xb5, hi: 0xbf}, + // Block 0x37, offset 0x1e7 + {value: 0x0000, lo: 0x03}, + {value: 0x0008, lo: 0x80, hi: 0xab}, + {value: 0x0040, lo: 0xac, hi: 0xaf}, + {value: 0x0008, lo: 0xb0, hi: 0xbf}, + // Block 0x38, offset 0x1eb + {value: 0x0000, lo: 0x06}, + {value: 0x0008, lo: 0x80, hi: 0x89}, + {value: 0x0040, lo: 0x8a, hi: 0x8f}, + {value: 0x0008, lo: 0x90, hi: 0x99}, + {value: 0x0028, lo: 0x9a, hi: 0x9a}, + {value: 0x0040, lo: 0x9b, hi: 0x9d}, + {value: 0x0018, lo: 0x9e, hi: 0xbf}, + // Block 0x39, offset 0x1f2 + {value: 0x0000, lo: 0x07}, + {value: 0x0008, lo: 0x80, hi: 0x96}, + {value: 0x3308, lo: 0x97, hi: 0x98}, + {value: 0x3008, lo: 0x99, hi: 0x9a}, + {value: 0x3308, lo: 0x9b, hi: 0x9b}, + {value: 0x0040, lo: 0x9c, hi: 0x9d}, + {value: 0x0018, lo: 0x9e, hi: 0x9f}, + {value: 0x0008, lo: 0xa0, hi: 0xbf}, + // Block 0x3a, offset 0x1fa + {value: 0x0000, lo: 0x0f}, + {value: 0x0008, lo: 0x80, hi: 0x94}, + {value: 0x3008, lo: 0x95, hi: 0x95}, + {value: 0x3308, lo: 0x96, hi: 0x96}, + {value: 0x3008, lo: 0x97, hi: 0x97}, + {value: 0x3308, lo: 0x98, hi: 0x9e}, + {value: 0x0040, lo: 0x9f, hi: 0x9f}, + {value: 0x3b08, lo: 0xa0, hi: 0xa0}, + {value: 0x3008, lo: 0xa1, hi: 0xa1}, + {value: 0x3308, lo: 0xa2, hi: 0xa2}, + {value: 0x3008, lo: 0xa3, hi: 0xa4}, + {value: 0x3308, lo: 0xa5, hi: 0xac}, + {value: 0x3008, lo: 0xad, hi: 0xb2}, + {value: 0x3308, lo: 0xb3, hi: 0xbc}, + {value: 0x0040, lo: 0xbd, hi: 0xbe}, + {value: 0x3308, lo: 0xbf, hi: 0xbf}, + // Block 0x3b, offset 0x20a + {value: 0x0000, lo: 0x0b}, + {value: 0x0008, lo: 0x80, hi: 0x89}, + {value: 0x0040, lo: 0x8a, hi: 0x8f}, + {value: 0x0008, lo: 0x90, hi: 0x99}, + {value: 0x0040, lo: 0x9a, hi: 0x9f}, + {value: 0x0018, lo: 0xa0, hi: 0xa6}, + {value: 0x0008, lo: 0xa7, hi: 0xa7}, + {value: 0x0018, lo: 0xa8, hi: 0xad}, + {value: 0x0040, lo: 0xae, hi: 0xaf}, + {value: 0x3308, lo: 0xb0, hi: 0xbd}, + {value: 0x3318, lo: 0xbe, hi: 0xbe}, + {value: 0x3308, lo: 0xbf, hi: 0xbf}, + // Block 0x3c, offset 0x216 + {value: 0x0000, lo: 0x02}, + {value: 0x3308, lo: 0x80, hi: 0x8e}, + {value: 0x0040, lo: 0x8f, hi: 0xbf}, + // Block 0x3d, offset 0x219 + {value: 0x0000, lo: 0x09}, + {value: 0x3308, lo: 0x80, hi: 0x83}, + {value: 0x3008, lo: 0x84, hi: 0x84}, + {value: 0x0008, lo: 0x85, hi: 0xb3}, + {value: 0x3308, lo: 0xb4, hi: 0xb4}, + {value: 0x3008, lo: 0xb5, hi: 0xb5}, + {value: 0x3308, lo: 0xb6, hi: 0xba}, + {value: 0x3008, lo: 0xbb, hi: 0xbb}, + {value: 0x3308, lo: 0xbc, hi: 0xbc}, + {value: 0x3008, lo: 0xbd, hi: 0xbf}, + // Block 0x3e, offset 0x223 + {value: 0x0000, lo: 0x0b}, + {value: 0x3008, lo: 0x80, hi: 0x81}, + {value: 0x3308, lo: 0x82, hi: 0x82}, + {value: 0x3008, lo: 0x83, hi: 0x83}, + {value: 0x3808, lo: 0x84, hi: 0x84}, + {value: 0x0008, lo: 0x85, hi: 0x8c}, + {value: 0x0040, lo: 0x8d, hi: 0x8f}, + {value: 0x0008, lo: 0x90, hi: 0x99}, + {value: 0x0018, lo: 0x9a, hi: 0xaa}, + {value: 0x3308, lo: 0xab, hi: 0xb3}, + {value: 0x0018, lo: 0xb4, hi: 0xbe}, + {value: 0x0040, lo: 0xbf, hi: 0xbf}, + // Block 0x3f, offset 0x22f + {value: 0x0000, lo: 0x0b}, + {value: 0x3308, lo: 0x80, hi: 0x81}, + {value: 0x3008, lo: 0x82, hi: 0x82}, + {value: 0x0008, lo: 0x83, hi: 0xa0}, + {value: 0x3008, lo: 0xa1, hi: 0xa1}, + {value: 0x3308, lo: 0xa2, hi: 0xa5}, + {value: 0x3008, lo: 0xa6, hi: 0xa7}, + {value: 0x3308, lo: 0xa8, hi: 0xa9}, + {value: 0x3808, lo: 0xaa, hi: 0xaa}, + {value: 0x3b08, lo: 0xab, hi: 0xab}, + {value: 0x3308, lo: 0xac, hi: 0xad}, + {value: 0x0008, lo: 0xae, hi: 0xbf}, + // Block 0x40, offset 0x23b + {value: 0x0000, lo: 0x0b}, + {value: 0x0008, lo: 0x80, hi: 0xa5}, + {value: 0x3308, lo: 0xa6, hi: 0xa6}, + {value: 0x3008, lo: 0xa7, hi: 0xa7}, + {value: 0x3308, lo: 0xa8, hi: 0xa9}, + {value: 0x3008, lo: 0xaa, hi: 0xac}, + {value: 0x3308, lo: 0xad, hi: 0xad}, + {value: 0x3008, lo: 0xae, hi: 0xae}, + {value: 0x3308, lo: 0xaf, hi: 0xb1}, + {value: 0x3808, lo: 0xb2, hi: 0xb3}, + {value: 0x0040, lo: 0xb4, hi: 0xbb}, + {value: 0x0018, lo: 0xbc, hi: 0xbf}, + // Block 0x41, offset 0x247 + {value: 0x0000, lo: 0x07}, + {value: 0x0008, lo: 0x80, hi: 0xa3}, + {value: 0x3008, lo: 0xa4, hi: 0xab}, + {value: 0x3308, lo: 0xac, hi: 0xb3}, + {value: 0x3008, lo: 0xb4, hi: 0xb5}, + {value: 0x3308, lo: 0xb6, hi: 0xb7}, + {value: 0x0040, lo: 0xb8, hi: 0xba}, + {value: 0x0018, lo: 0xbb, hi: 0xbf}, + // Block 0x42, offset 0x24f + {value: 0x0000, lo: 0x04}, + {value: 0x0008, lo: 0x80, hi: 0x89}, + {value: 0x0040, lo: 0x8a, hi: 0x8c}, + {value: 0x0008, lo: 0x8d, hi: 0xbd}, + {value: 0x0018, lo: 0xbe, hi: 0xbf}, + // Block 0x43, offset 0x254 + {value: 0x0000, lo: 0x0c}, + {value: 0x02a9, lo: 0x80, hi: 0x80}, + {value: 0x02b1, lo: 0x81, hi: 0x81}, + {value: 0x02b9, lo: 0x82, hi: 0x82}, + {value: 0x02c1, lo: 0x83, hi: 0x83}, + {value: 0x02c9, lo: 0x84, hi: 0x85}, + {value: 0x02d1, lo: 0x86, hi: 0x86}, + {value: 0x02d9, lo: 0x87, hi: 0x87}, + {value: 0x057d, lo: 0x88, hi: 0x88}, + {value: 0x0040, lo: 0x89, hi: 0x8f}, + {value: 0x059d, lo: 0x90, hi: 0xba}, + {value: 0x0040, lo: 0xbb, hi: 0xbc}, + {value: 0x059d, lo: 0xbd, hi: 0xbf}, + // Block 0x44, offset 0x261 + {value: 0x0000, lo: 0x10}, + {value: 0x0018, lo: 0x80, hi: 0x87}, + {value: 0x0040, lo: 0x88, hi: 0x8f}, + {value: 0x3308, lo: 0x90, hi: 0x92}, + {value: 0x0018, lo: 0x93, hi: 0x93}, + {value: 0x3308, lo: 0x94, hi: 0xa0}, + {value: 0x3008, lo: 0xa1, hi: 0xa1}, + {value: 0x3308, lo: 0xa2, hi: 0xa8}, + {value: 0x0008, lo: 0xa9, hi: 0xac}, + {value: 0x3308, lo: 0xad, hi: 0xad}, + {value: 0x0008, lo: 0xae, hi: 0xb3}, + {value: 0x3308, lo: 0xb4, hi: 0xb4}, + {value: 0x0008, lo: 0xb5, hi: 0xb6}, + {value: 0x3008, lo: 0xb7, hi: 0xb7}, + {value: 0x3308, lo: 0xb8, hi: 0xb9}, + {value: 0x0008, lo: 0xba, hi: 0xba}, + {value: 0x0040, lo: 0xbb, hi: 0xbf}, + // Block 0x45, offset 0x272 + {value: 0x0000, lo: 0x0a}, + {value: 0x0008, lo: 0x80, hi: 0x87}, + {value: 0xe045, lo: 0x88, hi: 0x8f}, + {value: 0x0008, lo: 0x90, hi: 0x95}, + {value: 0x0040, lo: 0x96, hi: 0x97}, + {value: 0xe045, lo: 0x98, hi: 0x9d}, + {value: 0x0040, lo: 0x9e, hi: 0x9f}, + {value: 0x0008, lo: 0xa0, hi: 0xa7}, + {value: 0xe045, lo: 0xa8, hi: 0xaf}, + {value: 0x0008, lo: 0xb0, hi: 0xb7}, + {value: 0xe045, lo: 0xb8, hi: 0xbf}, + // Block 0x46, offset 0x27d + {value: 0x0000, lo: 0x04}, + {value: 0x0018, lo: 0x80, hi: 0x80}, + {value: 0x0040, lo: 0x81, hi: 0x8f}, + {value: 0x3318, lo: 0x90, hi: 0xb0}, + {value: 0x0040, lo: 0xb1, hi: 0xbf}, + // Block 0x47, offset 0x282 + {value: 0x0000, lo: 0x08}, + {value: 0x0018, lo: 0x80, hi: 0x82}, + {value: 0x0040, lo: 0x83, hi: 0x83}, + {value: 0x0008, lo: 0x84, hi: 0x84}, + {value: 0x0018, lo: 0x85, hi: 0x88}, + {value: 0x0851, lo: 0x89, hi: 0x89}, + {value: 0x0018, lo: 0x8a, hi: 0x8b}, + {value: 0x0040, lo: 0x8c, hi: 0x8f}, + {value: 0x0018, lo: 0x90, hi: 0xbf}, + // Block 0x48, offset 0x28b + {value: 0x0000, lo: 0x07}, + {value: 0x0018, lo: 0x80, hi: 0xab}, + {value: 0x0859, lo: 0xac, hi: 0xac}, + {value: 0x0861, lo: 0xad, hi: 0xad}, + {value: 0x0018, lo: 0xae, hi: 0xae}, + {value: 0x0869, lo: 0xaf, hi: 0xaf}, + {value: 0x0871, lo: 0xb0, hi: 0xb0}, + {value: 0x0018, lo: 0xb1, hi: 0xbf}, + // Block 0x49, offset 0x293 + {value: 0x0000, lo: 0x05}, + {value: 0x0018, lo: 0x80, hi: 0x9f}, + {value: 0x0080, lo: 0xa0, hi: 0xa0}, + {value: 0x0018, lo: 0xa1, hi: 0xad}, + {value: 0x0080, lo: 0xae, hi: 0xaf}, + {value: 0x0018, lo: 0xb0, hi: 0xbf}, + // Block 0x4a, offset 0x299 + {value: 0x0000, lo: 0x04}, + {value: 0x0018, lo: 0x80, hi: 0xa8}, + {value: 0x09dd, lo: 0xa9, hi: 0xa9}, + {value: 0x09fd, lo: 0xaa, hi: 0xaa}, + {value: 0x0018, lo: 0xab, hi: 0xbf}, + // Block 0x4b, offset 0x29e + {value: 0x0000, lo: 0x02}, + {value: 0x0018, lo: 0x80, hi: 0xa6}, + {value: 0x0040, lo: 0xa7, hi: 0xbf}, + // Block 0x4c, offset 0x2a1 + {value: 0x0000, lo: 0x03}, + {value: 0x0018, lo: 0x80, hi: 0x8b}, + {value: 0x0929, lo: 0x8c, hi: 0x8c}, + {value: 0x0018, lo: 0x8d, hi: 0xbf}, + // Block 0x4d, offset 0x2a5 + {value: 0x0000, lo: 0x05}, + {value: 0x0018, lo: 0x80, hi: 0xb3}, + {value: 0x0e7e, lo: 0xb4, hi: 0xb4}, + {value: 0x0932, lo: 0xb5, hi: 0xb5}, + {value: 0x0e9e, lo: 0xb6, hi: 0xb6}, + {value: 0x0018, lo: 0xb7, hi: 0xbf}, + // Block 0x4e, offset 0x2ab + {value: 0x0000, lo: 0x03}, + {value: 0x0018, lo: 0x80, hi: 0x9b}, + {value: 0x0939, lo: 0x9c, hi: 0x9c}, + {value: 0x0018, lo: 0x9d, hi: 0xbf}, + // Block 0x4f, offset 0x2af + {value: 0x0000, lo: 0x03}, + {value: 0x0018, lo: 0x80, hi: 0xb3}, + {value: 0x0040, lo: 0xb4, hi: 0xb5}, + {value: 0x0018, lo: 0xb6, hi: 0xbf}, + // Block 0x50, offset 0x2b3 + {value: 0x0000, lo: 0x03}, + {value: 0x0018, lo: 0x80, hi: 0x95}, + {value: 0x0040, lo: 0x96, hi: 0x96}, + {value: 0x0018, lo: 0x97, hi: 0xbf}, + // Block 0x51, offset 0x2b7 + {value: 0x0000, lo: 0x04}, + {value: 0xe185, lo: 0x80, hi: 0x8f}, + {value: 0x03f5, lo: 0x90, hi: 0x9f}, + {value: 0x0ebd, lo: 0xa0, hi: 0xaf}, + {value: 0x0008, lo: 0xb0, hi: 0xbf}, + // Block 0x52, offset 0x2bc + {value: 0x0000, lo: 0x07}, + {value: 0x0008, lo: 0x80, hi: 0xa5}, + {value: 0x0040, lo: 0xa6, hi: 0xa6}, + {value: 0x0008, lo: 0xa7, hi: 0xa7}, + {value: 0x0040, lo: 0xa8, hi: 0xac}, + {value: 0x0008, lo: 0xad, hi: 0xad}, + {value: 0x0040, lo: 0xae, hi: 0xaf}, + {value: 0x0008, lo: 0xb0, hi: 0xbf}, + // Block 0x53, offset 0x2c4 + {value: 0x0000, lo: 0x06}, + {value: 0x0008, lo: 0x80, hi: 0xa7}, + {value: 0x0040, lo: 0xa8, hi: 0xae}, + {value: 0xe075, lo: 0xaf, hi: 0xaf}, + {value: 0x0018, lo: 0xb0, hi: 0xb0}, + {value: 0x0040, lo: 0xb1, hi: 0xbe}, + {value: 0x3b08, lo: 0xbf, hi: 0xbf}, + // Block 0x54, offset 0x2cb + {value: 0x0000, lo: 0x0a}, + {value: 0x0008, lo: 0x80, hi: 0x96}, + {value: 0x0040, lo: 0x97, hi: 0x9f}, + {value: 0x0008, lo: 0xa0, hi: 0xa6}, + {value: 0x0040, lo: 0xa7, hi: 0xa7}, + {value: 0x0008, lo: 0xa8, hi: 0xae}, + {value: 0x0040, lo: 0xaf, hi: 0xaf}, + {value: 0x0008, lo: 0xb0, hi: 0xb6}, + {value: 0x0040, lo: 0xb7, hi: 0xb7}, + {value: 0x0008, lo: 0xb8, hi: 0xbe}, + {value: 0x0040, lo: 0xbf, hi: 0xbf}, + // Block 0x55, offset 0x2d6 + {value: 0x0000, lo: 0x09}, + {value: 0x0008, lo: 0x80, hi: 0x86}, + {value: 0x0040, lo: 0x87, hi: 0x87}, + {value: 0x0008, lo: 0x88, hi: 0x8e}, + {value: 0x0040, lo: 0x8f, hi: 0x8f}, + {value: 0x0008, lo: 0x90, hi: 0x96}, + {value: 0x0040, lo: 0x97, hi: 0x97}, + {value: 0x0008, lo: 0x98, hi: 0x9e}, + {value: 0x0040, lo: 0x9f, hi: 0x9f}, + {value: 0x3308, lo: 0xa0, hi: 0xbf}, + // Block 0x56, offset 0x2e0 + {value: 0x0000, lo: 0x03}, + {value: 0x0018, lo: 0x80, hi: 0xae}, + {value: 0x0008, lo: 0xaf, hi: 0xaf}, + {value: 0x0018, lo: 0xb0, hi: 0xbf}, + // Block 0x57, offset 0x2e4 + {value: 0x0000, lo: 0x02}, + {value: 0x0018, lo: 0x80, hi: 0x9d}, + {value: 0x0040, lo: 0x9e, hi: 0xbf}, + // Block 0x58, offset 0x2e7 + {value: 0x0000, lo: 0x05}, + {value: 0x0018, lo: 0x80, hi: 0x99}, + {value: 0x0040, lo: 0x9a, hi: 0x9a}, + {value: 0x0018, lo: 0x9b, hi: 0x9e}, + {value: 0x0ef5, lo: 0x9f, hi: 0x9f}, + {value: 0x0018, lo: 0xa0, hi: 0xbf}, + // Block 0x59, offset 0x2ed + {value: 0x0000, lo: 0x03}, + {value: 0x0018, lo: 0x80, hi: 0xb2}, + {value: 0x0f15, lo: 0xb3, hi: 0xb3}, + {value: 0x0040, lo: 0xb4, hi: 0xbf}, + // Block 0x5a, offset 0x2f1 + {value: 0x0020, lo: 0x01}, + {value: 0x0f35, lo: 0x80, hi: 0xbf}, + // Block 0x5b, offset 0x2f3 + {value: 0x0020, lo: 0x02}, + {value: 0x1735, lo: 0x80, hi: 0x8f}, + {value: 0x1915, lo: 0x90, hi: 0xbf}, + // Block 0x5c, offset 0x2f6 + {value: 0x0020, lo: 0x01}, + {value: 0x1f15, lo: 0x80, hi: 0xbf}, + // Block 0x5d, offset 0x2f8 + {value: 0x0000, lo: 0x02}, + {value: 0x0040, lo: 0x80, hi: 0x80}, + {value: 0x0008, lo: 0x81, hi: 0xbf}, + // Block 0x5e, offset 0x2fb + {value: 0x0000, lo: 0x09}, + {value: 0x0008, lo: 0x80, hi: 0x96}, + {value: 0x0040, lo: 0x97, hi: 0x98}, + {value: 0x3308, lo: 0x99, hi: 0x9a}, + {value: 0x096a, lo: 0x9b, hi: 0x9b}, + {value: 0x0972, lo: 0x9c, hi: 0x9c}, + {value: 0x0008, lo: 0x9d, hi: 0x9e}, + {value: 0x0979, lo: 0x9f, hi: 0x9f}, + {value: 0x0018, lo: 0xa0, hi: 0xa0}, + {value: 0x0008, lo: 0xa1, hi: 0xbf}, + // Block 0x5f, offset 0x305 + {value: 0x0000, lo: 0x02}, + {value: 0x0008, lo: 0x80, hi: 0xbe}, + {value: 0x0981, lo: 0xbf, hi: 0xbf}, + // Block 0x60, offset 0x308 + {value: 0x0000, lo: 0x0e}, + {value: 0x0040, lo: 0x80, hi: 0x84}, + {value: 0x0008, lo: 0x85, hi: 0xaf}, + {value: 0x0040, lo: 0xb0, hi: 0xb0}, + {value: 0x2a35, lo: 0xb1, hi: 0xb1}, + {value: 0x2a55, lo: 0xb2, hi: 0xb2}, + {value: 0x2a75, lo: 0xb3, hi: 0xb3}, + {value: 0x2a95, lo: 0xb4, hi: 0xb4}, + {value: 0x2a75, lo: 0xb5, hi: 0xb5}, + {value: 0x2ab5, lo: 0xb6, hi: 0xb6}, + {value: 0x2ad5, lo: 0xb7, hi: 0xb7}, + {value: 0x2af5, lo: 0xb8, hi: 0xb9}, + {value: 0x2b15, lo: 0xba, hi: 0xbb}, + {value: 0x2b35, lo: 0xbc, hi: 0xbd}, + {value: 0x2b15, lo: 0xbe, hi: 0xbf}, + // Block 0x61, offset 0x317 + {value: 0x0000, lo: 0x03}, + {value: 0x0018, lo: 0x80, hi: 0xa3}, + {value: 0x0040, lo: 0xa4, hi: 0xaf}, + {value: 0x0008, lo: 0xb0, hi: 0xbf}, + // Block 0x62, offset 0x31b + {value: 0x0008, lo: 0x03}, + {value: 0x098a, lo: 0x80, hi: 0x9e}, + {value: 0x0040, lo: 0x9f, hi: 0x9f}, + {value: 0x0a82, lo: 0xa0, hi: 0xbf}, + // Block 0x63, offset 0x31f + {value: 0x0008, lo: 0x01}, + {value: 0x0d19, lo: 0x80, hi: 0xbf}, + // Block 0x64, offset 0x321 + {value: 0x0008, lo: 0x08}, + {value: 0x0f19, lo: 0x80, hi: 0xb0}, + {value: 0x4045, lo: 0xb1, hi: 0xb1}, + {value: 0x10a1, lo: 0xb2, hi: 0xb3}, + {value: 0x4065, lo: 0xb4, hi: 0xb4}, + {value: 0x10b1, lo: 0xb5, hi: 0xb7}, + {value: 0x4085, lo: 0xb8, hi: 0xb8}, + {value: 0x4085, lo: 0xb9, hi: 0xb9}, + {value: 0x10c9, lo: 0xba, hi: 0xbf}, + // Block 0x65, offset 0x32a + {value: 0x0000, lo: 0x03}, + {value: 0x0008, lo: 0x80, hi: 0x8c}, + {value: 0x0040, lo: 0x8d, hi: 0x8f}, + {value: 0x0018, lo: 0x90, hi: 0xbf}, + // Block 0x66, offset 0x32e + {value: 0x0000, lo: 0x04}, + {value: 0x0018, lo: 0x80, hi: 0x86}, + {value: 0x0040, lo: 0x87, hi: 0x8f}, + {value: 0x0008, lo: 0x90, hi: 0xbd}, + {value: 0x0018, lo: 0xbe, hi: 0xbf}, + // Block 0x67, offset 0x333 + {value: 0x0000, lo: 0x04}, + {value: 0x0008, lo: 0x80, hi: 0x8c}, + {value: 0x0018, lo: 0x8d, hi: 0x8f}, + {value: 0x0008, lo: 0x90, hi: 0xab}, + {value: 0x0040, lo: 0xac, hi: 0xbf}, + // Block 0x68, offset 0x338 + {value: 0x0000, lo: 0x05}, + {value: 0x0008, lo: 0x80, hi: 0xa5}, + {value: 0x0018, lo: 0xa6, hi: 0xaf}, + {value: 0x3308, lo: 0xb0, hi: 0xb1}, + {value: 0x0018, lo: 0xb2, hi: 0xb7}, + {value: 0x0040, lo: 0xb8, hi: 0xbf}, + // Block 0x69, offset 0x33e + {value: 0x0000, lo: 0x0f}, + {value: 0x0008, lo: 0x80, hi: 0x81}, + {value: 0x3308, lo: 0x82, hi: 0x82}, + {value: 0x0008, lo: 0x83, hi: 0x85}, + {value: 0x3b08, lo: 0x86, hi: 0x86}, + {value: 0x0008, lo: 0x87, hi: 0x8a}, + {value: 0x3308, lo: 0x8b, hi: 0x8b}, + {value: 0x0008, lo: 0x8c, hi: 0xa2}, + {value: 0x3008, lo: 0xa3, hi: 0xa4}, + {value: 0x3308, lo: 0xa5, hi: 0xa6}, + {value: 0x3008, lo: 0xa7, hi: 0xa7}, + {value: 0x0018, lo: 0xa8, hi: 0xab}, + {value: 0x3b08, lo: 0xac, hi: 0xac}, + {value: 0x0040, lo: 0xad, hi: 0xaf}, + {value: 0x0018, lo: 0xb0, hi: 0xb9}, + {value: 0x0040, lo: 0xba, hi: 0xbf}, + // Block 0x6a, offset 0x34e + {value: 0x0000, lo: 0x05}, + {value: 0x0208, lo: 0x80, hi: 0xb1}, + {value: 0x0108, lo: 0xb2, hi: 0xb2}, + {value: 0x0008, lo: 0xb3, hi: 0xb3}, + {value: 0x0018, lo: 0xb4, hi: 0xb7}, + {value: 0x0040, lo: 0xb8, hi: 0xbf}, + // Block 0x6b, offset 0x354 + {value: 0x0000, lo: 0x03}, + {value: 0x3008, lo: 0x80, hi: 0x81}, + {value: 0x0008, lo: 0x82, hi: 0xb3}, + {value: 0x3008, lo: 0xb4, hi: 0xbf}, + // Block 0x6c, offset 0x358 + {value: 0x0000, lo: 0x0e}, + {value: 0x3008, lo: 0x80, hi: 0x83}, + {value: 0x3b08, lo: 0x84, hi: 0x84}, + {value: 0x3308, lo: 0x85, hi: 0x85}, + {value: 0x0040, lo: 0x86, hi: 0x8d}, + {value: 0x0018, lo: 0x8e, hi: 0x8f}, + {value: 0x0008, lo: 0x90, hi: 0x99}, + {value: 0x0040, lo: 0x9a, hi: 0x9f}, + {value: 0x3308, lo: 0xa0, hi: 0xb1}, + {value: 0x0008, lo: 0xb2, hi: 0xb7}, + {value: 0x0018, lo: 0xb8, hi: 0xba}, + {value: 0x0008, lo: 0xbb, hi: 0xbb}, + {value: 0x0018, lo: 0xbc, hi: 0xbc}, + {value: 0x0008, lo: 0xbd, hi: 0xbe}, + {value: 0x3308, lo: 0xbf, hi: 0xbf}, + // Block 0x6d, offset 0x367 + {value: 0x0000, lo: 0x04}, + {value: 0x0008, lo: 0x80, hi: 0xa5}, + {value: 0x3308, lo: 0xa6, hi: 0xad}, + {value: 0x0018, lo: 0xae, hi: 0xaf}, + {value: 0x0008, lo: 0xb0, hi: 0xbf}, + // Block 0x6e, offset 0x36c + {value: 0x0000, lo: 0x07}, + {value: 0x0008, lo: 0x80, hi: 0x86}, + {value: 0x3308, lo: 0x87, hi: 0x91}, + {value: 0x3008, lo: 0x92, hi: 0x92}, + {value: 0x3808, lo: 0x93, hi: 0x93}, + {value: 0x0040, lo: 0x94, hi: 0x9e}, + {value: 0x0018, lo: 0x9f, hi: 0xbc}, + {value: 0x0040, lo: 0xbd, hi: 0xbf}, + // Block 0x6f, offset 0x374 + {value: 0x0000, lo: 0x09}, + {value: 0x3308, lo: 0x80, hi: 0x82}, + {value: 0x3008, lo: 0x83, hi: 0x83}, + {value: 0x0008, lo: 0x84, hi: 0xb2}, + {value: 0x3308, lo: 0xb3, hi: 0xb3}, + {value: 0x3008, lo: 0xb4, hi: 0xb5}, + {value: 0x3308, lo: 0xb6, hi: 0xb9}, + {value: 0x3008, lo: 0xba, hi: 0xbb}, + {value: 0x3308, lo: 0xbc, hi: 0xbd}, + {value: 0x3008, lo: 0xbe, hi: 0xbf}, + // Block 0x70, offset 0x37e + {value: 0x0000, lo: 0x0a}, + {value: 0x3808, lo: 0x80, hi: 0x80}, + {value: 0x0018, lo: 0x81, hi: 0x8d}, + {value: 0x0040, lo: 0x8e, hi: 0x8e}, + {value: 0x0008, lo: 0x8f, hi: 0x99}, + {value: 0x0040, lo: 0x9a, hi: 0x9d}, + {value: 0x0018, lo: 0x9e, hi: 0x9f}, + {value: 0x0008, lo: 0xa0, hi: 0xa4}, + {value: 0x3308, lo: 0xa5, hi: 0xa5}, + {value: 0x0008, lo: 0xa6, hi: 0xbe}, + {value: 0x0040, lo: 0xbf, hi: 0xbf}, + // Block 0x71, offset 0x389 + {value: 0x0000, lo: 0x07}, + {value: 0x0008, lo: 0x80, hi: 0xa8}, + {value: 0x3308, lo: 0xa9, hi: 0xae}, + {value: 0x3008, lo: 0xaf, hi: 0xb0}, + {value: 0x3308, lo: 0xb1, hi: 0xb2}, + {value: 0x3008, lo: 0xb3, hi: 0xb4}, + {value: 0x3308, lo: 0xb5, hi: 0xb6}, + {value: 0x0040, lo: 0xb7, hi: 0xbf}, + // Block 0x72, offset 0x391 + {value: 0x0000, lo: 0x10}, + {value: 0x0008, lo: 0x80, hi: 0x82}, + {value: 0x3308, lo: 0x83, hi: 0x83}, + {value: 0x0008, lo: 0x84, hi: 0x8b}, + {value: 0x3308, lo: 0x8c, hi: 0x8c}, + {value: 0x3008, lo: 0x8d, hi: 0x8d}, + {value: 0x0040, lo: 0x8e, hi: 0x8f}, + {value: 0x0008, lo: 0x90, hi: 0x99}, + {value: 0x0040, lo: 0x9a, hi: 0x9b}, + {value: 0x0018, lo: 0x9c, hi: 0x9f}, + {value: 0x0008, lo: 0xa0, hi: 0xb6}, + {value: 0x0018, lo: 0xb7, hi: 0xb9}, + {value: 0x0008, lo: 0xba, hi: 0xba}, + {value: 0x3008, lo: 0xbb, hi: 0xbb}, + {value: 0x3308, lo: 0xbc, hi: 0xbc}, + {value: 0x3008, lo: 0xbd, hi: 0xbd}, + {value: 0x0008, lo: 0xbe, hi: 0xbf}, + // Block 0x73, offset 0x3a2 + {value: 0x0000, lo: 0x08}, + {value: 0x0008, lo: 0x80, hi: 0xaf}, + {value: 0x3308, lo: 0xb0, hi: 0xb0}, + {value: 0x0008, lo: 0xb1, hi: 0xb1}, + {value: 0x3308, lo: 0xb2, hi: 0xb4}, + {value: 0x0008, lo: 0xb5, hi: 0xb6}, + {value: 0x3308, lo: 0xb7, hi: 0xb8}, + {value: 0x0008, lo: 0xb9, hi: 0xbd}, + {value: 0x3308, lo: 0xbe, hi: 0xbf}, + // Block 0x74, offset 0x3ab + {value: 0x0000, lo: 0x0f}, + {value: 0x0008, lo: 0x80, hi: 0x80}, + {value: 0x3308, lo: 0x81, hi: 0x81}, + {value: 0x0008, lo: 0x82, hi: 0x82}, + {value: 0x0040, lo: 0x83, hi: 0x9a}, + {value: 0x0008, lo: 0x9b, hi: 0x9d}, + {value: 0x0018, lo: 0x9e, hi: 0x9f}, + {value: 0x0008, lo: 0xa0, hi: 0xaa}, + {value: 0x3008, lo: 0xab, hi: 0xab}, + {value: 0x3308, lo: 0xac, hi: 0xad}, + {value: 0x3008, lo: 0xae, hi: 0xaf}, + {value: 0x0018, lo: 0xb0, hi: 0xb1}, + {value: 0x0008, lo: 0xb2, hi: 0xb4}, + {value: 0x3008, lo: 0xb5, hi: 0xb5}, + {value: 0x3b08, lo: 0xb6, hi: 0xb6}, + {value: 0x0040, lo: 0xb7, hi: 0xbf}, + // Block 0x75, offset 0x3bb + {value: 0x0000, lo: 0x0c}, + {value: 0x0040, lo: 0x80, hi: 0x80}, + {value: 0x0008, lo: 0x81, hi: 0x86}, + {value: 0x0040, lo: 0x87, hi: 0x88}, + {value: 0x0008, lo: 0x89, hi: 0x8e}, + {value: 0x0040, lo: 0x8f, hi: 0x90}, + {value: 0x0008, lo: 0x91, hi: 0x96}, + {value: 0x0040, lo: 0x97, hi: 0x9f}, + {value: 0x0008, lo: 0xa0, hi: 0xa6}, + {value: 0x0040, lo: 0xa7, hi: 0xa7}, + {value: 0x0008, lo: 0xa8, hi: 0xae}, + {value: 0x0040, lo: 0xaf, hi: 0xaf}, + {value: 0x0008, lo: 0xb0, hi: 0xbf}, + // Block 0x76, offset 0x3c8 + {value: 0x0000, lo: 0x0b}, + {value: 0x0008, lo: 0x80, hi: 0x9a}, + {value: 0x0018, lo: 0x9b, hi: 0x9b}, + {value: 0x449d, lo: 0x9c, hi: 0x9c}, + {value: 0x44b5, lo: 0x9d, hi: 0x9d}, + {value: 0x0941, lo: 0x9e, hi: 0x9e}, + {value: 0xe06d, lo: 0x9f, hi: 0x9f}, + {value: 0x0008, lo: 0xa0, hi: 0xa8}, + {value: 0x13f9, lo: 0xa9, hi: 0xa9}, + {value: 0x0018, lo: 0xaa, hi: 0xab}, + {value: 0x0040, lo: 0xac, hi: 0xaf}, + {value: 0x44cd, lo: 0xb0, hi: 0xbf}, + // Block 0x77, offset 0x3d4 + {value: 0x0000, lo: 0x04}, + {value: 0x44ed, lo: 0x80, hi: 0x8f}, + {value: 0x450d, lo: 0x90, hi: 0x9f}, + {value: 0x452d, lo: 0xa0, hi: 0xaf}, + {value: 0x450d, lo: 0xb0, hi: 0xbf}, + // Block 0x78, offset 0x3d9 + {value: 0x0000, lo: 0x0c}, + {value: 0x0008, lo: 0x80, hi: 0xa2}, + {value: 0x3008, lo: 0xa3, hi: 0xa4}, + {value: 0x3308, lo: 0xa5, hi: 0xa5}, + {value: 0x3008, lo: 0xa6, hi: 0xa7}, + {value: 0x3308, lo: 0xa8, hi: 0xa8}, + {value: 0x3008, lo: 0xa9, hi: 0xaa}, + {value: 0x0018, lo: 0xab, hi: 0xab}, + {value: 0x3008, lo: 0xac, hi: 0xac}, + {value: 0x3b08, lo: 0xad, hi: 0xad}, + {value: 0x0040, lo: 0xae, hi: 0xaf}, + {value: 0x0008, lo: 0xb0, hi: 0xb9}, + {value: 0x0040, lo: 0xba, hi: 0xbf}, + // Block 0x79, offset 0x3e6 + {value: 0x0000, lo: 0x03}, + {value: 0x0008, lo: 0x80, hi: 0xa3}, + {value: 0x0040, lo: 0xa4, hi: 0xaf}, + {value: 0x0018, lo: 0xb0, hi: 0xbf}, + // Block 0x7a, offset 0x3ea + {value: 0x0000, lo: 0x04}, + {value: 0x0018, lo: 0x80, hi: 0x86}, + {value: 0x0040, lo: 0x87, hi: 0x8a}, + {value: 0x0018, lo: 0x8b, hi: 0xbb}, + {value: 0x0040, lo: 0xbc, hi: 0xbf}, + // Block 0x7b, offset 0x3ef + {value: 0x0000, lo: 0x01}, + {value: 0x0040, lo: 0x80, hi: 0xbf}, + // Block 0x7c, offset 0x3f1 + {value: 0x0020, lo: 0x01}, + {value: 0x454d, lo: 0x80, hi: 0xbf}, + // Block 0x7d, offset 0x3f3 + {value: 0x0020, lo: 0x03}, + {value: 0x4d4d, lo: 0x80, hi: 0x94}, + {value: 0x4b0d, lo: 0x95, hi: 0x95}, + {value: 0x4fed, lo: 0x96, hi: 0xbf}, + // Block 0x7e, offset 0x3f7 + {value: 0x0020, lo: 0x01}, + {value: 0x552d, lo: 0x80, hi: 0xbf}, + // Block 0x7f, offset 0x3f9 + {value: 0x0020, lo: 0x03}, + {value: 0x5d2d, lo: 0x80, hi: 0x84}, + {value: 0x568d, lo: 0x85, hi: 0x85}, + {value: 0x5dcd, lo: 0x86, hi: 0xbf}, + // Block 0x80, offset 0x3fd + {value: 0x0020, lo: 0x08}, + {value: 0x6b8d, lo: 0x80, hi: 0x8f}, + {value: 0x6d4d, lo: 0x90, hi: 0x90}, + {value: 0x6d8d, lo: 0x91, hi: 0xab}, + {value: 0x1401, lo: 0xac, hi: 0xac}, + {value: 0x70ed, lo: 0xad, hi: 0xad}, + {value: 0x0040, lo: 0xae, hi: 0xae}, + {value: 0x0040, lo: 0xaf, hi: 0xaf}, + {value: 0x710d, lo: 0xb0, hi: 0xbf}, + // Block 0x81, offset 0x406 + {value: 0x0020, lo: 0x05}, + {value: 0x730d, lo: 0x80, hi: 0xad}, + {value: 0x656d, lo: 0xae, hi: 0xae}, + {value: 0x78cd, lo: 0xaf, hi: 0xb5}, + {value: 0x6f8d, lo: 0xb6, hi: 0xb6}, + {value: 0x79ad, lo: 0xb7, hi: 0xbf}, + // Block 0x82, offset 0x40c + {value: 0x0008, lo: 0x03}, + {value: 0x1751, lo: 0x80, hi: 0x82}, + {value: 0x1741, lo: 0x83, hi: 0x83}, + {value: 0x1769, lo: 0x84, hi: 0xbf}, + // Block 0x83, offset 0x410 + {value: 0x0008, lo: 0x0f}, + {value: 0x1d81, lo: 0x80, hi: 0x83}, + {value: 0x1d99, lo: 0x84, hi: 0x85}, + {value: 0x1da1, lo: 0x86, hi: 0x87}, + {value: 0x1da9, lo: 0x88, hi: 0x8f}, + {value: 0x0040, lo: 0x90, hi: 0x90}, + {value: 0x0040, lo: 0x91, hi: 0x91}, + {value: 0x1de9, lo: 0x92, hi: 0x97}, + {value: 0x1e11, lo: 0x98, hi: 0x9c}, + {value: 0x1e31, lo: 0x9d, hi: 0xb3}, + {value: 0x1d71, lo: 0xb4, hi: 0xb4}, + {value: 0x1d81, lo: 0xb5, hi: 0xb5}, + {value: 0x1ee9, lo: 0xb6, hi: 0xbb}, + {value: 0x1f09, lo: 0xbc, hi: 0xbc}, + {value: 0x1ef9, lo: 0xbd, hi: 0xbd}, + {value: 0x1f19, lo: 0xbe, hi: 0xbf}, + // Block 0x84, offset 0x420 + {value: 0x0000, lo: 0x09}, + {value: 0x0008, lo: 0x80, hi: 0x8b}, + {value: 0x0040, lo: 0x8c, hi: 0x8c}, + {value: 0x0008, lo: 0x8d, hi: 0xa6}, + {value: 0x0040, lo: 0xa7, hi: 0xa7}, + {value: 0x0008, lo: 0xa8, hi: 0xba}, + {value: 0x0040, lo: 0xbb, hi: 0xbb}, + {value: 0x0008, lo: 0xbc, hi: 0xbd}, + {value: 0x0040, lo: 0xbe, hi: 0xbe}, + {value: 0x0008, lo: 0xbf, hi: 0xbf}, + // Block 0x85, offset 0x42a + {value: 0x0000, lo: 0x04}, + {value: 0x0008, lo: 0x80, hi: 0x8d}, + {value: 0x0040, lo: 0x8e, hi: 0x8f}, + {value: 0x0008, lo: 0x90, hi: 0x9d}, + {value: 0x0040, lo: 0x9e, hi: 0xbf}, + // Block 0x86, offset 0x42f + {value: 0x0000, lo: 0x02}, + {value: 0x0008, lo: 0x80, hi: 0xba}, + {value: 0x0040, lo: 0xbb, hi: 0xbf}, + // Block 0x87, offset 0x432 + {value: 0x0000, lo: 0x05}, + {value: 0x0018, lo: 0x80, hi: 0x82}, + {value: 0x0040, lo: 0x83, hi: 0x86}, + {value: 0x0018, lo: 0x87, hi: 0xb3}, + {value: 0x0040, lo: 0xb4, hi: 0xb6}, + {value: 0x0018, lo: 0xb7, hi: 0xbf}, + // Block 0x88, offset 0x438 + {value: 0x0000, lo: 0x06}, + {value: 0x0018, lo: 0x80, hi: 0x8e}, + {value: 0x0040, lo: 0x8f, hi: 0x8f}, + {value: 0x0018, lo: 0x90, hi: 0x9c}, + {value: 0x0040, lo: 0x9d, hi: 0x9f}, + {value: 0x0018, lo: 0xa0, hi: 0xa0}, + {value: 0x0040, lo: 0xa1, hi: 0xbf}, + // Block 0x89, offset 0x43f + {value: 0x0000, lo: 0x04}, + {value: 0x0040, lo: 0x80, hi: 0x8f}, + {value: 0x0018, lo: 0x90, hi: 0xbc}, + {value: 0x3308, lo: 0xbd, hi: 0xbd}, + {value: 0x0040, lo: 0xbe, hi: 0xbf}, + // Block 0x8a, offset 0x444 + {value: 0x0000, lo: 0x03}, + {value: 0x0008, lo: 0x80, hi: 0x9c}, + {value: 0x0040, lo: 0x9d, hi: 0x9f}, + {value: 0x0008, lo: 0xa0, hi: 0xbf}, + // Block 0x8b, offset 0x448 + {value: 0x0000, lo: 0x05}, + {value: 0x0008, lo: 0x80, hi: 0x90}, + {value: 0x0040, lo: 0x91, hi: 0x9f}, + {value: 0x3308, lo: 0xa0, hi: 0xa0}, + {value: 0x0018, lo: 0xa1, hi: 0xbb}, + {value: 0x0040, lo: 0xbc, hi: 0xbf}, + // Block 0x8c, offset 0x44e + {value: 0x0000, lo: 0x04}, + {value: 0x0008, lo: 0x80, hi: 0x9f}, + {value: 0x0018, lo: 0xa0, hi: 0xa3}, + {value: 0x0040, lo: 0xa4, hi: 0xac}, + {value: 0x0008, lo: 0xad, hi: 0xbf}, + // Block 0x8d, offset 0x453 + {value: 0x0000, lo: 0x08}, + {value: 0x0008, lo: 0x80, hi: 0x80}, + {value: 0x0018, lo: 0x81, hi: 0x81}, + {value: 0x0008, lo: 0x82, hi: 0x89}, + {value: 0x0018, lo: 0x8a, hi: 0x8a}, + {value: 0x0040, lo: 0x8b, hi: 0x8f}, + {value: 0x0008, lo: 0x90, hi: 0xb5}, + {value: 0x3308, lo: 0xb6, hi: 0xba}, + {value: 0x0040, lo: 0xbb, hi: 0xbf}, + // Block 0x8e, offset 0x45c + {value: 0x0000, lo: 0x04}, + {value: 0x0008, lo: 0x80, hi: 0x9d}, + {value: 0x0040, lo: 0x9e, hi: 0x9e}, + {value: 0x0018, lo: 0x9f, hi: 0x9f}, + {value: 0x0008, lo: 0xa0, hi: 0xbf}, + // Block 0x8f, offset 0x461 + {value: 0x0000, lo: 0x05}, + {value: 0x0008, lo: 0x80, hi: 0x83}, + {value: 0x0040, lo: 0x84, hi: 0x87}, + {value: 0x0008, lo: 0x88, hi: 0x8f}, + {value: 0x0018, lo: 0x90, hi: 0x95}, + {value: 0x0040, lo: 0x96, hi: 0xbf}, + // Block 0x90, offset 0x467 + {value: 0x0000, lo: 0x06}, + {value: 0xe145, lo: 0x80, hi: 0x87}, + {value: 0xe1c5, lo: 0x88, hi: 0x8f}, + {value: 0xe145, lo: 0x90, hi: 0x97}, + {value: 0x8b0d, lo: 0x98, hi: 0x9f}, + {value: 0x8b25, lo: 0xa0, hi: 0xa7}, + {value: 0x0008, lo: 0xa8, hi: 0xbf}, + // Block 0x91, offset 0x46e + {value: 0x0000, lo: 0x06}, + {value: 0x0008, lo: 0x80, hi: 0x9d}, + {value: 0x0040, lo: 0x9e, hi: 0x9f}, + {value: 0x0008, lo: 0xa0, hi: 0xa9}, + {value: 0x0040, lo: 0xaa, hi: 0xaf}, + {value: 0x8b25, lo: 0xb0, hi: 0xb7}, + {value: 0x8b0d, lo: 0xb8, hi: 0xbf}, + // Block 0x92, offset 0x475 + {value: 0x0000, lo: 0x06}, + {value: 0xe145, lo: 0x80, hi: 0x87}, + {value: 0xe1c5, lo: 0x88, hi: 0x8f}, + {value: 0xe145, lo: 0x90, hi: 0x93}, + {value: 0x0040, lo: 0x94, hi: 0x97}, + {value: 0x0008, lo: 0x98, hi: 0xbb}, + {value: 0x0040, lo: 0xbc, hi: 0xbf}, + // Block 0x93, offset 0x47c + {value: 0x0000, lo: 0x03}, + {value: 0x0008, lo: 0x80, hi: 0xa7}, + {value: 0x0040, lo: 0xa8, hi: 0xaf}, + {value: 0x0008, lo: 0xb0, hi: 0xbf}, + // Block 0x94, offset 0x480 + {value: 0x0000, lo: 0x02}, + {value: 0x0008, lo: 0x80, hi: 0xb6}, + {value: 0x0040, lo: 0xb7, hi: 0xbf}, + // Block 0x95, offset 0x483 + {value: 0x0000, lo: 0x04}, + {value: 0x0008, lo: 0x80, hi: 0x95}, + {value: 0x0040, lo: 0x96, hi: 0x9f}, + {value: 0x0008, lo: 0xa0, hi: 0xa7}, + {value: 0x0040, lo: 0xa8, hi: 0xbf}, + // Block 0x96, offset 0x488 + {value: 0x0000, lo: 0x0b}, + {value: 0x0808, lo: 0x80, hi: 0x85}, + {value: 0x0040, lo: 0x86, hi: 0x87}, + {value: 0x0808, lo: 0x88, hi: 0x88}, + {value: 0x0040, lo: 0x89, hi: 0x89}, + {value: 0x0808, lo: 0x8a, hi: 0xb5}, + {value: 0x0040, lo: 0xb6, hi: 0xb6}, + {value: 0x0808, lo: 0xb7, hi: 0xb8}, + {value: 0x0040, lo: 0xb9, hi: 0xbb}, + {value: 0x0808, lo: 0xbc, hi: 0xbc}, + {value: 0x0040, lo: 0xbd, hi: 0xbe}, + {value: 0x0808, lo: 0xbf, hi: 0xbf}, + // Block 0x97, offset 0x494 + {value: 0x0000, lo: 0x05}, + {value: 0x0808, lo: 0x80, hi: 0x95}, + {value: 0x0040, lo: 0x96, hi: 0x96}, + {value: 0x0818, lo: 0x97, hi: 0x9f}, + {value: 0x0808, lo: 0xa0, hi: 0xb6}, + {value: 0x0818, lo: 0xb7, hi: 0xbf}, + // Block 0x98, offset 0x49a + {value: 0x0000, lo: 0x04}, + {value: 0x0808, lo: 0x80, hi: 0x9e}, + {value: 0x0040, lo: 0x9f, hi: 0xa6}, + {value: 0x0818, lo: 0xa7, hi: 0xaf}, + {value: 0x0040, lo: 0xb0, hi: 0xbf}, + // Block 0x99, offset 0x49f + {value: 0x0000, lo: 0x06}, + {value: 0x0040, lo: 0x80, hi: 0x9f}, + {value: 0x0808, lo: 0xa0, hi: 0xb2}, + {value: 0x0040, lo: 0xb3, hi: 0xb3}, + {value: 0x0808, lo: 0xb4, hi: 0xb5}, + {value: 0x0040, lo: 0xb6, hi: 0xba}, + {value: 0x0818, lo: 0xbb, hi: 0xbf}, + // Block 0x9a, offset 0x4a6 + {value: 0x0000, lo: 0x07}, + {value: 0x0808, lo: 0x80, hi: 0x95}, + {value: 0x0818, lo: 0x96, hi: 0x9b}, + {value: 0x0040, lo: 0x9c, hi: 0x9e}, + {value: 0x0018, lo: 0x9f, hi: 0x9f}, + {value: 0x0808, lo: 0xa0, hi: 0xb9}, + {value: 0x0040, lo: 0xba, hi: 0xbe}, + {value: 0x0818, lo: 0xbf, hi: 0xbf}, + // Block 0x9b, offset 0x4ae + {value: 0x0000, lo: 0x04}, + {value: 0x0808, lo: 0x80, hi: 0xb7}, + {value: 0x0040, lo: 0xb8, hi: 0xbb}, + {value: 0x0818, lo: 0xbc, hi: 0xbd}, + {value: 0x0808, lo: 0xbe, hi: 0xbf}, + // Block 0x9c, offset 0x4b3 + {value: 0x0000, lo: 0x03}, + {value: 0x0818, lo: 0x80, hi: 0x8f}, + {value: 0x0040, lo: 0x90, hi: 0x91}, + {value: 0x0818, lo: 0x92, hi: 0xbf}, + // Block 0x9d, offset 0x4b7 + {value: 0x0000, lo: 0x0f}, + {value: 0x0808, lo: 0x80, hi: 0x80}, + {value: 0x3308, lo: 0x81, hi: 0x83}, + {value: 0x0040, lo: 0x84, hi: 0x84}, + {value: 0x3308, lo: 0x85, hi: 0x86}, + {value: 0x0040, lo: 0x87, hi: 0x8b}, + {value: 0x3308, lo: 0x8c, hi: 0x8f}, + {value: 0x0808, lo: 0x90, hi: 0x93}, + {value: 0x0040, lo: 0x94, hi: 0x94}, + {value: 0x0808, lo: 0x95, hi: 0x97}, + {value: 0x0040, lo: 0x98, hi: 0x98}, + {value: 0x0808, lo: 0x99, hi: 0xb5}, + {value: 0x0040, lo: 0xb6, hi: 0xb7}, + {value: 0x3308, lo: 0xb8, hi: 0xba}, + {value: 0x0040, lo: 0xbb, hi: 0xbe}, + {value: 0x3b08, lo: 0xbf, hi: 0xbf}, + // Block 0x9e, offset 0x4c7 + {value: 0x0000, lo: 0x06}, + {value: 0x0818, lo: 0x80, hi: 0x88}, + {value: 0x0040, lo: 0x89, hi: 0x8f}, + {value: 0x0818, lo: 0x90, hi: 0x98}, + {value: 0x0040, lo: 0x99, hi: 0x9f}, + {value: 0x0808, lo: 0xa0, hi: 0xbc}, + {value: 0x0818, lo: 0xbd, hi: 0xbf}, + // Block 0x9f, offset 0x4ce + {value: 0x0000, lo: 0x03}, + {value: 0x0808, lo: 0x80, hi: 0x9c}, + {value: 0x0818, lo: 0x9d, hi: 0x9f}, + {value: 0x0040, lo: 0xa0, hi: 0xbf}, + // Block 0xa0, offset 0x4d2 + {value: 0x0000, lo: 0x03}, + {value: 0x0808, lo: 0x80, hi: 0xb5}, + {value: 0x0040, lo: 0xb6, hi: 0xb8}, + {value: 0x0018, lo: 0xb9, hi: 0xbf}, + // Block 0xa1, offset 0x4d6 + {value: 0x0000, lo: 0x06}, + {value: 0x0808, lo: 0x80, hi: 0x95}, + {value: 0x0040, lo: 0x96, hi: 0x97}, + {value: 0x0818, lo: 0x98, hi: 0x9f}, + {value: 0x0808, lo: 0xa0, hi: 0xb2}, + {value: 0x0040, lo: 0xb3, hi: 0xb7}, + {value: 0x0818, lo: 0xb8, hi: 0xbf}, + // Block 0xa2, offset 0x4dd + {value: 0x0000, lo: 0x01}, + {value: 0x0808, lo: 0x80, hi: 0xbf}, + // Block 0xa3, offset 0x4df + {value: 0x0000, lo: 0x02}, + {value: 0x0808, lo: 0x80, hi: 0x88}, + {value: 0x0040, lo: 0x89, hi: 0xbf}, + // Block 0xa4, offset 0x4e2 + {value: 0x0000, lo: 0x02}, + {value: 0x03dd, lo: 0x80, hi: 0xb2}, + {value: 0x0040, lo: 0xb3, hi: 0xbf}, + // Block 0xa5, offset 0x4e5 + {value: 0x0000, lo: 0x03}, + {value: 0x0808, lo: 0x80, hi: 0xb2}, + {value: 0x0040, lo: 0xb3, hi: 0xb9}, + {value: 0x0818, lo: 0xba, hi: 0xbf}, + // Block 0xa6, offset 0x4e9 + {value: 0x0000, lo: 0x08}, + {value: 0x0908, lo: 0x80, hi: 0x80}, + {value: 0x0a08, lo: 0x81, hi: 0xa1}, + {value: 0x0c08, lo: 0xa2, hi: 0xa2}, + {value: 0x0a08, lo: 0xa3, hi: 0xa3}, + {value: 0x3308, lo: 0xa4, hi: 0xa7}, + {value: 0x0040, lo: 0xa8, hi: 0xaf}, + {value: 0x0808, lo: 0xb0, hi: 0xb9}, + {value: 0x0040, lo: 0xba, hi: 0xbf}, + // Block 0xa7, offset 0x4f2 + {value: 0x0000, lo: 0x03}, + {value: 0x0040, lo: 0x80, hi: 0x9f}, + {value: 0x0818, lo: 0xa0, hi: 0xbe}, + {value: 0x0040, lo: 0xbf, hi: 0xbf}, + // Block 0xa8, offset 0x4f6 + {value: 0x0000, lo: 0x07}, + {value: 0x0808, lo: 0x80, hi: 0xa9}, + {value: 0x0040, lo: 0xaa, hi: 0xaa}, + {value: 0x3308, lo: 0xab, hi: 0xac}, + {value: 0x0818, lo: 0xad, hi: 0xad}, + {value: 0x0040, lo: 0xae, hi: 0xaf}, + {value: 0x0808, lo: 0xb0, hi: 0xb1}, + {value: 0x0040, lo: 0xb2, hi: 0xbf}, + // Block 0xa9, offset 0x4fe + {value: 0x0000, lo: 0x02}, + {value: 0x0040, lo: 0x80, hi: 0xbc}, + {value: 0x3308, lo: 0xbd, hi: 0xbf}, + // Block 0xaa, offset 0x501 + {value: 0x0000, lo: 0x07}, + {value: 0x0808, lo: 0x80, hi: 0x9c}, + {value: 0x0818, lo: 0x9d, hi: 0xa6}, + {value: 0x0808, lo: 0xa7, hi: 0xa7}, + {value: 0x0040, lo: 0xa8, hi: 0xaf}, + {value: 0x0a08, lo: 0xb0, hi: 0xb2}, + {value: 0x0c08, lo: 0xb3, hi: 0xb3}, + {value: 0x0a08, lo: 0xb4, hi: 0xbf}, + // Block 0xab, offset 0x509 + {value: 0x0000, lo: 0x0a}, + {value: 0x0a08, lo: 0x80, hi: 0x84}, + {value: 0x0808, lo: 0x85, hi: 0x85}, + {value: 0x3308, lo: 0x86, hi: 0x90}, + {value: 0x0a18, lo: 0x91, hi: 0x93}, + {value: 0x0c18, lo: 0x94, hi: 0x94}, + {value: 0x0818, lo: 0x95, hi: 0x99}, + {value: 0x0040, lo: 0x9a, hi: 0xaf}, + {value: 0x0a08, lo: 0xb0, hi: 0xb3}, + {value: 0x0c08, lo: 0xb4, hi: 0xb5}, + {value: 0x0a08, lo: 0xb6, hi: 0xbf}, + // Block 0xac, offset 0x514 + {value: 0x0000, lo: 0x0e}, + {value: 0x0a08, lo: 0x80, hi: 0x81}, + {value: 0x3308, lo: 0x82, hi: 0x85}, + {value: 0x0818, lo: 0x86, hi: 0x89}, + {value: 0x0040, lo: 0x8a, hi: 0xaf}, + {value: 0x0a08, lo: 0xb0, hi: 0xb0}, + {value: 0x0808, lo: 0xb1, hi: 0xb1}, + {value: 0x0a08, lo: 0xb2, hi: 0xb3}, + {value: 0x0c08, lo: 0xb4, hi: 0xb6}, + {value: 0x0808, lo: 0xb7, hi: 0xb7}, + {value: 0x0a08, lo: 0xb8, hi: 0xb8}, + {value: 0x0c08, lo: 0xb9, hi: 0xba}, + {value: 0x0a08, lo: 0xbb, hi: 0xbc}, + {value: 0x0c08, lo: 0xbd, hi: 0xbd}, + {value: 0x0a08, lo: 0xbe, hi: 0xbf}, + // Block 0xad, offset 0x523 + {value: 0x0000, lo: 0x0b}, + {value: 0x0808, lo: 0x80, hi: 0x80}, + {value: 0x0a08, lo: 0x81, hi: 0x81}, + {value: 0x0c08, lo: 0x82, hi: 0x83}, + {value: 0x0a08, lo: 0x84, hi: 0x84}, + {value: 0x0818, lo: 0x85, hi: 0x88}, + {value: 0x0c18, lo: 0x89, hi: 0x89}, + {value: 0x0a18, lo: 0x8a, hi: 0x8a}, + {value: 0x0918, lo: 0x8b, hi: 0x8b}, + {value: 0x0040, lo: 0x8c, hi: 0x9f}, + {value: 0x0808, lo: 0xa0, hi: 0xb6}, + {value: 0x0040, lo: 0xb7, hi: 0xbf}, + // Block 0xae, offset 0x52f + {value: 0x0000, lo: 0x05}, + {value: 0x3008, lo: 0x80, hi: 0x80}, + {value: 0x3308, lo: 0x81, hi: 0x81}, + {value: 0x3008, lo: 0x82, hi: 0x82}, + {value: 0x0008, lo: 0x83, hi: 0xb7}, + {value: 0x3308, lo: 0xb8, hi: 0xbf}, + // Block 0xaf, offset 0x535 + {value: 0x0000, lo: 0x0c}, + {value: 0x3308, lo: 0x80, hi: 0x85}, + {value: 0x3b08, lo: 0x86, hi: 0x86}, + {value: 0x0018, lo: 0x87, hi: 0x8d}, + {value: 0x0040, lo: 0x8e, hi: 0x91}, + {value: 0x0018, lo: 0x92, hi: 0xa5}, + {value: 0x0008, lo: 0xa6, hi: 0xaf}, + {value: 0x3b08, lo: 0xb0, hi: 0xb0}, + {value: 0x0008, lo: 0xb1, hi: 0xb2}, + {value: 0x3308, lo: 0xb3, hi: 0xb4}, + {value: 0x0008, lo: 0xb5, hi: 0xb5}, + {value: 0x0040, lo: 0xb6, hi: 0xbe}, + {value: 0x3b08, lo: 0xbf, hi: 0xbf}, + // Block 0xb0, offset 0x542 + {value: 0x0000, lo: 0x0b}, + {value: 0x3308, lo: 0x80, hi: 0x81}, + {value: 0x3008, lo: 0x82, hi: 0x82}, + {value: 0x0008, lo: 0x83, hi: 0xaf}, + {value: 0x3008, lo: 0xb0, hi: 0xb2}, + {value: 0x3308, lo: 0xb3, hi: 0xb6}, + {value: 0x3008, lo: 0xb7, hi: 0xb8}, + {value: 0x3b08, lo: 0xb9, hi: 0xb9}, + {value: 0x3308, lo: 0xba, hi: 0xba}, + {value: 0x0018, lo: 0xbb, hi: 0xbc}, + {value: 0x0040, lo: 0xbd, hi: 0xbd}, + {value: 0x0018, lo: 0xbe, hi: 0xbf}, + // Block 0xb1, offset 0x54e + {value: 0x0000, lo: 0x07}, + {value: 0x0018, lo: 0x80, hi: 0x81}, + {value: 0x3308, lo: 0x82, hi: 0x82}, + {value: 0x0040, lo: 0x83, hi: 0x8f}, + {value: 0x0008, lo: 0x90, hi: 0xa8}, + {value: 0x0040, lo: 0xa9, hi: 0xaf}, + {value: 0x0008, lo: 0xb0, hi: 0xb9}, + {value: 0x0040, lo: 0xba, hi: 0xbf}, + // Block 0xb2, offset 0x556 + {value: 0x0000, lo: 0x08}, + {value: 0x3308, lo: 0x80, hi: 0x82}, + {value: 0x0008, lo: 0x83, hi: 0xa6}, + {value: 0x3308, lo: 0xa7, hi: 0xab}, + {value: 0x3008, lo: 0xac, hi: 0xac}, + {value: 0x3308, lo: 0xad, hi: 0xb2}, + {value: 0x3b08, lo: 0xb3, hi: 0xb4}, + {value: 0x0040, lo: 0xb5, hi: 0xb5}, + {value: 0x0008, lo: 0xb6, hi: 0xbf}, + // Block 0xb3, offset 0x55f + {value: 0x0000, lo: 0x0a}, + {value: 0x0018, lo: 0x80, hi: 0x83}, + {value: 0x0008, lo: 0x84, hi: 0x84}, + {value: 0x3008, lo: 0x85, hi: 0x86}, + {value: 0x0008, lo: 0x87, hi: 0x87}, + {value: 0x0040, lo: 0x88, hi: 0x8f}, + {value: 0x0008, lo: 0x90, hi: 0xb2}, + {value: 0x3308, lo: 0xb3, hi: 0xb3}, + {value: 0x0018, lo: 0xb4, hi: 0xb5}, + {value: 0x0008, lo: 0xb6, hi: 0xb6}, + {value: 0x0040, lo: 0xb7, hi: 0xbf}, + // Block 0xb4, offset 0x56a + {value: 0x0000, lo: 0x06}, + {value: 0x3308, lo: 0x80, hi: 0x81}, + {value: 0x3008, lo: 0x82, hi: 0x82}, + {value: 0x0008, lo: 0x83, hi: 0xb2}, + {value: 0x3008, lo: 0xb3, hi: 0xb5}, + {value: 0x3308, lo: 0xb6, hi: 0xbe}, + {value: 0x3008, lo: 0xbf, hi: 0xbf}, + // Block 0xb5, offset 0x571 + {value: 0x0000, lo: 0x0e}, + {value: 0x3808, lo: 0x80, hi: 0x80}, + {value: 0x0008, lo: 0x81, hi: 0x84}, + {value: 0x0018, lo: 0x85, hi: 0x88}, + {value: 0x3308, lo: 0x89, hi: 0x8c}, + {value: 0x0018, lo: 0x8d, hi: 0x8d}, + {value: 0x3008, lo: 0x8e, hi: 0x8e}, + {value: 0x3308, lo: 0x8f, hi: 0x8f}, + {value: 0x0008, lo: 0x90, hi: 0x9a}, + {value: 0x0018, lo: 0x9b, hi: 0x9b}, + {value: 0x0008, lo: 0x9c, hi: 0x9c}, + {value: 0x0018, lo: 0x9d, hi: 0x9f}, + {value: 0x0040, lo: 0xa0, hi: 0xa0}, + {value: 0x0018, lo: 0xa1, hi: 0xb4}, + {value: 0x0040, lo: 0xb5, hi: 0xbf}, + // Block 0xb6, offset 0x580 + {value: 0x0000, lo: 0x0c}, + {value: 0x0008, lo: 0x80, hi: 0x91}, + {value: 0x0040, lo: 0x92, hi: 0x92}, + {value: 0x0008, lo: 0x93, hi: 0xab}, + {value: 0x3008, lo: 0xac, hi: 0xae}, + {value: 0x3308, lo: 0xaf, hi: 0xb1}, + {value: 0x3008, lo: 0xb2, hi: 0xb3}, + {value: 0x3308, lo: 0xb4, hi: 0xb4}, + {value: 0x3808, lo: 0xb5, hi: 0xb5}, + {value: 0x3308, lo: 0xb6, hi: 0xb7}, + {value: 0x0018, lo: 0xb8, hi: 0xbd}, + {value: 0x3308, lo: 0xbe, hi: 0xbe}, + {value: 0x0008, lo: 0xbf, hi: 0xbf}, + // Block 0xb7, offset 0x58d + {value: 0x0000, lo: 0x03}, + {value: 0x0008, lo: 0x80, hi: 0x80}, + {value: 0x3308, lo: 0x81, hi: 0x81}, + {value: 0x0040, lo: 0x82, hi: 0xbf}, + // Block 0xb8, offset 0x591 + {value: 0x0000, lo: 0x0c}, + {value: 0x0008, lo: 0x80, hi: 0x86}, + {value: 0x0040, lo: 0x87, hi: 0x87}, + {value: 0x0008, lo: 0x88, hi: 0x88}, + {value: 0x0040, lo: 0x89, hi: 0x89}, + {value: 0x0008, lo: 0x8a, hi: 0x8d}, + {value: 0x0040, lo: 0x8e, hi: 0x8e}, + {value: 0x0008, lo: 0x8f, hi: 0x9d}, + {value: 0x0040, lo: 0x9e, hi: 0x9e}, + {value: 0x0008, lo: 0x9f, hi: 0xa8}, + {value: 0x0018, lo: 0xa9, hi: 0xa9}, + {value: 0x0040, lo: 0xaa, hi: 0xaf}, + {value: 0x0008, lo: 0xb0, hi: 0xbf}, + // Block 0xb9, offset 0x59e + {value: 0x0000, lo: 0x08}, + {value: 0x0008, lo: 0x80, hi: 0x9e}, + {value: 0x3308, lo: 0x9f, hi: 0x9f}, + {value: 0x3008, lo: 0xa0, hi: 0xa2}, + {value: 0x3308, lo: 0xa3, hi: 0xa9}, + {value: 0x3b08, lo: 0xaa, hi: 0xaa}, + {value: 0x0040, lo: 0xab, hi: 0xaf}, + {value: 0x0008, lo: 0xb0, hi: 0xb9}, + {value: 0x0040, lo: 0xba, hi: 0xbf}, + // Block 0xba, offset 0x5a7 + {value: 0x0000, lo: 0x03}, + {value: 0x0008, lo: 0x80, hi: 0xb4}, + {value: 0x3008, lo: 0xb5, hi: 0xb7}, + {value: 0x3308, lo: 0xb8, hi: 0xbf}, + // Block 0xbb, offset 0x5ab + {value: 0x0000, lo: 0x0e}, + {value: 0x3008, lo: 0x80, hi: 0x81}, + {value: 0x3b08, lo: 0x82, hi: 0x82}, + {value: 0x3308, lo: 0x83, hi: 0x84}, + {value: 0x3008, lo: 0x85, hi: 0x85}, + {value: 0x3308, lo: 0x86, hi: 0x86}, + {value: 0x0008, lo: 0x87, hi: 0x8a}, + {value: 0x0018, lo: 0x8b, hi: 0x8f}, + {value: 0x0008, lo: 0x90, hi: 0x99}, + {value: 0x0018, lo: 0x9a, hi: 0x9b}, + {value: 0x0040, lo: 0x9c, hi: 0x9c}, + {value: 0x0018, lo: 0x9d, hi: 0x9d}, + {value: 0x3308, lo: 0x9e, hi: 0x9e}, + {value: 0x0008, lo: 0x9f, hi: 0xa1}, + {value: 0x0040, lo: 0xa2, hi: 0xbf}, + // Block 0xbc, offset 0x5ba + {value: 0x0000, lo: 0x07}, + {value: 0x0008, lo: 0x80, hi: 0xaf}, + {value: 0x3008, lo: 0xb0, hi: 0xb2}, + {value: 0x3308, lo: 0xb3, hi: 0xb8}, + {value: 0x3008, lo: 0xb9, hi: 0xb9}, + {value: 0x3308, lo: 0xba, hi: 0xba}, + {value: 0x3008, lo: 0xbb, hi: 0xbe}, + {value: 0x3308, lo: 0xbf, hi: 0xbf}, + // Block 0xbd, offset 0x5c2 + {value: 0x0000, lo: 0x0a}, + {value: 0x3308, lo: 0x80, hi: 0x80}, + {value: 0x3008, lo: 0x81, hi: 0x81}, + {value: 0x3b08, lo: 0x82, hi: 0x82}, + {value: 0x3308, lo: 0x83, hi: 0x83}, + {value: 0x0008, lo: 0x84, hi: 0x85}, + {value: 0x0018, lo: 0x86, hi: 0x86}, + {value: 0x0008, lo: 0x87, hi: 0x87}, + {value: 0x0040, lo: 0x88, hi: 0x8f}, + {value: 0x0008, lo: 0x90, hi: 0x99}, + {value: 0x0040, lo: 0x9a, hi: 0xbf}, + // Block 0xbe, offset 0x5cd + {value: 0x0000, lo: 0x08}, + {value: 0x0008, lo: 0x80, hi: 0xae}, + {value: 0x3008, lo: 0xaf, hi: 0xb1}, + {value: 0x3308, lo: 0xb2, hi: 0xb5}, + {value: 0x0040, lo: 0xb6, hi: 0xb7}, + {value: 0x3008, lo: 0xb8, hi: 0xbb}, + {value: 0x3308, lo: 0xbc, hi: 0xbd}, + {value: 0x3008, lo: 0xbe, hi: 0xbe}, + {value: 0x3b08, lo: 0xbf, hi: 0xbf}, + // Block 0xbf, offset 0x5d6 + {value: 0x0000, lo: 0x05}, + {value: 0x3308, lo: 0x80, hi: 0x80}, + {value: 0x0018, lo: 0x81, hi: 0x97}, + {value: 0x0008, lo: 0x98, hi: 0x9b}, + {value: 0x3308, lo: 0x9c, hi: 0x9d}, + {value: 0x0040, lo: 0x9e, hi: 0xbf}, + // Block 0xc0, offset 0x5dc + {value: 0x0000, lo: 0x07}, + {value: 0x0008, lo: 0x80, hi: 0xaf}, + {value: 0x3008, lo: 0xb0, hi: 0xb2}, + {value: 0x3308, lo: 0xb3, hi: 0xba}, + {value: 0x3008, lo: 0xbb, hi: 0xbc}, + {value: 0x3308, lo: 0xbd, hi: 0xbd}, + {value: 0x3008, lo: 0xbe, hi: 0xbe}, + {value: 0x3b08, lo: 0xbf, hi: 0xbf}, + // Block 0xc1, offset 0x5e4 + {value: 0x0000, lo: 0x08}, + {value: 0x3308, lo: 0x80, hi: 0x80}, + {value: 0x0018, lo: 0x81, hi: 0x83}, + {value: 0x0008, lo: 0x84, hi: 0x84}, + {value: 0x0040, lo: 0x85, hi: 0x8f}, + {value: 0x0008, lo: 0x90, hi: 0x99}, + {value: 0x0040, lo: 0x9a, hi: 0x9f}, + {value: 0x0018, lo: 0xa0, hi: 0xac}, + {value: 0x0040, lo: 0xad, hi: 0xbf}, + // Block 0xc2, offset 0x5ed + {value: 0x0000, lo: 0x0b}, + {value: 0x0008, lo: 0x80, hi: 0xaa}, + {value: 0x3308, lo: 0xab, hi: 0xab}, + {value: 0x3008, lo: 0xac, hi: 0xac}, + {value: 0x3308, lo: 0xad, hi: 0xad}, + {value: 0x3008, lo: 0xae, hi: 0xaf}, + {value: 0x3308, lo: 0xb0, hi: 0xb5}, + {value: 0x3808, lo: 0xb6, hi: 0xb6}, + {value: 0x3308, lo: 0xb7, hi: 0xb7}, + {value: 0x0008, lo: 0xb8, hi: 0xb8}, + {value: 0x0018, lo: 0xb9, hi: 0xb9}, + {value: 0x0040, lo: 0xba, hi: 0xbf}, + // Block 0xc3, offset 0x5f9 + {value: 0x0000, lo: 0x02}, + {value: 0x0008, lo: 0x80, hi: 0x89}, + {value: 0x0040, lo: 0x8a, hi: 0xbf}, + // Block 0xc4, offset 0x5fc + {value: 0x0000, lo: 0x0b}, + {value: 0x0008, lo: 0x80, hi: 0x9a}, + {value: 0x0040, lo: 0x9b, hi: 0x9c}, + {value: 0x3308, lo: 0x9d, hi: 0x9f}, + {value: 0x3008, lo: 0xa0, hi: 0xa1}, + {value: 0x3308, lo: 0xa2, hi: 0xa5}, + {value: 0x3008, lo: 0xa6, hi: 0xa6}, + {value: 0x3308, lo: 0xa7, hi: 0xaa}, + {value: 0x3b08, lo: 0xab, hi: 0xab}, + {value: 0x0040, lo: 0xac, hi: 0xaf}, + {value: 0x0008, lo: 0xb0, hi: 0xb9}, + {value: 0x0018, lo: 0xba, hi: 0xbf}, + // Block 0xc5, offset 0x608 + {value: 0x0000, lo: 0x02}, + {value: 0x0008, lo: 0x80, hi: 0x86}, + {value: 0x0040, lo: 0x87, hi: 0xbf}, + // Block 0xc6, offset 0x60b + {value: 0x0000, lo: 0x08}, + {value: 0x0008, lo: 0x80, hi: 0xab}, + {value: 0x3008, lo: 0xac, hi: 0xae}, + {value: 0x3308, lo: 0xaf, hi: 0xb7}, + {value: 0x3008, lo: 0xb8, hi: 0xb8}, + {value: 0x3b08, lo: 0xb9, hi: 0xb9}, + {value: 0x3308, lo: 0xba, hi: 0xba}, + {value: 0x0018, lo: 0xbb, hi: 0xbb}, + {value: 0x0040, lo: 0xbc, hi: 0xbf}, + // Block 0xc7, offset 0x614 + {value: 0x0000, lo: 0x02}, + {value: 0x0040, lo: 0x80, hi: 0x9f}, + {value: 0x049d, lo: 0xa0, hi: 0xbf}, + // Block 0xc8, offset 0x617 + {value: 0x0000, lo: 0x04}, + {value: 0x0008, lo: 0x80, hi: 0xa9}, + {value: 0x0018, lo: 0xaa, hi: 0xb2}, + {value: 0x0040, lo: 0xb3, hi: 0xbe}, + {value: 0x0008, lo: 0xbf, hi: 0xbf}, + // Block 0xc9, offset 0x61c + {value: 0x0000, lo: 0x08}, + {value: 0x3008, lo: 0x80, hi: 0x80}, + {value: 0x0008, lo: 0x81, hi: 0x81}, + {value: 0x3008, lo: 0x82, hi: 0x82}, + {value: 0x3308, lo: 0x83, hi: 0x83}, + {value: 0x0018, lo: 0x84, hi: 0x86}, + {value: 0x0040, lo: 0x87, hi: 0x8f}, + {value: 0x0008, lo: 0x90, hi: 0x99}, + {value: 0x0040, lo: 0x9a, hi: 0xbf}, + // Block 0xca, offset 0x625 + {value: 0x0000, lo: 0x04}, + {value: 0x0040, lo: 0x80, hi: 0x9f}, + {value: 0x0008, lo: 0xa0, hi: 0xa7}, + {value: 0x0040, lo: 0xa8, hi: 0xa9}, + {value: 0x0008, lo: 0xaa, hi: 0xbf}, + // Block 0xcb, offset 0x62a + {value: 0x0000, lo: 0x0c}, + {value: 0x0008, lo: 0x80, hi: 0x90}, + {value: 0x3008, lo: 0x91, hi: 0x93}, + {value: 0x3308, lo: 0x94, hi: 0x97}, + {value: 0x0040, lo: 0x98, hi: 0x99}, + {value: 0x3308, lo: 0x9a, hi: 0x9b}, + {value: 0x3008, lo: 0x9c, hi: 0x9f}, + {value: 0x3b08, lo: 0xa0, hi: 0xa0}, + {value: 0x0008, lo: 0xa1, hi: 0xa1}, + {value: 0x0018, lo: 0xa2, hi: 0xa2}, + {value: 0x0008, lo: 0xa3, hi: 0xa3}, + {value: 0x3008, lo: 0xa4, hi: 0xa4}, + {value: 0x0040, lo: 0xa5, hi: 0xbf}, + // Block 0xcc, offset 0x637 + {value: 0x0000, lo: 0x0a}, + {value: 0x0008, lo: 0x80, hi: 0x80}, + {value: 0x3308, lo: 0x81, hi: 0x8a}, + {value: 0x0008, lo: 0x8b, hi: 0xb2}, + {value: 0x3308, lo: 0xb3, hi: 0xb3}, + {value: 0x3b08, lo: 0xb4, hi: 0xb4}, + {value: 0x3308, lo: 0xb5, hi: 0xb8}, + {value: 0x3008, lo: 0xb9, hi: 0xb9}, + {value: 0x0008, lo: 0xba, hi: 0xba}, + {value: 0x3308, lo: 0xbb, hi: 0xbe}, + {value: 0x0018, lo: 0xbf, hi: 0xbf}, + // Block 0xcd, offset 0x642 + {value: 0x0000, lo: 0x08}, + {value: 0x0018, lo: 0x80, hi: 0x86}, + {value: 0x3b08, lo: 0x87, hi: 0x87}, + {value: 0x0040, lo: 0x88, hi: 0x8f}, + {value: 0x0008, lo: 0x90, hi: 0x90}, + {value: 0x3308, lo: 0x91, hi: 0x96}, + {value: 0x3008, lo: 0x97, hi: 0x98}, + {value: 0x3308, lo: 0x99, hi: 0x9b}, + {value: 0x0008, lo: 0x9c, hi: 0xbf}, + // Block 0xce, offset 0x64b + {value: 0x0000, lo: 0x0a}, + {value: 0x0008, lo: 0x80, hi: 0x89}, + {value: 0x3308, lo: 0x8a, hi: 0x96}, + {value: 0x3008, lo: 0x97, hi: 0x97}, + {value: 0x3308, lo: 0x98, hi: 0x98}, + {value: 0x3b08, lo: 0x99, hi: 0x99}, + {value: 0x0018, lo: 0x9a, hi: 0x9c}, + {value: 0x0008, lo: 0x9d, hi: 0x9d}, + {value: 0x0018, lo: 0x9e, hi: 0xa2}, + {value: 0x0040, lo: 0xa3, hi: 0xaf}, + {value: 0x0008, lo: 0xb0, hi: 0xbf}, + // Block 0xcf, offset 0x656 + {value: 0x0000, lo: 0x02}, + {value: 0x0008, lo: 0x80, hi: 0xb8}, + {value: 0x0040, lo: 0xb9, hi: 0xbf}, + // Block 0xd0, offset 0x659 + {value: 0x0000, lo: 0x02}, + {value: 0x0018, lo: 0x80, hi: 0x89}, + {value: 0x0040, lo: 0x8a, hi: 0xbf}, + // Block 0xd1, offset 0x65c + {value: 0x0000, lo: 0x09}, + {value: 0x0008, lo: 0x80, hi: 0x88}, + {value: 0x0040, lo: 0x89, hi: 0x89}, + {value: 0x0008, lo: 0x8a, hi: 0xae}, + {value: 0x3008, lo: 0xaf, hi: 0xaf}, + {value: 0x3308, lo: 0xb0, hi: 0xb6}, + {value: 0x0040, lo: 0xb7, hi: 0xb7}, + {value: 0x3308, lo: 0xb8, hi: 0xbd}, + {value: 0x3008, lo: 0xbe, hi: 0xbe}, + {value: 0x3b08, lo: 0xbf, hi: 0xbf}, + // Block 0xd2, offset 0x666 + {value: 0x0000, lo: 0x08}, + {value: 0x0008, lo: 0x80, hi: 0x80}, + {value: 0x0018, lo: 0x81, hi: 0x85}, + {value: 0x0040, lo: 0x86, hi: 0x8f}, + {value: 0x0008, lo: 0x90, hi: 0x99}, + {value: 0x0018, lo: 0x9a, hi: 0xac}, + {value: 0x0040, lo: 0xad, hi: 0xaf}, + {value: 0x0018, lo: 0xb0, hi: 0xb1}, + {value: 0x0008, lo: 0xb2, hi: 0xbf}, + // Block 0xd3, offset 0x66f + {value: 0x0000, lo: 0x0b}, + {value: 0x0008, lo: 0x80, hi: 0x8f}, + {value: 0x0040, lo: 0x90, hi: 0x91}, + {value: 0x3308, lo: 0x92, hi: 0xa7}, + {value: 0x0040, lo: 0xa8, hi: 0xa8}, + {value: 0x3008, lo: 0xa9, hi: 0xa9}, + {value: 0x3308, lo: 0xaa, hi: 0xb0}, + {value: 0x3008, lo: 0xb1, hi: 0xb1}, + {value: 0x3308, lo: 0xb2, hi: 0xb3}, + {value: 0x3008, lo: 0xb4, hi: 0xb4}, + {value: 0x3308, lo: 0xb5, hi: 0xb6}, + {value: 0x0040, lo: 0xb7, hi: 0xbf}, + // Block 0xd4, offset 0x67b + {value: 0x0000, lo: 0x0c}, + {value: 0x0008, lo: 0x80, hi: 0x86}, + {value: 0x0040, lo: 0x87, hi: 0x87}, + {value: 0x0008, lo: 0x88, hi: 0x89}, + {value: 0x0040, lo: 0x8a, hi: 0x8a}, + {value: 0x0008, lo: 0x8b, hi: 0xb0}, + {value: 0x3308, lo: 0xb1, hi: 0xb6}, + {value: 0x0040, lo: 0xb7, hi: 0xb9}, + {value: 0x3308, lo: 0xba, hi: 0xba}, + {value: 0x0040, lo: 0xbb, hi: 0xbb}, + {value: 0x3308, lo: 0xbc, hi: 0xbd}, + {value: 0x0040, lo: 0xbe, hi: 0xbe}, + {value: 0x3308, lo: 0xbf, hi: 0xbf}, + // Block 0xd5, offset 0x688 + {value: 0x0000, lo: 0x0c}, + {value: 0x3308, lo: 0x80, hi: 0x83}, + {value: 0x3b08, lo: 0x84, hi: 0x85}, + {value: 0x0008, lo: 0x86, hi: 0x86}, + {value: 0x3308, lo: 0x87, hi: 0x87}, + {value: 0x0040, lo: 0x88, hi: 0x8f}, + {value: 0x0008, lo: 0x90, hi: 0x99}, + {value: 0x0040, lo: 0x9a, hi: 0x9f}, + {value: 0x0008, lo: 0xa0, hi: 0xa5}, + {value: 0x0040, lo: 0xa6, hi: 0xa6}, + {value: 0x0008, lo: 0xa7, hi: 0xa8}, + {value: 0x0040, lo: 0xa9, hi: 0xa9}, + {value: 0x0008, lo: 0xaa, hi: 0xbf}, + // Block 0xd6, offset 0x695 + {value: 0x0000, lo: 0x0d}, + {value: 0x0008, lo: 0x80, hi: 0x89}, + {value: 0x3008, lo: 0x8a, hi: 0x8e}, + {value: 0x0040, lo: 0x8f, hi: 0x8f}, + {value: 0x3308, lo: 0x90, hi: 0x91}, + {value: 0x0040, lo: 0x92, hi: 0x92}, + {value: 0x3008, lo: 0x93, hi: 0x94}, + {value: 0x3308, lo: 0x95, hi: 0x95}, + {value: 0x3008, lo: 0x96, hi: 0x96}, + {value: 0x3b08, lo: 0x97, hi: 0x97}, + {value: 0x0008, lo: 0x98, hi: 0x98}, + {value: 0x0040, lo: 0x99, hi: 0x9f}, + {value: 0x0008, lo: 0xa0, hi: 0xa9}, + {value: 0x0040, lo: 0xaa, hi: 0xbf}, + // Block 0xd7, offset 0x6a3 + {value: 0x0000, lo: 0x06}, + {value: 0x0040, lo: 0x80, hi: 0x9f}, + {value: 0x0008, lo: 0xa0, hi: 0xb2}, + {value: 0x3308, lo: 0xb3, hi: 0xb4}, + {value: 0x3008, lo: 0xb5, hi: 0xb6}, + {value: 0x0018, lo: 0xb7, hi: 0xb8}, + {value: 0x0040, lo: 0xb9, hi: 0xbf}, + // Block 0xd8, offset 0x6aa + {value: 0x0000, lo: 0x0a}, + {value: 0x3308, lo: 0x80, hi: 0x81}, + {value: 0x0008, lo: 0x82, hi: 0x82}, + {value: 0x3008, lo: 0x83, hi: 0x83}, + {value: 0x0008, lo: 0x84, hi: 0x90}, + {value: 0x0040, lo: 0x91, hi: 0x91}, + {value: 0x0008, lo: 0x92, hi: 0xb3}, + {value: 0x3008, lo: 0xb4, hi: 0xb5}, + {value: 0x3308, lo: 0xb6, hi: 0xba}, + {value: 0x0040, lo: 0xbb, hi: 0xbd}, + {value: 0x3008, lo: 0xbe, hi: 0xbf}, + // Block 0xd9, offset 0x6b5 + {value: 0x0000, lo: 0x06}, + {value: 0x3308, lo: 0x80, hi: 0x80}, + {value: 0x3808, lo: 0x81, hi: 0x81}, + {value: 0x3b08, lo: 0x82, hi: 0x82}, + {value: 0x0018, lo: 0x83, hi: 0x8f}, + {value: 0x0008, lo: 0x90, hi: 0x99}, + {value: 0x0040, lo: 0x9a, hi: 0xbf}, + // Block 0xda, offset 0x6bc + {value: 0x0000, lo: 0x03}, + {value: 0x0040, lo: 0x80, hi: 0xaf}, + {value: 0x0008, lo: 0xb0, hi: 0xb0}, + {value: 0x0040, lo: 0xb1, hi: 0xbf}, + // Block 0xdb, offset 0x6c0 + {value: 0x0000, lo: 0x03}, + {value: 0x0018, lo: 0x80, hi: 0xb1}, + {value: 0x0040, lo: 0xb2, hi: 0xbe}, + {value: 0x0018, lo: 0xbf, hi: 0xbf}, + // Block 0xdc, offset 0x6c4 + {value: 0x0000, lo: 0x02}, + {value: 0x0008, lo: 0x80, hi: 0x99}, + {value: 0x0040, lo: 0x9a, hi: 0xbf}, + // Block 0xdd, offset 0x6c7 + {value: 0x0000, lo: 0x04}, + {value: 0x0018, lo: 0x80, hi: 0xae}, + {value: 0x0040, lo: 0xaf, hi: 0xaf}, + {value: 0x0018, lo: 0xb0, hi: 0xb4}, + {value: 0x0040, lo: 0xb5, hi: 0xbf}, + // Block 0xde, offset 0x6cc + {value: 0x0000, lo: 0x02}, + {value: 0x0008, lo: 0x80, hi: 0x83}, + {value: 0x0040, lo: 0x84, hi: 0xbf}, + // Block 0xdf, offset 0x6cf + {value: 0x0000, lo: 0x02}, + {value: 0x0040, lo: 0x80, hi: 0x8f}, + {value: 0x0008, lo: 0x90, hi: 0xbf}, + // Block 0xe0, offset 0x6d2 + {value: 0x0000, lo: 0x03}, + {value: 0x0008, lo: 0x80, hi: 0xb0}, + {value: 0x0018, lo: 0xb1, hi: 0xb2}, + {value: 0x0040, lo: 0xb3, hi: 0xbf}, + // Block 0xe1, offset 0x6d6 + {value: 0x0000, lo: 0x02}, + {value: 0x0008, lo: 0x80, hi: 0xaf}, + {value: 0x0340, lo: 0xb0, hi: 0xbf}, + // Block 0xe2, offset 0x6d9 + {value: 0x0000, lo: 0x04}, + {value: 0x3308, lo: 0x80, hi: 0x80}, + {value: 0x0008, lo: 0x81, hi: 0x86}, + {value: 0x3308, lo: 0x87, hi: 0x95}, + {value: 0x0040, lo: 0x96, hi: 0xbf}, + // Block 0xe3, offset 0x6de + {value: 0x0000, lo: 0x06}, + {value: 0x0008, lo: 0x80, hi: 0x9e}, + {value: 0x0040, lo: 0x9f, hi: 0x9f}, + {value: 0x0008, lo: 0xa0, hi: 0xa9}, + {value: 0x0040, lo: 0xaa, hi: 0xad}, + {value: 0x0018, lo: 0xae, hi: 0xaf}, + {value: 0x0008, lo: 0xb0, hi: 0xbf}, + // Block 0xe4, offset 0x6e5 + {value: 0x0000, lo: 0x02}, + {value: 0x0008, lo: 0x80, hi: 0xbe}, + {value: 0x0040, lo: 0xbf, hi: 0xbf}, + // Block 0xe5, offset 0x6e8 + {value: 0x0000, lo: 0x07}, + {value: 0x0008, lo: 0x80, hi: 0x89}, + {value: 0x0040, lo: 0x8a, hi: 0x8f}, + {value: 0x0008, lo: 0x90, hi: 0xad}, + {value: 0x0040, lo: 0xae, hi: 0xaf}, + {value: 0x3308, lo: 0xb0, hi: 0xb4}, + {value: 0x0018, lo: 0xb5, hi: 0xb5}, + {value: 0x0040, lo: 0xb6, hi: 0xbf}, + // Block 0xe6, offset 0x6f0 + {value: 0x0000, lo: 0x03}, + {value: 0x0008, lo: 0x80, hi: 0xaf}, + {value: 0x3308, lo: 0xb0, hi: 0xb6}, + {value: 0x0018, lo: 0xb7, hi: 0xbf}, + // Block 0xe7, offset 0x6f4 + {value: 0x0000, lo: 0x0a}, + {value: 0x0008, lo: 0x80, hi: 0x83}, + {value: 0x0018, lo: 0x84, hi: 0x85}, + {value: 0x0040, lo: 0x86, hi: 0x8f}, + {value: 0x0008, lo: 0x90, hi: 0x99}, + {value: 0x0040, lo: 0x9a, hi: 0x9a}, + {value: 0x0018, lo: 0x9b, hi: 0xa1}, + {value: 0x0040, lo: 0xa2, hi: 0xa2}, + {value: 0x0008, lo: 0xa3, hi: 0xb7}, + {value: 0x0040, lo: 0xb8, hi: 0xbc}, + {value: 0x0008, lo: 0xbd, hi: 0xbf}, + // Block 0xe8, offset 0x6ff + {value: 0x0000, lo: 0x02}, + {value: 0x0008, lo: 0x80, hi: 0x8f}, + {value: 0x0040, lo: 0x90, hi: 0xbf}, + // Block 0xe9, offset 0x702 + {value: 0x0000, lo: 0x02}, + {value: 0xe105, lo: 0x80, hi: 0x9f}, + {value: 0x0008, lo: 0xa0, hi: 0xbf}, + // Block 0xea, offset 0x705 + {value: 0x0000, lo: 0x02}, + {value: 0x0018, lo: 0x80, hi: 0x9a}, + {value: 0x0040, lo: 0x9b, hi: 0xbf}, + // Block 0xeb, offset 0x708 + {value: 0x0000, lo: 0x05}, + {value: 0x0008, lo: 0x80, hi: 0x8a}, + {value: 0x0040, lo: 0x8b, hi: 0x8e}, + {value: 0x3308, lo: 0x8f, hi: 0x8f}, + {value: 0x0008, lo: 0x90, hi: 0x90}, + {value: 0x3008, lo: 0x91, hi: 0xbf}, + // Block 0xec, offset 0x70e + {value: 0x0000, lo: 0x05}, + {value: 0x3008, lo: 0x80, hi: 0x87}, + {value: 0x0040, lo: 0x88, hi: 0x8e}, + {value: 0x3308, lo: 0x8f, hi: 0x92}, + {value: 0x0008, lo: 0x93, hi: 0x9f}, + {value: 0x0040, lo: 0xa0, hi: 0xbf}, + // Block 0xed, offset 0x714 + {value: 0x0000, lo: 0x08}, + {value: 0x0040, lo: 0x80, hi: 0x9f}, + {value: 0x0008, lo: 0xa0, hi: 0xa1}, + {value: 0x0018, lo: 0xa2, hi: 0xa2}, + {value: 0x0008, lo: 0xa3, hi: 0xa3}, + {value: 0x3308, lo: 0xa4, hi: 0xa4}, + {value: 0x0040, lo: 0xa5, hi: 0xaf}, + {value: 0x3008, lo: 0xb0, hi: 0xb1}, + {value: 0x0040, lo: 0xb2, hi: 0xbf}, + // Block 0xee, offset 0x71d + {value: 0x0000, lo: 0x02}, + {value: 0x0008, lo: 0x80, hi: 0xb7}, + {value: 0x0040, lo: 0xb8, hi: 0xbf}, + // Block 0xef, offset 0x720 + {value: 0x0000, lo: 0x02}, + {value: 0x0008, lo: 0x80, hi: 0x95}, + {value: 0x0040, lo: 0x96, hi: 0xbf}, + // Block 0xf0, offset 0x723 + {value: 0x0000, lo: 0x02}, + {value: 0x0008, lo: 0x80, hi: 0x88}, + {value: 0x0040, lo: 0x89, hi: 0xbf}, + // Block 0xf1, offset 0x726 + {value: 0x0000, lo: 0x07}, + {value: 0x0040, lo: 0x80, hi: 0xaf}, + {value: 0x0008, lo: 0xb0, hi: 0xb3}, + {value: 0x0040, lo: 0xb4, hi: 0xb4}, + {value: 0x0008, lo: 0xb5, hi: 0xbb}, + {value: 0x0040, lo: 0xbc, hi: 0xbc}, + {value: 0x0008, lo: 0xbd, hi: 0xbe}, + {value: 0x0040, lo: 0xbf, hi: 0xbf}, + // Block 0xf2, offset 0x72e + {value: 0x0000, lo: 0x04}, + {value: 0x0008, lo: 0x80, hi: 0xa2}, + {value: 0x0040, lo: 0xa3, hi: 0xb1}, + {value: 0x0008, lo: 0xb2, hi: 0xb2}, + {value: 0x0040, lo: 0xb3, hi: 0xbf}, + // Block 0xf3, offset 0x733 + {value: 0x0000, lo: 0x08}, + {value: 0x0040, lo: 0x80, hi: 0x8f}, + {value: 0x0008, lo: 0x90, hi: 0x92}, + {value: 0x0040, lo: 0x93, hi: 0x94}, + {value: 0x0008, lo: 0x95, hi: 0x95}, + {value: 0x0040, lo: 0x96, hi: 0xa3}, + {value: 0x0008, lo: 0xa4, hi: 0xa7}, + {value: 0x0040, lo: 0xa8, hi: 0xaf}, + {value: 0x0008, lo: 0xb0, hi: 0xbf}, + // Block 0xf4, offset 0x73c + {value: 0x0000, lo: 0x02}, + {value: 0x0008, lo: 0x80, hi: 0xbb}, + {value: 0x0040, lo: 0xbc, hi: 0xbf}, + // Block 0xf5, offset 0x73f + {value: 0x0000, lo: 0x04}, + {value: 0x0008, lo: 0x80, hi: 0xaa}, + {value: 0x0040, lo: 0xab, hi: 0xaf}, + {value: 0x0008, lo: 0xb0, hi: 0xbc}, + {value: 0x0040, lo: 0xbd, hi: 0xbf}, + // Block 0xf6, offset 0x744 + {value: 0x0000, lo: 0x09}, + {value: 0x0008, lo: 0x80, hi: 0x88}, + {value: 0x0040, lo: 0x89, hi: 0x8f}, + {value: 0x0008, lo: 0x90, hi: 0x99}, + {value: 0x0040, lo: 0x9a, hi: 0x9b}, + {value: 0x0018, lo: 0x9c, hi: 0x9c}, + {value: 0x3308, lo: 0x9d, hi: 0x9e}, + {value: 0x0018, lo: 0x9f, hi: 0x9f}, + {value: 0x03c0, lo: 0xa0, hi: 0xa3}, + {value: 0x0040, lo: 0xa4, hi: 0xbf}, + // Block 0xf7, offset 0x74e + {value: 0x0000, lo: 0x03}, + {value: 0x3308, lo: 0x80, hi: 0xad}, + {value: 0x0040, lo: 0xae, hi: 0xaf}, + {value: 0x3308, lo: 0xb0, hi: 0xbf}, + // Block 0xf8, offset 0x752 + {value: 0x0000, lo: 0x03}, + {value: 0x3308, lo: 0x80, hi: 0x86}, + {value: 0x0040, lo: 0x87, hi: 0x8f}, + {value: 0x0018, lo: 0x90, hi: 0xbf}, + // Block 0xf9, offset 0x756 + {value: 0x0000, lo: 0x02}, + {value: 0x0018, lo: 0x80, hi: 0x83}, + {value: 0x0040, lo: 0x84, hi: 0xbf}, + // Block 0xfa, offset 0x759 + {value: 0x0000, lo: 0x02}, + {value: 0x0018, lo: 0x80, hi: 0xb5}, + {value: 0x0040, lo: 0xb6, hi: 0xbf}, + // Block 0xfb, offset 0x75c + {value: 0x0000, lo: 0x03}, + {value: 0x0018, lo: 0x80, hi: 0xa6}, + {value: 0x0040, lo: 0xa7, hi: 0xa8}, + {value: 0x0018, lo: 0xa9, hi: 0xbf}, + // Block 0xfc, offset 0x760 + {value: 0x0000, lo: 0x0e}, + {value: 0x0018, lo: 0x80, hi: 0x9d}, + {value: 0x2379, lo: 0x9e, hi: 0x9e}, + {value: 0x2381, lo: 0x9f, hi: 0x9f}, + {value: 0x2389, lo: 0xa0, hi: 0xa0}, + {value: 0x2391, lo: 0xa1, hi: 0xa1}, + {value: 0x2399, lo: 0xa2, hi: 0xa2}, + {value: 0x23a1, lo: 0xa3, hi: 0xa3}, + {value: 0x23a9, lo: 0xa4, hi: 0xa4}, + {value: 0x3018, lo: 0xa5, hi: 0xa6}, + {value: 0x3318, lo: 0xa7, hi: 0xa9}, + {value: 0x0018, lo: 0xaa, hi: 0xac}, + {value: 0x3018, lo: 0xad, hi: 0xb2}, + {value: 0x0340, lo: 0xb3, hi: 0xba}, + {value: 0x3318, lo: 0xbb, hi: 0xbf}, + // Block 0xfd, offset 0x76f + {value: 0x0000, lo: 0x0b}, + {value: 0x3318, lo: 0x80, hi: 0x82}, + {value: 0x0018, lo: 0x83, hi: 0x84}, + {value: 0x3318, lo: 0x85, hi: 0x8b}, + {value: 0x0018, lo: 0x8c, hi: 0xa9}, + {value: 0x3318, lo: 0xaa, hi: 0xad}, + {value: 0x0018, lo: 0xae, hi: 0xba}, + {value: 0x23b1, lo: 0xbb, hi: 0xbb}, + {value: 0x23b9, lo: 0xbc, hi: 0xbc}, + {value: 0x23c1, lo: 0xbd, hi: 0xbd}, + {value: 0x23c9, lo: 0xbe, hi: 0xbe}, + {value: 0x23d1, lo: 0xbf, hi: 0xbf}, + // Block 0xfe, offset 0x77b + {value: 0x0000, lo: 0x03}, + {value: 0x23d9, lo: 0x80, hi: 0x80}, + {value: 0x0018, lo: 0x81, hi: 0xaa}, + {value: 0x0040, lo: 0xab, hi: 0xbf}, + // Block 0xff, offset 0x77f + {value: 0x0000, lo: 0x04}, + {value: 0x0018, lo: 0x80, hi: 0x81}, + {value: 0x3318, lo: 0x82, hi: 0x84}, + {value: 0x0018, lo: 0x85, hi: 0x85}, + {value: 0x0040, lo: 0x86, hi: 0xbf}, + // Block 0x100, offset 0x784 + {value: 0x0000, lo: 0x04}, + {value: 0x0018, lo: 0x80, hi: 0x93}, + {value: 0x0040, lo: 0x94, hi: 0x9f}, + {value: 0x0018, lo: 0xa0, hi: 0xb3}, + {value: 0x0040, lo: 0xb4, hi: 0xbf}, + // Block 0x101, offset 0x789 + {value: 0x0000, lo: 0x04}, + {value: 0x0018, lo: 0x80, hi: 0x96}, + {value: 0x0040, lo: 0x97, hi: 0x9f}, + {value: 0x0018, lo: 0xa0, hi: 0xb8}, + {value: 0x0040, lo: 0xb9, hi: 0xbf}, + // Block 0x102, offset 0x78e + {value: 0x0000, lo: 0x03}, + {value: 0x3308, lo: 0x80, hi: 0xb6}, + {value: 0x0018, lo: 0xb7, hi: 0xba}, + {value: 0x3308, lo: 0xbb, hi: 0xbf}, + // Block 0x103, offset 0x792 + {value: 0x0000, lo: 0x04}, + {value: 0x3308, lo: 0x80, hi: 0xac}, + {value: 0x0018, lo: 0xad, hi: 0xb4}, + {value: 0x3308, lo: 0xb5, hi: 0xb5}, + {value: 0x0018, lo: 0xb6, hi: 0xbf}, + // Block 0x104, offset 0x797 + {value: 0x0000, lo: 0x08}, + {value: 0x0018, lo: 0x80, hi: 0x83}, + {value: 0x3308, lo: 0x84, hi: 0x84}, + {value: 0x0018, lo: 0x85, hi: 0x8b}, + {value: 0x0040, lo: 0x8c, hi: 0x9a}, + {value: 0x3308, lo: 0x9b, hi: 0x9f}, + {value: 0x0040, lo: 0xa0, hi: 0xa0}, + {value: 0x3308, lo: 0xa1, hi: 0xaf}, + {value: 0x0040, lo: 0xb0, hi: 0xbf}, + // Block 0x105, offset 0x7a0 + {value: 0x0000, lo: 0x04}, + {value: 0x0008, lo: 0x80, hi: 0x9e}, + {value: 0x0040, lo: 0x9f, hi: 0xa4}, + {value: 0x0008, lo: 0xa5, hi: 0xaa}, + {value: 0x0040, lo: 0xab, hi: 0xbf}, + // Block 0x106, offset 0x7a5 + {value: 0x0000, lo: 0x03}, + {value: 0x0040, lo: 0x80, hi: 0x8e}, + {value: 0x3308, lo: 0x8f, hi: 0x8f}, + {value: 0x0040, lo: 0x90, hi: 0xbf}, + // Block 0x107, offset 0x7a9 + {value: 0x0000, lo: 0x05}, + {value: 0x0008, lo: 0x80, hi: 0xac}, + {value: 0x0040, lo: 0xad, hi: 0xaf}, + {value: 0x3308, lo: 0xb0, hi: 0xb6}, + {value: 0x0008, lo: 0xb7, hi: 0xbd}, + {value: 0x0040, lo: 0xbe, hi: 0xbf}, + // Block 0x108, offset 0x7af + {value: 0x0000, lo: 0x05}, + {value: 0x0008, lo: 0x80, hi: 0x89}, + {value: 0x0040, lo: 0x8a, hi: 0x8d}, + {value: 0x0008, lo: 0x8e, hi: 0x8e}, + {value: 0x0018, lo: 0x8f, hi: 0x8f}, + {value: 0x0040, lo: 0x90, hi: 0xbf}, + // Block 0x109, offset 0x7b5 + {value: 0x0000, lo: 0x04}, + {value: 0x0040, lo: 0x80, hi: 0x8f}, + {value: 0x0008, lo: 0x90, hi: 0xad}, + {value: 0x3308, lo: 0xae, hi: 0xae}, + {value: 0x0040, lo: 0xaf, hi: 0xbf}, + // Block 0x10a, offset 0x7ba + {value: 0x0000, lo: 0x05}, + {value: 0x0008, lo: 0x80, hi: 0xab}, + {value: 0x3308, lo: 0xac, hi: 0xaf}, + {value: 0x0008, lo: 0xb0, hi: 0xb9}, + {value: 0x0040, lo: 0xba, hi: 0xbe}, + {value: 0x0018, lo: 0xbf, hi: 0xbf}, + // Block 0x10b, offset 0x7c0 + {value: 0x0000, lo: 0x05}, + {value: 0x0040, lo: 0x80, hi: 0x8f}, + {value: 0x0008, lo: 0x90, hi: 0xab}, + {value: 0x3308, lo: 0xac, hi: 0xaf}, + {value: 0x0008, lo: 0xb0, hi: 0xb9}, + {value: 0x0040, lo: 0xba, hi: 0xbf}, + // Block 0x10c, offset 0x7c6 + {value: 0x0000, lo: 0x09}, + {value: 0x0040, lo: 0x80, hi: 0x9f}, + {value: 0x0008, lo: 0xa0, hi: 0xa6}, + {value: 0x0040, lo: 0xa7, hi: 0xa7}, + {value: 0x0008, lo: 0xa8, hi: 0xab}, + {value: 0x0040, lo: 0xac, hi: 0xac}, + {value: 0x0008, lo: 0xad, hi: 0xae}, + {value: 0x0040, lo: 0xaf, hi: 0xaf}, + {value: 0x0008, lo: 0xb0, hi: 0xbe}, + {value: 0x0040, lo: 0xbf, hi: 0xbf}, + // Block 0x10d, offset 0x7d0 + {value: 0x0000, lo: 0x05}, + {value: 0x0808, lo: 0x80, hi: 0x84}, + {value: 0x0040, lo: 0x85, hi: 0x86}, + {value: 0x0818, lo: 0x87, hi: 0x8f}, + {value: 0x3308, lo: 0x90, hi: 0x96}, + {value: 0x0040, lo: 0x97, hi: 0xbf}, + // Block 0x10e, offset 0x7d6 + {value: 0x0000, lo: 0x08}, + {value: 0x0a08, lo: 0x80, hi: 0x83}, + {value: 0x3308, lo: 0x84, hi: 0x8a}, + {value: 0x0b08, lo: 0x8b, hi: 0x8b}, + {value: 0x0040, lo: 0x8c, hi: 0x8f}, + {value: 0x0808, lo: 0x90, hi: 0x99}, + {value: 0x0040, lo: 0x9a, hi: 0x9d}, + {value: 0x0818, lo: 0x9e, hi: 0x9f}, + {value: 0x0040, lo: 0xa0, hi: 0xbf}, + // Block 0x10f, offset 0x7df + {value: 0x0000, lo: 0x02}, + {value: 0x0040, lo: 0x80, hi: 0xb0}, + {value: 0x0818, lo: 0xb1, hi: 0xbf}, + // Block 0x110, offset 0x7e2 + {value: 0x0000, lo: 0x02}, + {value: 0x0818, lo: 0x80, hi: 0xb4}, + {value: 0x0040, lo: 0xb5, hi: 0xbf}, + // Block 0x111, offset 0x7e5 + {value: 0x0000, lo: 0x03}, + {value: 0x0040, lo: 0x80, hi: 0x80}, + {value: 0x0818, lo: 0x81, hi: 0xbd}, + {value: 0x0040, lo: 0xbe, hi: 0xbf}, + // Block 0x112, offset 0x7e9 + {value: 0x0000, lo: 0x03}, + {value: 0x0040, lo: 0x80, hi: 0xaf}, + {value: 0x0018, lo: 0xb0, hi: 0xb1}, + {value: 0x0040, lo: 0xb2, hi: 0xbf}, + // Block 0x113, offset 0x7ed + {value: 0x0000, lo: 0x03}, + {value: 0x0018, lo: 0x80, hi: 0xab}, + {value: 0x0040, lo: 0xac, hi: 0xaf}, + {value: 0x0018, lo: 0xb0, hi: 0xbf}, + // Block 0x114, offset 0x7f1 + {value: 0x0000, lo: 0x05}, + {value: 0x0018, lo: 0x80, hi: 0x93}, + {value: 0x0040, lo: 0x94, hi: 0x9f}, + {value: 0x0018, lo: 0xa0, hi: 0xae}, + {value: 0x0040, lo: 0xaf, hi: 0xb0}, + {value: 0x0018, lo: 0xb1, hi: 0xbf}, + // Block 0x115, offset 0x7f7 + {value: 0x0000, lo: 0x05}, + {value: 0x0040, lo: 0x80, hi: 0x80}, + {value: 0x0018, lo: 0x81, hi: 0x8f}, + {value: 0x0040, lo: 0x90, hi: 0x90}, + {value: 0x0018, lo: 0x91, hi: 0xb5}, + {value: 0x0040, lo: 0xb6, hi: 0xbf}, + // Block 0x116, offset 0x7fd + {value: 0x0000, lo: 0x04}, + {value: 0x0018, lo: 0x80, hi: 0x8f}, + {value: 0x2709, lo: 0x90, hi: 0x90}, + {value: 0x0018, lo: 0x91, hi: 0xad}, + {value: 0x0040, lo: 0xae, hi: 0xbf}, + // Block 0x117, offset 0x802 + {value: 0x0000, lo: 0x02}, + {value: 0x0040, lo: 0x80, hi: 0xa5}, + {value: 0x0018, lo: 0xa6, hi: 0xbf}, + // Block 0x118, offset 0x805 + {value: 0x0000, lo: 0x0f}, + {value: 0x2889, lo: 0x80, hi: 0x80}, + {value: 0x2891, lo: 0x81, hi: 0x81}, + {value: 0x2899, lo: 0x82, hi: 0x82}, + {value: 0x28a1, lo: 0x83, hi: 0x83}, + {value: 0x28a9, lo: 0x84, hi: 0x84}, + {value: 0x28b1, lo: 0x85, hi: 0x85}, + {value: 0x28b9, lo: 0x86, hi: 0x86}, + {value: 0x28c1, lo: 0x87, hi: 0x87}, + {value: 0x28c9, lo: 0x88, hi: 0x88}, + {value: 0x0040, lo: 0x89, hi: 0x8f}, + {value: 0x28d1, lo: 0x90, hi: 0x90}, + {value: 0x28d9, lo: 0x91, hi: 0x91}, + {value: 0x0040, lo: 0x92, hi: 0x9f}, + {value: 0x0018, lo: 0xa0, hi: 0xa5}, + {value: 0x0040, lo: 0xa6, hi: 0xbf}, + // Block 0x119, offset 0x815 + {value: 0x0000, lo: 0x06}, + {value: 0x0018, lo: 0x80, hi: 0x97}, + {value: 0x0040, lo: 0x98, hi: 0x9b}, + {value: 0x0018, lo: 0x9c, hi: 0xac}, + {value: 0x0040, lo: 0xad, hi: 0xaf}, + {value: 0x0018, lo: 0xb0, hi: 0xbc}, + {value: 0x0040, lo: 0xbd, hi: 0xbf}, + // Block 0x11a, offset 0x81c + {value: 0x0000, lo: 0x03}, + {value: 0x0018, lo: 0x80, hi: 0xb6}, + {value: 0x0040, lo: 0xb7, hi: 0xba}, + {value: 0x0018, lo: 0xbb, hi: 0xbf}, + // Block 0x11b, offset 0x820 + {value: 0x0000, lo: 0x06}, + {value: 0x0018, lo: 0x80, hi: 0x99}, + {value: 0x0040, lo: 0x9a, hi: 0x9f}, + {value: 0x0018, lo: 0xa0, hi: 0xab}, + {value: 0x0040, lo: 0xac, hi: 0xaf}, + {value: 0x0018, lo: 0xb0, hi: 0xb0}, + {value: 0x0040, lo: 0xb1, hi: 0xbf}, + // Block 0x11c, offset 0x827 + {value: 0x0000, lo: 0x03}, + {value: 0x0018, lo: 0x80, hi: 0x8b}, + {value: 0x0040, lo: 0x8c, hi: 0x8f}, + {value: 0x0018, lo: 0x90, hi: 0xbf}, + // Block 0x11d, offset 0x82b + {value: 0x0000, lo: 0x05}, + {value: 0x0018, lo: 0x80, hi: 0x87}, + {value: 0x0040, lo: 0x88, hi: 0x8f}, + {value: 0x0018, lo: 0x90, hi: 0x99}, + {value: 0x0040, lo: 0x9a, hi: 0x9f}, + {value: 0x0018, lo: 0xa0, hi: 0xbf}, + // Block 0x11e, offset 0x831 + {value: 0x0000, lo: 0x06}, + {value: 0x0018, lo: 0x80, hi: 0x87}, + {value: 0x0040, lo: 0x88, hi: 0x8f}, + {value: 0x0018, lo: 0x90, hi: 0xad}, + {value: 0x0040, lo: 0xae, hi: 0xaf}, + {value: 0x0018, lo: 0xb0, hi: 0xb1}, + {value: 0x0040, lo: 0xb2, hi: 0xbf}, + // Block 0x11f, offset 0x838 + {value: 0x0000, lo: 0x06}, + {value: 0x0018, lo: 0x80, hi: 0x93}, + {value: 0x0040, lo: 0x94, hi: 0x9f}, + {value: 0x0018, lo: 0xa0, hi: 0xad}, + {value: 0x0040, lo: 0xae, hi: 0xaf}, + {value: 0x0018, lo: 0xb0, hi: 0xbc}, + {value: 0x0040, lo: 0xbd, hi: 0xbf}, + // Block 0x120, offset 0x83f + {value: 0x0000, lo: 0x05}, + {value: 0x0018, lo: 0x80, hi: 0x88}, + {value: 0x0040, lo: 0x89, hi: 0x8f}, + {value: 0x0018, lo: 0x90, hi: 0xbd}, + {value: 0x0040, lo: 0xbe, hi: 0xbe}, + {value: 0x0018, lo: 0xbf, hi: 0xbf}, + // Block 0x121, offset 0x845 + {value: 0x0000, lo: 0x08}, + {value: 0x0018, lo: 0x80, hi: 0x85}, + {value: 0x0040, lo: 0x86, hi: 0x8d}, + {value: 0x0018, lo: 0x8e, hi: 0x9b}, + {value: 0x0040, lo: 0x9c, hi: 0x9f}, + {value: 0x0018, lo: 0xa0, hi: 0xa8}, + {value: 0x0040, lo: 0xa9, hi: 0xaf}, + {value: 0x0018, lo: 0xb0, hi: 0xb8}, + {value: 0x0040, lo: 0xb9, hi: 0xbf}, + // Block 0x122, offset 0x84e + {value: 0x0000, lo: 0x03}, + {value: 0x0018, lo: 0x80, hi: 0x92}, + {value: 0x0040, lo: 0x93, hi: 0x93}, + {value: 0x0018, lo: 0x94, hi: 0xbf}, + // Block 0x123, offset 0x852 + {value: 0x0000, lo: 0x0d}, + {value: 0x0018, lo: 0x80, hi: 0x8a}, + {value: 0x0040, lo: 0x8b, hi: 0xaf}, + {value: 0x06e1, lo: 0xb0, hi: 0xb0}, + {value: 0x0049, lo: 0xb1, hi: 0xb1}, + {value: 0x0029, lo: 0xb2, hi: 0xb2}, + {value: 0x0031, lo: 0xb3, hi: 0xb3}, + {value: 0x06e9, lo: 0xb4, hi: 0xb4}, + {value: 0x06f1, lo: 0xb5, hi: 0xb5}, + {value: 0x06f9, lo: 0xb6, hi: 0xb6}, + {value: 0x0701, lo: 0xb7, hi: 0xb7}, + {value: 0x0709, lo: 0xb8, hi: 0xb8}, + {value: 0x0711, lo: 0xb9, hi: 0xb9}, + {value: 0x0040, lo: 0xba, hi: 0xbf}, + // Block 0x124, offset 0x860 + {value: 0x0000, lo: 0x02}, + {value: 0x0008, lo: 0x80, hi: 0x9f}, + {value: 0x0040, lo: 0xa0, hi: 0xbf}, + // Block 0x125, offset 0x863 + {value: 0x0000, lo: 0x02}, + {value: 0x0008, lo: 0x80, hi: 0xb9}, + {value: 0x0040, lo: 0xba, hi: 0xbf}, + // Block 0x126, offset 0x866 + {value: 0x0000, lo: 0x03}, + {value: 0x0008, lo: 0x80, hi: 0x9d}, + {value: 0x0040, lo: 0x9e, hi: 0x9f}, + {value: 0x0008, lo: 0xa0, hi: 0xbf}, + // Block 0x127, offset 0x86a + {value: 0x0000, lo: 0x03}, + {value: 0x0008, lo: 0x80, hi: 0xa1}, + {value: 0x0040, lo: 0xa2, hi: 0xaf}, + {value: 0x0008, lo: 0xb0, hi: 0xbf}, + // Block 0x128, offset 0x86e + {value: 0x0000, lo: 0x02}, + {value: 0x0008, lo: 0x80, hi: 0xa0}, + {value: 0x0040, lo: 0xa1, hi: 0xbf}, + // Block 0x129, offset 0x871 + {value: 0x0000, lo: 0x03}, + {value: 0x0008, lo: 0x80, hi: 0x8a}, + {value: 0x0040, lo: 0x8b, hi: 0x8f}, + {value: 0x0008, lo: 0x90, hi: 0xbf}, + // Block 0x12a, offset 0x875 + {value: 0x0000, lo: 0x02}, + {value: 0x0008, lo: 0x80, hi: 0xaf}, + {value: 0x0040, lo: 0xb0, hi: 0xbf}, + // Block 0x12b, offset 0x878 + {value: 0x0000, lo: 0x04}, + {value: 0x0040, lo: 0x80, hi: 0x80}, + {value: 0x0340, lo: 0x81, hi: 0x81}, + {value: 0x0040, lo: 0x82, hi: 0x9f}, + {value: 0x0340, lo: 0xa0, hi: 0xbf}, + // Block 0x12c, offset 0x87d + {value: 0x0000, lo: 0x01}, + {value: 0x0340, lo: 0x80, hi: 0xbf}, + // Block 0x12d, offset 0x87f + {value: 0x0000, lo: 0x01}, + {value: 0x33c0, lo: 0x80, hi: 0xbf}, + // Block 0x12e, offset 0x881 + {value: 0x0000, lo: 0x02}, + {value: 0x33c0, lo: 0x80, hi: 0xaf}, + {value: 0x0040, lo: 0xb0, hi: 0xbf}, +} + +// Total table size 46723 bytes (45KiB); checksum: 4CF3143A diff --git a/vendor/golang.org/x/net/idna/trie.go b/vendor/golang.org/x/net/idna/trie.go index c4ef847e..42127417 100644 --- a/vendor/golang.org/x/net/idna/trie.go +++ b/vendor/golang.org/x/net/idna/trie.go @@ -6,27 +6,6 @@ package idna -// appendMapping appends the mapping for the respective rune. isMapped must be -// true. A mapping is a categorization of a rune as defined in UTS #46. -func (c info) appendMapping(b []byte, s string) []byte { - index := int(c >> indexShift) - if c&xorBit == 0 { - s := mappings[index:] - return append(b, s[1:s[0]+1]...) - } - b = append(b, s...) - if c&inlineXOR == inlineXOR { - // TODO: support and handle two-byte inline masks - b[len(b)-1] ^= byte(index) - } else { - for p := len(b) - int(xorData[index]); p < len(b); p++ { - index++ - b[p] ^= xorData[index] - } - } - return b -} - // Sparse block handling code. type valueRange struct { diff --git a/vendor/golang.org/x/net/idna/trie12.0.0.go b/vendor/golang.org/x/net/idna/trie12.0.0.go new file mode 100644 index 00000000..bb63f904 --- /dev/null +++ b/vendor/golang.org/x/net/idna/trie12.0.0.go @@ -0,0 +1,31 @@ +// Code generated by running "go generate" in golang.org/x/text. DO NOT EDIT. + +// Copyright 2016 The Go Authors. All rights reserved. +// Use of this source code is governed by a BSD-style +// license that can be found in the LICENSE file. + +//go:build !go1.16 +// +build !go1.16 + +package idna + +// appendMapping appends the mapping for the respective rune. isMapped must be +// true. A mapping is a categorization of a rune as defined in UTS #46. +func (c info) appendMapping(b []byte, s string) []byte { + index := int(c >> indexShift) + if c&xorBit == 0 { + s := mappings[index:] + return append(b, s[1:s[0]+1]...) + } + b = append(b, s...) + if c&inlineXOR == inlineXOR { + // TODO: support and handle two-byte inline masks + b[len(b)-1] ^= byte(index) + } else { + for p := len(b) - int(xorData[index]); p < len(b); p++ { + index++ + b[p] ^= xorData[index] + } + } + return b +} diff --git a/vendor/golang.org/x/net/idna/trie13.0.0.go b/vendor/golang.org/x/net/idna/trie13.0.0.go new file mode 100644 index 00000000..7d68a8dc --- /dev/null +++ b/vendor/golang.org/x/net/idna/trie13.0.0.go @@ -0,0 +1,31 @@ +// Code generated by running "go generate" in golang.org/x/text. DO NOT EDIT. + +// Copyright 2016 The Go Authors. All rights reserved. +// Use of this source code is governed by a BSD-style +// license that can be found in the LICENSE file. + +//go:build go1.16 +// +build go1.16 + +package idna + +// appendMapping appends the mapping for the respective rune. isMapped must be +// true. A mapping is a categorization of a rune as defined in UTS #46. +func (c info) appendMapping(b []byte, s string) []byte { + index := int(c >> indexShift) + if c&xorBit == 0 { + p := index + return append(b, mappings[mappingIndex[p]:mappingIndex[p+1]]...) + } + b = append(b, s...) + if c&inlineXOR == inlineXOR { + // TODO: support and handle two-byte inline masks + b[len(b)-1] ^= byte(index) + } else { + for p := len(b) - int(xorData[index]); p < len(b); p++ { + index++ + b[p] ^= xorData[index] + } + } + return b +} diff --git a/vendor/golang.org/x/sys/cpu/cpu.go b/vendor/golang.org/x/sys/cpu/cpu.go index 83f112c4..4756ad5f 100644 --- a/vendor/golang.org/x/sys/cpu/cpu.go +++ b/vendor/golang.org/x/sys/cpu/cpu.go @@ -38,7 +38,7 @@ var X86 struct { HasAVX512F bool // Advanced vector extension 512 Foundation Instructions HasAVX512CD bool // Advanced vector extension 512 Conflict Detection Instructions HasAVX512ER bool // Advanced vector extension 512 Exponential and Reciprocal Instructions - HasAVX512PF bool // Advanced vector extension 512 Prefetch Instructions Instructions + HasAVX512PF bool // Advanced vector extension 512 Prefetch Instructions HasAVX512VL bool // Advanced vector extension 512 Vector Length Extensions HasAVX512BW bool // Advanced vector extension 512 Byte and Word Instructions HasAVX512DQ bool // Advanced vector extension 512 Doubleword and Quadword Instructions @@ -54,6 +54,9 @@ var X86 struct { HasAVX512VBMI2 bool // Advanced vector extension 512 Vector Byte Manipulation Instructions 2 HasAVX512BITALG bool // Advanced vector extension 512 Bit Algorithms HasAVX512BF16 bool // Advanced vector extension 512 BFloat16 Instructions + HasAMXTile bool // Advanced Matrix Extension Tile instructions + HasAMXInt8 bool // Advanced Matrix Extension Int8 instructions + HasAMXBF16 bool // Advanced Matrix Extension BFloat16 instructions HasBMI1 bool // Bit manipulation instruction set 1 HasBMI2 bool // Bit manipulation instruction set 2 HasCX16 bool // Compare and exchange 16 Bytes diff --git a/vendor/golang.org/x/sys/cpu/cpu_x86.go b/vendor/golang.org/x/sys/cpu/cpu_x86.go index f5aacfc8..2dcde828 100644 --- a/vendor/golang.org/x/sys/cpu/cpu_x86.go +++ b/vendor/golang.org/x/sys/cpu/cpu_x86.go @@ -37,6 +37,9 @@ func initOptions() { {Name: "avx512vbmi2", Feature: &X86.HasAVX512VBMI2}, {Name: "avx512bitalg", Feature: &X86.HasAVX512BITALG}, {Name: "avx512bf16", Feature: &X86.HasAVX512BF16}, + {Name: "amxtile", Feature: &X86.HasAMXTile}, + {Name: "amxint8", Feature: &X86.HasAMXInt8}, + {Name: "amxbf16", Feature: &X86.HasAMXBF16}, {Name: "bmi1", Feature: &X86.HasBMI1}, {Name: "bmi2", Feature: &X86.HasBMI2}, {Name: "cx16", Feature: &X86.HasCX16}, @@ -138,6 +141,10 @@ func archInit() { eax71, _, _, _ := cpuid(7, 1) X86.HasAVX512BF16 = isSet(5, eax71) } + + X86.HasAMXTile = isSet(24, edx7) + X86.HasAMXInt8 = isSet(25, edx7) + X86.HasAMXBF16 = isSet(22, edx7) } func isSet(bitpos uint, value uint32) bool { diff --git a/vendor/golang.org/x/sys/cpu/endian_little.go b/vendor/golang.org/x/sys/cpu/endian_little.go index fe545966..55db853e 100644 --- a/vendor/golang.org/x/sys/cpu/endian_little.go +++ b/vendor/golang.org/x/sys/cpu/endian_little.go @@ -2,8 +2,8 @@ // Use of this source code is governed by a BSD-style // license that can be found in the LICENSE file. -//go:build 386 || amd64 || amd64p32 || alpha || arm || arm64 || loong64 || mipsle || mips64le || mips64p32le || nios2 || ppc64le || riscv || riscv64 || sh -// +build 386 amd64 amd64p32 alpha arm arm64 loong64 mipsle mips64le mips64p32le nios2 ppc64le riscv riscv64 sh +//go:build 386 || amd64 || amd64p32 || alpha || arm || arm64 || loong64 || mipsle || mips64le || mips64p32le || nios2 || ppc64le || riscv || riscv64 || sh || wasm +// +build 386 amd64 amd64p32 alpha arm arm64 loong64 mipsle mips64le mips64p32le nios2 ppc64le riscv riscv64 sh wasm package cpu diff --git a/vendor/golang.org/x/sys/unix/mkall.sh b/vendor/golang.org/x/sys/unix/mkall.sh index 8e3947c3..e6f31d37 100644 --- a/vendor/golang.org/x/sys/unix/mkall.sh +++ b/vendor/golang.org/x/sys/unix/mkall.sh @@ -50,7 +50,7 @@ if [[ "$GOOS" = "linux" ]]; then # Use the Docker-based build system # Files generated through docker (use $cmd so you can Ctl-C the build or run) $cmd docker build --tag generate:$GOOS $GOOS - $cmd docker run --interactive --tty --volume $(cd -- "$(dirname -- "$0")/.." && /bin/pwd):/build generate:$GOOS + $cmd docker run --interactive --tty --volume $(cd -- "$(dirname -- "$0")/.." && pwd):/build generate:$GOOS exit fi diff --git a/vendor/golang.org/x/sys/unix/mkerrors.sh b/vendor/golang.org/x/sys/unix/mkerrors.sh index be0423e6..47fa6a7e 100644 --- a/vendor/golang.org/x/sys/unix/mkerrors.sh +++ b/vendor/golang.org/x/sys/unix/mkerrors.sh @@ -519,7 +519,7 @@ ccflags="$@" $2 ~ /^LOCK_(SH|EX|NB|UN)$/ || $2 ~ /^LO_(KEY|NAME)_SIZE$/ || $2 ~ /^LOOP_(CLR|CTL|GET|SET)_/ || - $2 ~ /^(AF|SOCK|SO|SOL|IPPROTO|IP|IPV6|TCP|MCAST|EVFILT|NOTE|SHUT|PROT|MAP|MFD|T?PACKET|MSG|SCM|MCL|DT|MADV|PR|LOCAL|TCPOPT|UDP)_/ || + $2 ~ /^(AF|SOCK|SO|SOL|IPPROTO|IP|IPV6|TCP|MCAST|EVFILT|NOTE|SHUT|PROT|MAP|MREMAP|MFD|T?PACKET|MSG|SCM|MCL|DT|MADV|PR|LOCAL|TCPOPT|UDP)_/ || $2 ~ /^NFC_(GENL|PROTO|COMM|RF|SE|DIRECTION|LLCP|SOCKPROTO)_/ || $2 ~ /^NFC_.*_(MAX)?SIZE$/ || $2 ~ /^RAW_PAYLOAD_/ || @@ -583,6 +583,7 @@ ccflags="$@" $2 ~ /^PERF_/ || $2 ~ /^SECCOMP_MODE_/ || $2 ~ /^SEEK_/ || + $2 ~ /^SCHED_/ || $2 ~ /^SPLICE_/ || $2 ~ /^SYNC_FILE_RANGE_/ || $2 !~ /IOC_MAGIC/ && @@ -624,7 +625,7 @@ ccflags="$@" $2 ~ /^MEM/ || $2 ~ /^WG/ || $2 ~ /^FIB_RULE_/ || - $2 ~ /^BLK[A-Z]*(GET$|SET$|BUF$|PART$|SIZE)/ {printf("\t%s = C.%s\n", $2, $2)} + $2 ~ /^BLK[A-Z]*(GET$|SET$|BUF$|PART$|SIZE|IOMIN$|IOOPT$|ALIGNOFF$|DISCARD|ROTATIONAL$|ZEROOUT$|GETDISKSEQ$)/ {printf("\t%s = C.%s\n", $2, $2)} $2 ~ /^__WCOREFLAG$/ {next} $2 ~ /^__W[A-Z0-9]+$/ {printf("\t%s = C.%s\n", substr($2,3), $2)} @@ -741,7 +742,8 @@ main(void) e = errors[i].num; if(i > 0 && errors[i-1].num == e) continue; - strcpy(buf, strerror(e)); + strncpy(buf, strerror(e), sizeof(buf) - 1); + buf[sizeof(buf) - 1] = '\0'; // lowercase first letter: Bad -> bad, but STREAM -> STREAM. if(A <= buf[0] && buf[0] <= Z && a <= buf[1] && buf[1] <= z) buf[0] += a - A; @@ -760,7 +762,8 @@ main(void) e = signals[i].num; if(i > 0 && signals[i-1].num == e) continue; - strcpy(buf, strsignal(e)); + strncpy(buf, strsignal(e), sizeof(buf) - 1); + buf[sizeof(buf) - 1] = '\0'; // lowercase first letter: Bad -> bad, but STREAM -> STREAM. if(A <= buf[0] && buf[0] <= Z && a <= buf[1] && buf[1] <= z) buf[0] += a - A; diff --git a/vendor/golang.org/x/sys/unix/mmap_nomremap.go b/vendor/golang.org/x/sys/unix/mmap_nomremap.go new file mode 100644 index 00000000..ca051363 --- /dev/null +++ b/vendor/golang.org/x/sys/unix/mmap_nomremap.go @@ -0,0 +1,14 @@ +// Copyright 2023 The Go Authors. All rights reserved. +// Use of this source code is governed by a BSD-style +// license that can be found in the LICENSE file. + +//go:build aix || darwin || dragonfly || freebsd || openbsd || solaris +// +build aix darwin dragonfly freebsd openbsd solaris + +package unix + +var mapper = &mmapper{ + active: make(map[*byte][]byte), + mmap: mmap, + munmap: munmap, +} diff --git a/vendor/golang.org/x/sys/unix/mremap.go b/vendor/golang.org/x/sys/unix/mremap.go new file mode 100644 index 00000000..fa93d0aa --- /dev/null +++ b/vendor/golang.org/x/sys/unix/mremap.go @@ -0,0 +1,53 @@ +// Copyright 2023 The Go Authors. All rights reserved. +// Use of this source code is governed by a BSD-style +// license that can be found in the LICENSE file. + +//go:build linux || netbsd +// +build linux netbsd + +package unix + +import "unsafe" + +type mremapMmapper struct { + mmapper + mremap func(oldaddr uintptr, oldlength uintptr, newlength uintptr, flags int, newaddr uintptr) (xaddr uintptr, err error) +} + +var mapper = &mremapMmapper{ + mmapper: mmapper{ + active: make(map[*byte][]byte), + mmap: mmap, + munmap: munmap, + }, + mremap: mremap, +} + +func (m *mremapMmapper) Mremap(oldData []byte, newLength int, flags int) (data []byte, err error) { + if newLength <= 0 || len(oldData) == 0 || len(oldData) != cap(oldData) || flags&mremapFixed != 0 { + return nil, EINVAL + } + + pOld := &oldData[cap(oldData)-1] + m.Lock() + defer m.Unlock() + bOld := m.active[pOld] + if bOld == nil || &bOld[0] != &oldData[0] { + return nil, EINVAL + } + newAddr, errno := m.mremap(uintptr(unsafe.Pointer(&bOld[0])), uintptr(len(bOld)), uintptr(newLength), flags, 0) + if errno != nil { + return nil, errno + } + bNew := unsafe.Slice((*byte)(unsafe.Pointer(newAddr)), newLength) + pNew := &bNew[cap(bNew)-1] + if flags&mremapDontunmap == 0 { + delete(m.active, pOld) + } + m.active[pNew] = bNew + return bNew, nil +} + +func Mremap(oldData []byte, newLength int, flags int) (data []byte, err error) { + return mapper.Mremap(oldData, newLength, flags) +} diff --git a/vendor/golang.org/x/sys/unix/syscall_aix.go b/vendor/golang.org/x/sys/unix/syscall_aix.go index c406ae00..9a6e5aca 100644 --- a/vendor/golang.org/x/sys/unix/syscall_aix.go +++ b/vendor/golang.org/x/sys/unix/syscall_aix.go @@ -535,21 +535,6 @@ func Fsync(fd int) error { //sys sendmsg(s int, msg *Msghdr, flags int) (n int, err error) = nsendmsg //sys munmap(addr uintptr, length uintptr) (err error) - -var mapper = &mmapper{ - active: make(map[*byte][]byte), - mmap: mmap, - munmap: munmap, -} - -func Mmap(fd int, offset int64, length int, prot int, flags int) (data []byte, err error) { - return mapper.Mmap(fd, offset, length, prot, flags) -} - -func Munmap(b []byte) (err error) { - return mapper.Munmap(b) -} - //sys Madvise(b []byte, advice int) (err error) //sys Mprotect(b []byte, prot int) (err error) //sys Mlock(b []byte) (err error) diff --git a/vendor/golang.org/x/sys/unix/syscall_bsd.go b/vendor/golang.org/x/sys/unix/syscall_bsd.go index 7705c327..4217de51 100644 --- a/vendor/golang.org/x/sys/unix/syscall_bsd.go +++ b/vendor/golang.org/x/sys/unix/syscall_bsd.go @@ -601,20 +601,6 @@ func Poll(fds []PollFd, timeout int) (n int, err error) { // Gethostuuid(uuid *byte, timeout *Timespec) (err error) // Ptrace(req int, pid int, addr uintptr, data int) (ret uintptr, err error) -var mapper = &mmapper{ - active: make(map[*byte][]byte), - mmap: mmap, - munmap: munmap, -} - -func Mmap(fd int, offset int64, length int, prot int, flags int) (data []byte, err error) { - return mapper.Mmap(fd, offset, length, prot, flags) -} - -func Munmap(b []byte) (err error) { - return mapper.Munmap(b) -} - //sys Madvise(b []byte, behav int) (err error) //sys Mlock(b []byte) (err error) //sys Mlockall(flags int) (err error) diff --git a/vendor/golang.org/x/sys/unix/syscall_darwin.go b/vendor/golang.org/x/sys/unix/syscall_darwin.go index 20692150..135cc3cd 100644 --- a/vendor/golang.org/x/sys/unix/syscall_darwin.go +++ b/vendor/golang.org/x/sys/unix/syscall_darwin.go @@ -510,30 +510,36 @@ func SysctlKinfoProcSlice(name string, args ...int) ([]KinfoProc, error) { return nil, err } - // Find size. - n := uintptr(0) - if err := sysctl(mib, nil, &n, nil, 0); err != nil { - return nil, err - } - if n == 0 { - return nil, nil - } - if n%SizeofKinfoProc != 0 { - return nil, fmt.Errorf("sysctl() returned a size of %d, which is not a multiple of %d", n, SizeofKinfoProc) - } + for { + // Find size. + n := uintptr(0) + if err := sysctl(mib, nil, &n, nil, 0); err != nil { + return nil, err + } + if n == 0 { + return nil, nil + } + if n%SizeofKinfoProc != 0 { + return nil, fmt.Errorf("sysctl() returned a size of %d, which is not a multiple of %d", n, SizeofKinfoProc) + } - // Read into buffer of that size. - buf := make([]KinfoProc, n/SizeofKinfoProc) - if err := sysctl(mib, (*byte)(unsafe.Pointer(&buf[0])), &n, nil, 0); err != nil { - return nil, err - } - if n%SizeofKinfoProc != 0 { - return nil, fmt.Errorf("sysctl() returned a size of %d, which is not a multiple of %d", n, SizeofKinfoProc) - } + // Read into buffer of that size. + buf := make([]KinfoProc, n/SizeofKinfoProc) + if err := sysctl(mib, (*byte)(unsafe.Pointer(&buf[0])), &n, nil, 0); err != nil { + if err == ENOMEM { + // Process table grew. Try again. + continue + } + return nil, err + } + if n%SizeofKinfoProc != 0 { + return nil, fmt.Errorf("sysctl() returned a size of %d, which is not a multiple of %d", n, SizeofKinfoProc) + } - // The actual call may return less than the original reported required - // size so ensure we deal with that. - return buf[:n/SizeofKinfoProc], nil + // The actual call may return less than the original reported required + // size so ensure we deal with that. + return buf[:n/SizeofKinfoProc], nil + } } //sys sendfile(infd int, outfd int, offset int64, len *int64, hdtr unsafe.Pointer, flags int) (err error) diff --git a/vendor/golang.org/x/sys/unix/syscall_linux.go b/vendor/golang.org/x/sys/unix/syscall_linux.go index fbaeb5ff..0ba03019 100644 --- a/vendor/golang.org/x/sys/unix/syscall_linux.go +++ b/vendor/golang.org/x/sys/unix/syscall_linux.go @@ -1699,12 +1699,23 @@ func PtracePokeUser(pid int, addr uintptr, data []byte) (count int, err error) { return ptracePoke(PTRACE_POKEUSR, PTRACE_PEEKUSR, pid, addr, data) } +// elfNT_PRSTATUS is a copy of the debug/elf.NT_PRSTATUS constant so +// x/sys/unix doesn't need to depend on debug/elf and thus +// compress/zlib, debug/dwarf, and other packages. +const elfNT_PRSTATUS = 1 + func PtraceGetRegs(pid int, regsout *PtraceRegs) (err error) { - return ptracePtr(PTRACE_GETREGS, pid, 0, unsafe.Pointer(regsout)) + var iov Iovec + iov.Base = (*byte)(unsafe.Pointer(regsout)) + iov.SetLen(int(unsafe.Sizeof(*regsout))) + return ptracePtr(PTRACE_GETREGSET, pid, uintptr(elfNT_PRSTATUS), unsafe.Pointer(&iov)) } func PtraceSetRegs(pid int, regs *PtraceRegs) (err error) { - return ptracePtr(PTRACE_SETREGS, pid, 0, unsafe.Pointer(regs)) + var iov Iovec + iov.Base = (*byte)(unsafe.Pointer(regs)) + iov.SetLen(int(unsafe.Sizeof(*regs))) + return ptracePtr(PTRACE_SETREGSET, pid, uintptr(elfNT_PRSTATUS), unsafe.Pointer(&iov)) } func PtraceSetOptions(pid int, options int) (err error) { @@ -1874,7 +1885,7 @@ func Getpgrp() (pid int) { //sys PerfEventOpen(attr *PerfEventAttr, pid int, cpu int, groupFd int, flags int) (fd int, err error) //sys PivotRoot(newroot string, putold string) (err error) = SYS_PIVOT_ROOT //sys Prctl(option int, arg2 uintptr, arg3 uintptr, arg4 uintptr, arg5 uintptr) (err error) -//sys Pselect(nfd int, r *FdSet, w *FdSet, e *FdSet, timeout *Timespec, sigmask *Sigset_t) (n int, err error) = SYS_PSELECT6 +//sys pselect6(nfd int, r *FdSet, w *FdSet, e *FdSet, timeout *Timespec, sigmask *sigset_argpack) (n int, err error) //sys read(fd int, p []byte) (n int, err error) //sys Removexattr(path string, attr string) (err error) //sys Renameat2(olddirfd int, oldpath string, newdirfd int, newpath string, flags uint) (err error) @@ -2113,21 +2124,7 @@ func writevRacedetect(iovecs []Iovec, n int) { // mmap varies by architecture; see syscall_linux_*.go. //sys munmap(addr uintptr, length uintptr) (err error) - -var mapper = &mmapper{ - active: make(map[*byte][]byte), - mmap: mmap, - munmap: munmap, -} - -func Mmap(fd int, offset int64, length int, prot int, flags int) (data []byte, err error) { - return mapper.Mmap(fd, offset, length, prot, flags) -} - -func Munmap(b []byte) (err error) { - return mapper.Munmap(b) -} - +//sys mremap(oldaddr uintptr, oldlength uintptr, newlength uintptr, flags int, newaddr uintptr) (xaddr uintptr, err error) //sys Madvise(b []byte, advice int) (err error) //sys Mprotect(b []byte, prot int) (err error) //sys Mlock(b []byte) (err error) @@ -2136,6 +2133,12 @@ func Munmap(b []byte) (err error) { //sys Munlock(b []byte) (err error) //sys Munlockall() (err error) +const ( + mremapFixed = MREMAP_FIXED + mremapDontunmap = MREMAP_DONTUNMAP + mremapMaymove = MREMAP_MAYMOVE +) + // Vmsplice splices user pages from a slice of Iovecs into a pipe specified by fd, // using the specified flags. func Vmsplice(fd int, iovs []Iovec, flags int) (int, error) { @@ -2420,6 +2423,77 @@ func PthreadSigmask(how int, set, oldset *Sigset_t) error { return rtSigprocmask(how, set, oldset, _C__NSIG/8) } +//sysnb getresuid(ruid *_C_int, euid *_C_int, suid *_C_int) +//sysnb getresgid(rgid *_C_int, egid *_C_int, sgid *_C_int) + +func Getresuid() (ruid, euid, suid int) { + var r, e, s _C_int + getresuid(&r, &e, &s) + return int(r), int(e), int(s) +} + +func Getresgid() (rgid, egid, sgid int) { + var r, e, s _C_int + getresgid(&r, &e, &s) + return int(r), int(e), int(s) +} + +// Pselect is a wrapper around the Linux pselect6 system call. +// This version does not modify the timeout argument. +func Pselect(nfd int, r *FdSet, w *FdSet, e *FdSet, timeout *Timespec, sigmask *Sigset_t) (n int, err error) { + // Per https://man7.org/linux/man-pages/man2/select.2.html#NOTES, + // The Linux pselect6() system call modifies its timeout argument. + // [Not modifying the argument] is the behavior required by POSIX.1-2001. + var mutableTimeout *Timespec + if timeout != nil { + mutableTimeout = new(Timespec) + *mutableTimeout = *timeout + } + + // The final argument of the pselect6() system call is not a + // sigset_t * pointer, but is instead a structure + var kernelMask *sigset_argpack + if sigmask != nil { + wordBits := 32 << (^uintptr(0) >> 63) // see math.intSize + + // A sigset stores one bit per signal, + // offset by 1 (because signal 0 does not exist). + // So the number of words needed is ⌈__C_NSIG - 1 / wordBits⌉. + sigsetWords := (_C__NSIG - 1 + wordBits - 1) / (wordBits) + + sigsetBytes := uintptr(sigsetWords * (wordBits / 8)) + kernelMask = &sigset_argpack{ + ss: sigmask, + ssLen: sigsetBytes, + } + } + + return pselect6(nfd, r, w, e, mutableTimeout, kernelMask) +} + +//sys schedSetattr(pid int, attr *SchedAttr, flags uint) (err error) +//sys schedGetattr(pid int, attr *SchedAttr, size uint, flags uint) (err error) + +// SchedSetAttr is a wrapper for sched_setattr(2) syscall. +// https://man7.org/linux/man-pages/man2/sched_setattr.2.html +func SchedSetAttr(pid int, attr *SchedAttr, flags uint) error { + if attr == nil { + return EINVAL + } + attr.Size = SizeofSchedAttr + return schedSetattr(pid, attr, flags) +} + +// SchedGetAttr is a wrapper for sched_getattr(2) syscall. +// https://man7.org/linux/man-pages/man2/sched_getattr.2.html +func SchedGetAttr(pid int, flags uint) (*SchedAttr, error) { + attr := &SchedAttr{} + if err := schedGetattr(pid, attr, SizeofSchedAttr, flags); err != nil { + return nil, err + } + return attr, nil +} + /* * Unimplemented */ @@ -2461,7 +2535,6 @@ func PthreadSigmask(how int, set, oldset *Sigset_t) error { // MqTimedreceive // MqTimedsend // MqUnlink -// Mremap // Msgctl // Msgget // Msgrcv diff --git a/vendor/golang.org/x/sys/unix/syscall_linux_amd64.go b/vendor/golang.org/x/sys/unix/syscall_linux_amd64.go index 5b21fcfd..70601ce3 100644 --- a/vendor/golang.org/x/sys/unix/syscall_linux_amd64.go +++ b/vendor/golang.org/x/sys/unix/syscall_linux_amd64.go @@ -40,7 +40,7 @@ func Select(nfd int, r *FdSet, w *FdSet, e *FdSet, timeout *Timeval) (n int, err if timeout != nil { ts = &Timespec{Sec: timeout.Sec, Nsec: timeout.Usec * 1000} } - return Pselect(nfd, r, w, e, ts, nil) + return pselect6(nfd, r, w, e, ts, nil) } //sys sendfile(outfd int, infd int, offset *int64, count int) (written int, err error) diff --git a/vendor/golang.org/x/sys/unix/syscall_linux_arm64.go b/vendor/golang.org/x/sys/unix/syscall_linux_arm64.go index a81f5742..f5266689 100644 --- a/vendor/golang.org/x/sys/unix/syscall_linux_arm64.go +++ b/vendor/golang.org/x/sys/unix/syscall_linux_arm64.go @@ -33,7 +33,7 @@ func Select(nfd int, r *FdSet, w *FdSet, e *FdSet, timeout *Timeval) (n int, err if timeout != nil { ts = &Timespec{Sec: timeout.Sec, Nsec: timeout.Usec * 1000} } - return Pselect(nfd, r, w, e, ts, nil) + return pselect6(nfd, r, w, e, ts, nil) } //sys sendfile(outfd int, infd int, offset *int64, count int) (written int, err error) diff --git a/vendor/golang.org/x/sys/unix/syscall_linux_loong64.go b/vendor/golang.org/x/sys/unix/syscall_linux_loong64.go index 69d2d7c3..f6ab02ec 100644 --- a/vendor/golang.org/x/sys/unix/syscall_linux_loong64.go +++ b/vendor/golang.org/x/sys/unix/syscall_linux_loong64.go @@ -28,7 +28,7 @@ func Select(nfd int, r *FdSet, w *FdSet, e *FdSet, timeout *Timeval) (n int, err if timeout != nil { ts = &Timespec{Sec: timeout.Sec, Nsec: timeout.Usec * 1000} } - return Pselect(nfd, r, w, e, ts, nil) + return pselect6(nfd, r, w, e, ts, nil) } //sys sendfile(outfd int, infd int, offset *int64, count int) (written int, err error) diff --git a/vendor/golang.org/x/sys/unix/syscall_linux_mips64x.go b/vendor/golang.org/x/sys/unix/syscall_linux_mips64x.go index 76d56409..93fe59d2 100644 --- a/vendor/golang.org/x/sys/unix/syscall_linux_mips64x.go +++ b/vendor/golang.org/x/sys/unix/syscall_linux_mips64x.go @@ -31,7 +31,7 @@ func Select(nfd int, r *FdSet, w *FdSet, e *FdSet, timeout *Timeval) (n int, err if timeout != nil { ts = &Timespec{Sec: timeout.Sec, Nsec: timeout.Usec * 1000} } - return Pselect(nfd, r, w, e, ts, nil) + return pselect6(nfd, r, w, e, ts, nil) } //sys sendfile(outfd int, infd int, offset *int64, count int) (written int, err error) diff --git a/vendor/golang.org/x/sys/unix/syscall_linux_riscv64.go b/vendor/golang.org/x/sys/unix/syscall_linux_riscv64.go index 35851ef7..5e6ceee1 100644 --- a/vendor/golang.org/x/sys/unix/syscall_linux_riscv64.go +++ b/vendor/golang.org/x/sys/unix/syscall_linux_riscv64.go @@ -32,7 +32,7 @@ func Select(nfd int, r *FdSet, w *FdSet, e *FdSet, timeout *Timeval) (n int, err if timeout != nil { ts = &Timespec{Sec: timeout.Sec, Nsec: timeout.Usec * 1000} } - return Pselect(nfd, r, w, e, ts, nil) + return pselect6(nfd, r, w, e, ts, nil) } //sys sendfile(outfd int, infd int, offset *int64, count int) (written int, err error) @@ -177,3 +177,14 @@ func KexecFileLoad(kernelFd int, initrdFd int, cmdline string, flags int) error } return kexecFileLoad(kernelFd, initrdFd, cmdlineLen, cmdline, flags) } + +//sys riscvHWProbe(pairs []RISCVHWProbePairs, cpuCount uintptr, cpus *CPUSet, flags uint) (err error) + +func RISCVHWProbe(pairs []RISCVHWProbePairs, set *CPUSet, flags uint) (err error) { + var setSize uintptr + + if set != nil { + setSize = uintptr(unsafe.Sizeof(*set)) + } + return riscvHWProbe(pairs, setSize, set, flags) +} diff --git a/vendor/golang.org/x/sys/unix/syscall_netbsd.go b/vendor/golang.org/x/sys/unix/syscall_netbsd.go index 018d7d47..ddd1ac85 100644 --- a/vendor/golang.org/x/sys/unix/syscall_netbsd.go +++ b/vendor/golang.org/x/sys/unix/syscall_netbsd.go @@ -360,6 +360,18 @@ func Statvfs(path string, buf *Statvfs_t) (err error) { //sys writelen(fd int, buf *byte, nbuf int) (n int, err error) = SYS_WRITE //sys utimensat(dirfd int, path string, times *[2]Timespec, flags int) (err error) +const ( + mremapFixed = MAP_FIXED + mremapDontunmap = 0 + mremapMaymove = 0 +) + +//sys mremapNetBSD(oldp uintptr, oldsize uintptr, newp uintptr, newsize uintptr, flags int) (xaddr uintptr, err error) = SYS_MREMAP + +func mremap(oldaddr uintptr, oldlength uintptr, newlength uintptr, flags int, newaddr uintptr) (uintptr, error) { + return mremapNetBSD(oldaddr, oldlength, newaddr, newlength, flags) +} + /* * Unimplemented */ @@ -564,7 +576,6 @@ func Statvfs(path string, buf *Statvfs_t) (err error) { // mq_timedreceive // mq_timedsend // mq_unlink -// mremap // msgget // msgrcv // msgsnd diff --git a/vendor/golang.org/x/sys/unix/syscall_openbsd.go b/vendor/golang.org/x/sys/unix/syscall_openbsd.go index f9c7a966..c5f166a1 100644 --- a/vendor/golang.org/x/sys/unix/syscall_openbsd.go +++ b/vendor/golang.org/x/sys/unix/syscall_openbsd.go @@ -151,6 +151,21 @@ func Getfsstat(buf []Statfs_t, flags int) (n int, err error) { return } +//sysnb getresuid(ruid *_C_int, euid *_C_int, suid *_C_int) +//sysnb getresgid(rgid *_C_int, egid *_C_int, sgid *_C_int) + +func Getresuid() (ruid, euid, suid int) { + var r, e, s _C_int + getresuid(&r, &e, &s) + return int(r), int(e), int(s) +} + +func Getresgid() (rgid, egid, sgid int) { + var r, e, s _C_int + getresgid(&r, &e, &s) + return int(r), int(e), int(s) +} + //sys ioctl(fd int, req uint, arg uintptr) (err error) //sys ioctlPtr(fd int, req uint, arg unsafe.Pointer) (err error) = SYS_IOCTL @@ -338,8 +353,6 @@ func Uname(uname *Utsname) error { // getgid // getitimer // getlogin -// getresgid -// getresuid // getthrid // ktrace // lfs_bmapv diff --git a/vendor/golang.org/x/sys/unix/syscall_solaris.go b/vendor/golang.org/x/sys/unix/syscall_solaris.go index b600a289..72d23575 100644 --- a/vendor/golang.org/x/sys/unix/syscall_solaris.go +++ b/vendor/golang.org/x/sys/unix/syscall_solaris.go @@ -716,20 +716,6 @@ func writelen(fd int, buf *byte, nbuf int) (n int, err error) { return } -var mapper = &mmapper{ - active: make(map[*byte][]byte), - mmap: mmap, - munmap: munmap, -} - -func Mmap(fd int, offset int64, length int, prot int, flags int) (data []byte, err error) { - return mapper.Mmap(fd, offset, length, prot, flags) -} - -func Munmap(b []byte) (err error) { - return mapper.Munmap(b) -} - // Event Ports type fileObjCookie struct { diff --git a/vendor/golang.org/x/sys/unix/syscall_unix.go b/vendor/golang.org/x/sys/unix/syscall_unix.go index 8e48c29e..f6eda270 100644 --- a/vendor/golang.org/x/sys/unix/syscall_unix.go +++ b/vendor/golang.org/x/sys/unix/syscall_unix.go @@ -147,6 +147,14 @@ func (m *mmapper) Munmap(data []byte) (err error) { return nil } +func Mmap(fd int, offset int64, length int, prot int, flags int) (data []byte, err error) { + return mapper.Mmap(fd, offset, length, prot, flags) +} + +func Munmap(b []byte) (err error) { + return mapper.Munmap(b) +} + func Read(fd int, p []byte) (n int, err error) { n, err = read(fd, p) if raceenabled { @@ -541,6 +549,9 @@ func SetNonblock(fd int, nonblocking bool) (err error) { if err != nil { return err } + if (flag&O_NONBLOCK != 0) == nonblocking { + return nil + } if nonblocking { flag |= O_NONBLOCK } else { diff --git a/vendor/golang.org/x/sys/unix/syscall_zos_s390x.go b/vendor/golang.org/x/sys/unix/syscall_zos_s390x.go index d3d49ec3..44e72edb 100644 --- a/vendor/golang.org/x/sys/unix/syscall_zos_s390x.go +++ b/vendor/golang.org/x/sys/unix/syscall_zos_s390x.go @@ -285,25 +285,11 @@ func Close(fd int) (err error) { return } -var mapper = &mmapper{ - active: make(map[*byte][]byte), - mmap: mmap, - munmap: munmap, -} - // Dummy function: there are no semantics for Madvise on z/OS func Madvise(b []byte, advice int) (err error) { return } -func Mmap(fd int, offset int64, length int, prot int, flags int) (data []byte, err error) { - return mapper.Mmap(fd, offset, length, prot, flags) -} - -func Munmap(b []byte) (err error) { - return mapper.Munmap(b) -} - //sys Gethostname(buf []byte) (err error) = SYS___GETHOSTNAME_A //sysnb Getegid() (egid int) //sysnb Geteuid() (uid int) diff --git a/vendor/golang.org/x/sys/unix/zerrors_linux.go b/vendor/golang.org/x/sys/unix/zerrors_linux.go index de936b67..0787a043 100644 --- a/vendor/golang.org/x/sys/unix/zerrors_linux.go +++ b/vendor/golang.org/x/sys/unix/zerrors_linux.go @@ -493,6 +493,7 @@ const ( BPF_F_TEST_RUN_ON_CPU = 0x1 BPF_F_TEST_STATE_FREQ = 0x8 BPF_F_TEST_XDP_LIVE_FRAMES = 0x2 + BPF_F_XDP_DEV_BOUND_ONLY = 0x40 BPF_F_XDP_HAS_FRAGS = 0x20 BPF_H = 0x8 BPF_IMM = 0x0 @@ -826,9 +827,9 @@ const ( DM_UUID_FLAG = 0x4000 DM_UUID_LEN = 0x81 DM_VERSION = 0xc138fd00 - DM_VERSION_EXTRA = "-ioctl (2022-07-28)" + DM_VERSION_EXTRA = "-ioctl (2023-03-01)" DM_VERSION_MAJOR = 0x4 - DM_VERSION_MINOR = 0x2f + DM_VERSION_MINOR = 0x30 DM_VERSION_PATCHLEVEL = 0x0 DT_BLK = 0x6 DT_CHR = 0x2 @@ -1197,6 +1198,7 @@ const ( FAN_EVENT_METADATA_LEN = 0x18 FAN_EVENT_ON_CHILD = 0x8000000 FAN_FS_ERROR = 0x8000 + FAN_INFO = 0x20 FAN_MARK_ADD = 0x1 FAN_MARK_DONT_FOLLOW = 0x4 FAN_MARK_EVICTABLE = 0x200 @@ -1233,6 +1235,8 @@ const ( FAN_REPORT_PIDFD = 0x80 FAN_REPORT_TARGET_FID = 0x1000 FAN_REPORT_TID = 0x100 + FAN_RESPONSE_INFO_AUDIT_RULE = 0x1 + FAN_RESPONSE_INFO_NONE = 0x0 FAN_UNLIMITED_MARKS = 0x20 FAN_UNLIMITED_QUEUE = 0x10 FD_CLOEXEC = 0x1 @@ -1860,6 +1864,7 @@ const ( MEMWRITEOOB64 = 0xc0184d15 MFD_ALLOW_SEALING = 0x2 MFD_CLOEXEC = 0x1 + MFD_EXEC = 0x10 MFD_HUGETLB = 0x4 MFD_HUGE_16GB = 0x88000000 MFD_HUGE_16MB = 0x60000000 @@ -1875,6 +1880,7 @@ const ( MFD_HUGE_8MB = 0x5c000000 MFD_HUGE_MASK = 0x3f MFD_HUGE_SHIFT = 0x1a + MFD_NOEXEC_SEAL = 0x8 MINIX2_SUPER_MAGIC = 0x2468 MINIX2_SUPER_MAGIC2 = 0x2478 MINIX3_SUPER_MAGIC = 0x4d5a @@ -1898,6 +1904,9 @@ const ( MOUNT_ATTR_SIZE_VER0 = 0x20 MOUNT_ATTR_STRICTATIME = 0x20 MOUNT_ATTR__ATIME = 0x70 + MREMAP_DONTUNMAP = 0x4 + MREMAP_FIXED = 0x2 + MREMAP_MAYMOVE = 0x1 MSDOS_SUPER_MAGIC = 0x4d44 MSG_BATCH = 0x40000 MSG_CMSG_CLOEXEC = 0x40000000 @@ -2204,6 +2213,7 @@ const ( PACKET_USER = 0x6 PACKET_VERSION = 0xa PACKET_VNET_HDR = 0xf + PACKET_VNET_HDR_SZ = 0x18 PARITY_CRC16_PR0 = 0x2 PARITY_CRC16_PR0_CCITT = 0x4 PARITY_CRC16_PR1 = 0x3 @@ -2221,6 +2231,7 @@ const ( PERF_ATTR_SIZE_VER5 = 0x70 PERF_ATTR_SIZE_VER6 = 0x78 PERF_ATTR_SIZE_VER7 = 0x80 + PERF_ATTR_SIZE_VER8 = 0x88 PERF_AUX_FLAG_COLLISION = 0x8 PERF_AUX_FLAG_CORESIGHT_FORMAT_CORESIGHT = 0x0 PERF_AUX_FLAG_CORESIGHT_FORMAT_RAW = 0x100 @@ -2361,6 +2372,7 @@ const ( PR_FP_EXC_UND = 0x40000 PR_FP_MODE_FR = 0x1 PR_FP_MODE_FRE = 0x2 + PR_GET_AUXV = 0x41555856 PR_GET_CHILD_SUBREAPER = 0x25 PR_GET_DUMPABLE = 0x3 PR_GET_ENDIAN = 0x13 @@ -2369,6 +2381,8 @@ const ( PR_GET_FP_MODE = 0x2e PR_GET_IO_FLUSHER = 0x3a PR_GET_KEEPCAPS = 0x7 + PR_GET_MDWE = 0x42 + PR_GET_MEMORY_MERGE = 0x44 PR_GET_NAME = 0x10 PR_GET_NO_NEW_PRIVS = 0x27 PR_GET_PDEATHSIG = 0x2 @@ -2389,6 +2403,7 @@ const ( PR_MCE_KILL_GET = 0x22 PR_MCE_KILL_LATE = 0x0 PR_MCE_KILL_SET = 0x1 + PR_MDWE_REFUSE_EXEC_GAIN = 0x1 PR_MPX_DISABLE_MANAGEMENT = 0x2c PR_MPX_ENABLE_MANAGEMENT = 0x2b PR_MTE_TAG_MASK = 0x7fff8 @@ -2423,6 +2438,8 @@ const ( PR_SET_FP_MODE = 0x2d PR_SET_IO_FLUSHER = 0x39 PR_SET_KEEPCAPS = 0x8 + PR_SET_MDWE = 0x41 + PR_SET_MEMORY_MERGE = 0x43 PR_SET_MM = 0x23 PR_SET_MM_ARG_END = 0x9 PR_SET_MM_ARG_START = 0x8 @@ -2506,6 +2523,7 @@ const ( PTRACE_GETSIGMASK = 0x420a PTRACE_GET_RSEQ_CONFIGURATION = 0x420f PTRACE_GET_SYSCALL_INFO = 0x420e + PTRACE_GET_SYSCALL_USER_DISPATCH_CONFIG = 0x4211 PTRACE_INTERRUPT = 0x4207 PTRACE_KILL = 0x8 PTRACE_LISTEN = 0x4208 @@ -2536,6 +2554,7 @@ const ( PTRACE_SETREGSET = 0x4205 PTRACE_SETSIGINFO = 0x4203 PTRACE_SETSIGMASK = 0x420b + PTRACE_SET_SYSCALL_USER_DISPATCH_CONFIG = 0x4210 PTRACE_SINGLESTEP = 0x9 PTRACE_SYSCALL = 0x18 PTRACE_SYSCALL_INFO_ENTRY = 0x1 @@ -2802,6 +2821,23 @@ const ( RWF_SUPPORTED = 0x1f RWF_SYNC = 0x4 RWF_WRITE_LIFE_NOT_SET = 0x0 + SCHED_BATCH = 0x3 + SCHED_DEADLINE = 0x6 + SCHED_FIFO = 0x1 + SCHED_FLAG_ALL = 0x7f + SCHED_FLAG_DL_OVERRUN = 0x4 + SCHED_FLAG_KEEP_ALL = 0x18 + SCHED_FLAG_KEEP_PARAMS = 0x10 + SCHED_FLAG_KEEP_POLICY = 0x8 + SCHED_FLAG_RECLAIM = 0x2 + SCHED_FLAG_RESET_ON_FORK = 0x1 + SCHED_FLAG_UTIL_CLAMP = 0x60 + SCHED_FLAG_UTIL_CLAMP_MAX = 0x40 + SCHED_FLAG_UTIL_CLAMP_MIN = 0x20 + SCHED_IDLE = 0x5 + SCHED_NORMAL = 0x0 + SCHED_RESET_ON_FORK = 0x40000000 + SCHED_RR = 0x2 SCM_CREDENTIALS = 0x2 SCM_RIGHTS = 0x1 SCM_TIMESTAMP = 0x1d @@ -3072,7 +3108,7 @@ const ( TASKSTATS_GENL_NAME = "TASKSTATS" TASKSTATS_GENL_VERSION = 0x1 TASKSTATS_TYPE_MAX = 0x6 - TASKSTATS_VERSION = 0xd + TASKSTATS_VERSION = 0xe TCIFLUSH = 0x0 TCIOFF = 0x2 TCIOFLUSH = 0x2 @@ -3238,6 +3274,7 @@ const ( TP_STATUS_COPY = 0x2 TP_STATUS_CSUMNOTREADY = 0x8 TP_STATUS_CSUM_VALID = 0x80 + TP_STATUS_GSO_TCP = 0x100 TP_STATUS_KERNEL = 0x0 TP_STATUS_LOSING = 0x4 TP_STATUS_SENDING = 0x2 diff --git a/vendor/golang.org/x/sys/unix/zerrors_linux_386.go b/vendor/golang.org/x/sys/unix/zerrors_linux_386.go index a46df0f1..cfb14300 100644 --- a/vendor/golang.org/x/sys/unix/zerrors_linux_386.go +++ b/vendor/golang.org/x/sys/unix/zerrors_linux_386.go @@ -27,22 +27,31 @@ const ( B57600 = 0x1001 B576000 = 0x1006 B921600 = 0x1007 + BLKALIGNOFF = 0x127a BLKBSZGET = 0x80041270 BLKBSZSET = 0x40041271 + BLKDISCARD = 0x1277 + BLKDISCARDZEROES = 0x127c BLKFLSBUF = 0x1261 BLKFRAGET = 0x1265 BLKFRASET = 0x1264 + BLKGETDISKSEQ = 0x80081280 BLKGETSIZE = 0x1260 BLKGETSIZE64 = 0x80041272 + BLKIOMIN = 0x1278 + BLKIOOPT = 0x1279 BLKPBSZGET = 0x127b BLKRAGET = 0x1263 BLKRASET = 0x1262 BLKROGET = 0x125e BLKROSET = 0x125d + BLKROTATIONAL = 0x127e BLKRRPART = 0x125f + BLKSECDISCARD = 0x127d BLKSECTGET = 0x1267 BLKSECTSET = 0x1266 BLKSSZGET = 0x1268 + BLKZEROOUT = 0x127f BOTHER = 0x1000 BS1 = 0x2000 BSDLY = 0x2000 diff --git a/vendor/golang.org/x/sys/unix/zerrors_linux_amd64.go b/vendor/golang.org/x/sys/unix/zerrors_linux_amd64.go index 6cd4a3ea..df64f2d5 100644 --- a/vendor/golang.org/x/sys/unix/zerrors_linux_amd64.go +++ b/vendor/golang.org/x/sys/unix/zerrors_linux_amd64.go @@ -27,22 +27,31 @@ const ( B57600 = 0x1001 B576000 = 0x1006 B921600 = 0x1007 + BLKALIGNOFF = 0x127a BLKBSZGET = 0x80081270 BLKBSZSET = 0x40081271 + BLKDISCARD = 0x1277 + BLKDISCARDZEROES = 0x127c BLKFLSBUF = 0x1261 BLKFRAGET = 0x1265 BLKFRASET = 0x1264 + BLKGETDISKSEQ = 0x80081280 BLKGETSIZE = 0x1260 BLKGETSIZE64 = 0x80081272 + BLKIOMIN = 0x1278 + BLKIOOPT = 0x1279 BLKPBSZGET = 0x127b BLKRAGET = 0x1263 BLKRASET = 0x1262 BLKROGET = 0x125e BLKROSET = 0x125d + BLKROTATIONAL = 0x127e BLKRRPART = 0x125f + BLKSECDISCARD = 0x127d BLKSECTGET = 0x1267 BLKSECTSET = 0x1266 BLKSSZGET = 0x1268 + BLKZEROOUT = 0x127f BOTHER = 0x1000 BS1 = 0x2000 BSDLY = 0x2000 diff --git a/vendor/golang.org/x/sys/unix/zerrors_linux_arm.go b/vendor/golang.org/x/sys/unix/zerrors_linux_arm.go index c7ebee24..3025cd5b 100644 --- a/vendor/golang.org/x/sys/unix/zerrors_linux_arm.go +++ b/vendor/golang.org/x/sys/unix/zerrors_linux_arm.go @@ -27,22 +27,31 @@ const ( B57600 = 0x1001 B576000 = 0x1006 B921600 = 0x1007 + BLKALIGNOFF = 0x127a BLKBSZGET = 0x80041270 BLKBSZSET = 0x40041271 + BLKDISCARD = 0x1277 + BLKDISCARDZEROES = 0x127c BLKFLSBUF = 0x1261 BLKFRAGET = 0x1265 BLKFRASET = 0x1264 + BLKGETDISKSEQ = 0x80081280 BLKGETSIZE = 0x1260 BLKGETSIZE64 = 0x80041272 + BLKIOMIN = 0x1278 + BLKIOOPT = 0x1279 BLKPBSZGET = 0x127b BLKRAGET = 0x1263 BLKRASET = 0x1262 BLKROGET = 0x125e BLKROSET = 0x125d + BLKROTATIONAL = 0x127e BLKRRPART = 0x125f + BLKSECDISCARD = 0x127d BLKSECTGET = 0x1267 BLKSECTSET = 0x1266 BLKSSZGET = 0x1268 + BLKZEROOUT = 0x127f BOTHER = 0x1000 BS1 = 0x2000 BSDLY = 0x2000 diff --git a/vendor/golang.org/x/sys/unix/zerrors_linux_arm64.go b/vendor/golang.org/x/sys/unix/zerrors_linux_arm64.go index 9d5352c3..09e1ffbe 100644 --- a/vendor/golang.org/x/sys/unix/zerrors_linux_arm64.go +++ b/vendor/golang.org/x/sys/unix/zerrors_linux_arm64.go @@ -27,22 +27,31 @@ const ( B57600 = 0x1001 B576000 = 0x1006 B921600 = 0x1007 + BLKALIGNOFF = 0x127a BLKBSZGET = 0x80081270 BLKBSZSET = 0x40081271 + BLKDISCARD = 0x1277 + BLKDISCARDZEROES = 0x127c BLKFLSBUF = 0x1261 BLKFRAGET = 0x1265 BLKFRASET = 0x1264 + BLKGETDISKSEQ = 0x80081280 BLKGETSIZE = 0x1260 BLKGETSIZE64 = 0x80081272 + BLKIOMIN = 0x1278 + BLKIOOPT = 0x1279 BLKPBSZGET = 0x127b BLKRAGET = 0x1263 BLKRASET = 0x1262 BLKROGET = 0x125e BLKROSET = 0x125d + BLKROTATIONAL = 0x127e BLKRRPART = 0x125f + BLKSECDISCARD = 0x127d BLKSECTGET = 0x1267 BLKSECTSET = 0x1266 BLKSSZGET = 0x1268 + BLKZEROOUT = 0x127f BOTHER = 0x1000 BS1 = 0x2000 BSDLY = 0x2000 @@ -443,6 +452,7 @@ const ( TIOCSWINSZ = 0x5414 TIOCVHANGUP = 0x5437 TOSTOP = 0x100 + TPIDR2_MAGIC = 0x54504902 TUNATTACHFILTER = 0x401054d5 TUNDETACHFILTER = 0x401054d6 TUNGETDEVNETNS = 0x54e3 @@ -515,6 +525,7 @@ const ( XCASE = 0x4 XTABS = 0x1800 ZA_MAGIC = 0x54366345 + ZT_MAGIC = 0x5a544e01 _HIDIOCGRAWNAME = 0x80804804 _HIDIOCGRAWPHYS = 0x80404805 _HIDIOCGRAWUNIQ = 0x80404808 diff --git a/vendor/golang.org/x/sys/unix/zerrors_linux_loong64.go b/vendor/golang.org/x/sys/unix/zerrors_linux_loong64.go index f26a164f..a4572354 100644 --- a/vendor/golang.org/x/sys/unix/zerrors_linux_loong64.go +++ b/vendor/golang.org/x/sys/unix/zerrors_linux_loong64.go @@ -27,22 +27,31 @@ const ( B57600 = 0x1001 B576000 = 0x1006 B921600 = 0x1007 + BLKALIGNOFF = 0x127a BLKBSZGET = 0x80081270 BLKBSZSET = 0x40081271 + BLKDISCARD = 0x1277 + BLKDISCARDZEROES = 0x127c BLKFLSBUF = 0x1261 BLKFRAGET = 0x1265 BLKFRASET = 0x1264 + BLKGETDISKSEQ = 0x80081280 BLKGETSIZE = 0x1260 BLKGETSIZE64 = 0x80081272 + BLKIOMIN = 0x1278 + BLKIOOPT = 0x1279 BLKPBSZGET = 0x127b BLKRAGET = 0x1263 BLKRASET = 0x1262 BLKROGET = 0x125e BLKROSET = 0x125d + BLKROTATIONAL = 0x127e BLKRRPART = 0x125f + BLKSECDISCARD = 0x127d BLKSECTGET = 0x1267 BLKSECTSET = 0x1266 BLKSSZGET = 0x1268 + BLKZEROOUT = 0x127f BOTHER = 0x1000 BS1 = 0x2000 BSDLY = 0x2000 diff --git a/vendor/golang.org/x/sys/unix/zerrors_linux_mips.go b/vendor/golang.org/x/sys/unix/zerrors_linux_mips.go index 890bc3c9..fee7dfb8 100644 --- a/vendor/golang.org/x/sys/unix/zerrors_linux_mips.go +++ b/vendor/golang.org/x/sys/unix/zerrors_linux_mips.go @@ -27,22 +27,31 @@ const ( B57600 = 0x1001 B576000 = 0x1006 B921600 = 0x1007 + BLKALIGNOFF = 0x2000127a BLKBSZGET = 0x40041270 BLKBSZSET = 0x80041271 + BLKDISCARD = 0x20001277 + BLKDISCARDZEROES = 0x2000127c BLKFLSBUF = 0x20001261 BLKFRAGET = 0x20001265 BLKFRASET = 0x20001264 + BLKGETDISKSEQ = 0x40081280 BLKGETSIZE = 0x20001260 BLKGETSIZE64 = 0x40041272 + BLKIOMIN = 0x20001278 + BLKIOOPT = 0x20001279 BLKPBSZGET = 0x2000127b BLKRAGET = 0x20001263 BLKRASET = 0x20001262 BLKROGET = 0x2000125e BLKROSET = 0x2000125d + BLKROTATIONAL = 0x2000127e BLKRRPART = 0x2000125f + BLKSECDISCARD = 0x2000127d BLKSECTGET = 0x20001267 BLKSECTSET = 0x20001266 BLKSSZGET = 0x20001268 + BLKZEROOUT = 0x2000127f BOTHER = 0x1000 BS1 = 0x2000 BSDLY = 0x2000 diff --git a/vendor/golang.org/x/sys/unix/zerrors_linux_mips64.go b/vendor/golang.org/x/sys/unix/zerrors_linux_mips64.go index 549f26ac..a5b2373a 100644 --- a/vendor/golang.org/x/sys/unix/zerrors_linux_mips64.go +++ b/vendor/golang.org/x/sys/unix/zerrors_linux_mips64.go @@ -27,22 +27,31 @@ const ( B57600 = 0x1001 B576000 = 0x1006 B921600 = 0x1007 + BLKALIGNOFF = 0x2000127a BLKBSZGET = 0x40081270 BLKBSZSET = 0x80081271 + BLKDISCARD = 0x20001277 + BLKDISCARDZEROES = 0x2000127c BLKFLSBUF = 0x20001261 BLKFRAGET = 0x20001265 BLKFRASET = 0x20001264 + BLKGETDISKSEQ = 0x40081280 BLKGETSIZE = 0x20001260 BLKGETSIZE64 = 0x40081272 + BLKIOMIN = 0x20001278 + BLKIOOPT = 0x20001279 BLKPBSZGET = 0x2000127b BLKRAGET = 0x20001263 BLKRASET = 0x20001262 BLKROGET = 0x2000125e BLKROSET = 0x2000125d + BLKROTATIONAL = 0x2000127e BLKRRPART = 0x2000125f + BLKSECDISCARD = 0x2000127d BLKSECTGET = 0x20001267 BLKSECTSET = 0x20001266 BLKSSZGET = 0x20001268 + BLKZEROOUT = 0x2000127f BOTHER = 0x1000 BS1 = 0x2000 BSDLY = 0x2000 diff --git a/vendor/golang.org/x/sys/unix/zerrors_linux_mips64le.go b/vendor/golang.org/x/sys/unix/zerrors_linux_mips64le.go index e0365e32..5dde82c9 100644 --- a/vendor/golang.org/x/sys/unix/zerrors_linux_mips64le.go +++ b/vendor/golang.org/x/sys/unix/zerrors_linux_mips64le.go @@ -27,22 +27,31 @@ const ( B57600 = 0x1001 B576000 = 0x1006 B921600 = 0x1007 + BLKALIGNOFF = 0x2000127a BLKBSZGET = 0x40081270 BLKBSZSET = 0x80081271 + BLKDISCARD = 0x20001277 + BLKDISCARDZEROES = 0x2000127c BLKFLSBUF = 0x20001261 BLKFRAGET = 0x20001265 BLKFRASET = 0x20001264 + BLKGETDISKSEQ = 0x40081280 BLKGETSIZE = 0x20001260 BLKGETSIZE64 = 0x40081272 + BLKIOMIN = 0x20001278 + BLKIOOPT = 0x20001279 BLKPBSZGET = 0x2000127b BLKRAGET = 0x20001263 BLKRASET = 0x20001262 BLKROGET = 0x2000125e BLKROSET = 0x2000125d + BLKROTATIONAL = 0x2000127e BLKRRPART = 0x2000125f + BLKSECDISCARD = 0x2000127d BLKSECTGET = 0x20001267 BLKSECTSET = 0x20001266 BLKSSZGET = 0x20001268 + BLKZEROOUT = 0x2000127f BOTHER = 0x1000 BS1 = 0x2000 BSDLY = 0x2000 diff --git a/vendor/golang.org/x/sys/unix/zerrors_linux_mipsle.go b/vendor/golang.org/x/sys/unix/zerrors_linux_mipsle.go index fdccce15..2e80ea6b 100644 --- a/vendor/golang.org/x/sys/unix/zerrors_linux_mipsle.go +++ b/vendor/golang.org/x/sys/unix/zerrors_linux_mipsle.go @@ -27,22 +27,31 @@ const ( B57600 = 0x1001 B576000 = 0x1006 B921600 = 0x1007 + BLKALIGNOFF = 0x2000127a BLKBSZGET = 0x40041270 BLKBSZSET = 0x80041271 + BLKDISCARD = 0x20001277 + BLKDISCARDZEROES = 0x2000127c BLKFLSBUF = 0x20001261 BLKFRAGET = 0x20001265 BLKFRASET = 0x20001264 + BLKGETDISKSEQ = 0x40081280 BLKGETSIZE = 0x20001260 BLKGETSIZE64 = 0x40041272 + BLKIOMIN = 0x20001278 + BLKIOOPT = 0x20001279 BLKPBSZGET = 0x2000127b BLKRAGET = 0x20001263 BLKRASET = 0x20001262 BLKROGET = 0x2000125e BLKROSET = 0x2000125d + BLKROTATIONAL = 0x2000127e BLKRRPART = 0x2000125f + BLKSECDISCARD = 0x2000127d BLKSECTGET = 0x20001267 BLKSECTSET = 0x20001266 BLKSSZGET = 0x20001268 + BLKZEROOUT = 0x2000127f BOTHER = 0x1000 BS1 = 0x2000 BSDLY = 0x2000 diff --git a/vendor/golang.org/x/sys/unix/zerrors_linux_ppc.go b/vendor/golang.org/x/sys/unix/zerrors_linux_ppc.go index b2205c83..a65dcd7c 100644 --- a/vendor/golang.org/x/sys/unix/zerrors_linux_ppc.go +++ b/vendor/golang.org/x/sys/unix/zerrors_linux_ppc.go @@ -27,22 +27,31 @@ const ( B57600 = 0x10 B576000 = 0x15 B921600 = 0x16 + BLKALIGNOFF = 0x2000127a BLKBSZGET = 0x40041270 BLKBSZSET = 0x80041271 + BLKDISCARD = 0x20001277 + BLKDISCARDZEROES = 0x2000127c BLKFLSBUF = 0x20001261 BLKFRAGET = 0x20001265 BLKFRASET = 0x20001264 + BLKGETDISKSEQ = 0x40081280 BLKGETSIZE = 0x20001260 BLKGETSIZE64 = 0x40041272 + BLKIOMIN = 0x20001278 + BLKIOOPT = 0x20001279 BLKPBSZGET = 0x2000127b BLKRAGET = 0x20001263 BLKRASET = 0x20001262 BLKROGET = 0x2000125e BLKROSET = 0x2000125d + BLKROTATIONAL = 0x2000127e BLKRRPART = 0x2000125f + BLKSECDISCARD = 0x2000127d BLKSECTGET = 0x20001267 BLKSECTSET = 0x20001266 BLKSSZGET = 0x20001268 + BLKZEROOUT = 0x2000127f BOTHER = 0x1f BS1 = 0x8000 BSDLY = 0x8000 diff --git a/vendor/golang.org/x/sys/unix/zerrors_linux_ppc64.go b/vendor/golang.org/x/sys/unix/zerrors_linux_ppc64.go index 81aa5ad0..cbd34e3d 100644 --- a/vendor/golang.org/x/sys/unix/zerrors_linux_ppc64.go +++ b/vendor/golang.org/x/sys/unix/zerrors_linux_ppc64.go @@ -27,22 +27,31 @@ const ( B57600 = 0x10 B576000 = 0x15 B921600 = 0x16 + BLKALIGNOFF = 0x2000127a BLKBSZGET = 0x40081270 BLKBSZSET = 0x80081271 + BLKDISCARD = 0x20001277 + BLKDISCARDZEROES = 0x2000127c BLKFLSBUF = 0x20001261 BLKFRAGET = 0x20001265 BLKFRASET = 0x20001264 + BLKGETDISKSEQ = 0x40081280 BLKGETSIZE = 0x20001260 BLKGETSIZE64 = 0x40081272 + BLKIOMIN = 0x20001278 + BLKIOOPT = 0x20001279 BLKPBSZGET = 0x2000127b BLKRAGET = 0x20001263 BLKRASET = 0x20001262 BLKROGET = 0x2000125e BLKROSET = 0x2000125d + BLKROTATIONAL = 0x2000127e BLKRRPART = 0x2000125f + BLKSECDISCARD = 0x2000127d BLKSECTGET = 0x20001267 BLKSECTSET = 0x20001266 BLKSSZGET = 0x20001268 + BLKZEROOUT = 0x2000127f BOTHER = 0x1f BS1 = 0x8000 BSDLY = 0x8000 diff --git a/vendor/golang.org/x/sys/unix/zerrors_linux_ppc64le.go b/vendor/golang.org/x/sys/unix/zerrors_linux_ppc64le.go index 76807a1f..e4afa7a3 100644 --- a/vendor/golang.org/x/sys/unix/zerrors_linux_ppc64le.go +++ b/vendor/golang.org/x/sys/unix/zerrors_linux_ppc64le.go @@ -27,22 +27,31 @@ const ( B57600 = 0x10 B576000 = 0x15 B921600 = 0x16 + BLKALIGNOFF = 0x2000127a BLKBSZGET = 0x40081270 BLKBSZSET = 0x80081271 + BLKDISCARD = 0x20001277 + BLKDISCARDZEROES = 0x2000127c BLKFLSBUF = 0x20001261 BLKFRAGET = 0x20001265 BLKFRASET = 0x20001264 + BLKGETDISKSEQ = 0x40081280 BLKGETSIZE = 0x20001260 BLKGETSIZE64 = 0x40081272 + BLKIOMIN = 0x20001278 + BLKIOOPT = 0x20001279 BLKPBSZGET = 0x2000127b BLKRAGET = 0x20001263 BLKRASET = 0x20001262 BLKROGET = 0x2000125e BLKROSET = 0x2000125d + BLKROTATIONAL = 0x2000127e BLKRRPART = 0x2000125f + BLKSECDISCARD = 0x2000127d BLKSECTGET = 0x20001267 BLKSECTSET = 0x20001266 BLKSSZGET = 0x20001268 + BLKZEROOUT = 0x2000127f BOTHER = 0x1f BS1 = 0x8000 BSDLY = 0x8000 diff --git a/vendor/golang.org/x/sys/unix/zerrors_linux_riscv64.go b/vendor/golang.org/x/sys/unix/zerrors_linux_riscv64.go index d4a5ab9e..44f45a03 100644 --- a/vendor/golang.org/x/sys/unix/zerrors_linux_riscv64.go +++ b/vendor/golang.org/x/sys/unix/zerrors_linux_riscv64.go @@ -27,22 +27,31 @@ const ( B57600 = 0x1001 B576000 = 0x1006 B921600 = 0x1007 + BLKALIGNOFF = 0x127a BLKBSZGET = 0x80081270 BLKBSZSET = 0x40081271 + BLKDISCARD = 0x1277 + BLKDISCARDZEROES = 0x127c BLKFLSBUF = 0x1261 BLKFRAGET = 0x1265 BLKFRASET = 0x1264 + BLKGETDISKSEQ = 0x80081280 BLKGETSIZE = 0x1260 BLKGETSIZE64 = 0x80081272 + BLKIOMIN = 0x1278 + BLKIOOPT = 0x1279 BLKPBSZGET = 0x127b BLKRAGET = 0x1263 BLKRASET = 0x1262 BLKROGET = 0x125e BLKROSET = 0x125d + BLKROTATIONAL = 0x127e BLKRRPART = 0x125f + BLKSECDISCARD = 0x127d BLKSECTGET = 0x1267 BLKSECTSET = 0x1266 BLKSSZGET = 0x1268 + BLKZEROOUT = 0x127f BOTHER = 0x1000 BS1 = 0x2000 BSDLY = 0x2000 diff --git a/vendor/golang.org/x/sys/unix/zerrors_linux_s390x.go b/vendor/golang.org/x/sys/unix/zerrors_linux_s390x.go index 66e65db9..74733e26 100644 --- a/vendor/golang.org/x/sys/unix/zerrors_linux_s390x.go +++ b/vendor/golang.org/x/sys/unix/zerrors_linux_s390x.go @@ -27,22 +27,31 @@ const ( B57600 = 0x1001 B576000 = 0x1006 B921600 = 0x1007 + BLKALIGNOFF = 0x127a BLKBSZGET = 0x80081270 BLKBSZSET = 0x40081271 + BLKDISCARD = 0x1277 + BLKDISCARDZEROES = 0x127c BLKFLSBUF = 0x1261 BLKFRAGET = 0x1265 BLKFRASET = 0x1264 + BLKGETDISKSEQ = 0x80081280 BLKGETSIZE = 0x1260 BLKGETSIZE64 = 0x80081272 + BLKIOMIN = 0x1278 + BLKIOOPT = 0x1279 BLKPBSZGET = 0x127b BLKRAGET = 0x1263 BLKRASET = 0x1262 BLKROGET = 0x125e BLKROSET = 0x125d + BLKROTATIONAL = 0x127e BLKRRPART = 0x125f + BLKSECDISCARD = 0x127d BLKSECTGET = 0x1267 BLKSECTSET = 0x1266 BLKSSZGET = 0x1268 + BLKZEROOUT = 0x127f BOTHER = 0x1000 BS1 = 0x2000 BSDLY = 0x2000 diff --git a/vendor/golang.org/x/sys/unix/zerrors_linux_sparc64.go b/vendor/golang.org/x/sys/unix/zerrors_linux_sparc64.go index f6192526..f5f3934b 100644 --- a/vendor/golang.org/x/sys/unix/zerrors_linux_sparc64.go +++ b/vendor/golang.org/x/sys/unix/zerrors_linux_sparc64.go @@ -30,22 +30,31 @@ const ( B57600 = 0x1001 B576000 = 0x1006 B921600 = 0x1007 + BLKALIGNOFF = 0x2000127a BLKBSZGET = 0x40081270 BLKBSZSET = 0x80081271 + BLKDISCARD = 0x20001277 + BLKDISCARDZEROES = 0x2000127c BLKFLSBUF = 0x20001261 BLKFRAGET = 0x20001265 BLKFRASET = 0x20001264 + BLKGETDISKSEQ = 0x40081280 BLKGETSIZE = 0x20001260 BLKGETSIZE64 = 0x40081272 + BLKIOMIN = 0x20001278 + BLKIOOPT = 0x20001279 BLKPBSZGET = 0x2000127b BLKRAGET = 0x20001263 BLKRASET = 0x20001262 BLKROGET = 0x2000125e BLKROSET = 0x2000125d + BLKROTATIONAL = 0x2000127e BLKRRPART = 0x2000125f + BLKSECDISCARD = 0x2000127d BLKSECTGET = 0x20001267 BLKSECTSET = 0x20001266 BLKSSZGET = 0x20001268 + BLKZEROOUT = 0x2000127f BOTHER = 0x1000 BS1 = 0x2000 BSDLY = 0x2000 @@ -329,6 +338,54 @@ const ( SCM_WIFI_STATUS = 0x25 SFD_CLOEXEC = 0x400000 SFD_NONBLOCK = 0x4000 + SF_FP = 0x38 + SF_I0 = 0x20 + SF_I1 = 0x24 + SF_I2 = 0x28 + SF_I3 = 0x2c + SF_I4 = 0x30 + SF_I5 = 0x34 + SF_L0 = 0x0 + SF_L1 = 0x4 + SF_L2 = 0x8 + SF_L3 = 0xc + SF_L4 = 0x10 + SF_L5 = 0x14 + SF_L6 = 0x18 + SF_L7 = 0x1c + SF_PC = 0x3c + SF_RETP = 0x40 + SF_V9_FP = 0x70 + SF_V9_I0 = 0x40 + SF_V9_I1 = 0x48 + SF_V9_I2 = 0x50 + SF_V9_I3 = 0x58 + SF_V9_I4 = 0x60 + SF_V9_I5 = 0x68 + SF_V9_L0 = 0x0 + SF_V9_L1 = 0x8 + SF_V9_L2 = 0x10 + SF_V9_L3 = 0x18 + SF_V9_L4 = 0x20 + SF_V9_L5 = 0x28 + SF_V9_L6 = 0x30 + SF_V9_L7 = 0x38 + SF_V9_PC = 0x78 + SF_V9_RETP = 0x80 + SF_V9_XARG0 = 0x88 + SF_V9_XARG1 = 0x90 + SF_V9_XARG2 = 0x98 + SF_V9_XARG3 = 0xa0 + SF_V9_XARG4 = 0xa8 + SF_V9_XARG5 = 0xb0 + SF_V9_XXARG = 0xb8 + SF_XARG0 = 0x44 + SF_XARG1 = 0x48 + SF_XARG2 = 0x4c + SF_XARG3 = 0x50 + SF_XARG4 = 0x54 + SF_XARG5 = 0x58 + SF_XXARG = 0x5c SIOCATMARK = 0x8905 SIOCGPGRP = 0x8904 SIOCGSTAMPNS_NEW = 0x40108907 diff --git a/vendor/golang.org/x/sys/unix/zsyscall_linux.go b/vendor/golang.org/x/sys/unix/zsyscall_linux.go index da63d9d7..14ab34a5 100644 --- a/vendor/golang.org/x/sys/unix/zsyscall_linux.go +++ b/vendor/golang.org/x/sys/unix/zsyscall_linux.go @@ -1356,7 +1356,7 @@ func Prctl(option int, arg2 uintptr, arg3 uintptr, arg4 uintptr, arg5 uintptr) ( // THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT -func Pselect(nfd int, r *FdSet, w *FdSet, e *FdSet, timeout *Timespec, sigmask *Sigset_t) (n int, err error) { +func pselect6(nfd int, r *FdSet, w *FdSet, e *FdSet, timeout *Timespec, sigmask *sigset_argpack) (n int, err error) { r0, _, e1 := Syscall6(SYS_PSELECT6, uintptr(nfd), uintptr(unsafe.Pointer(r)), uintptr(unsafe.Pointer(w)), uintptr(unsafe.Pointer(e)), uintptr(unsafe.Pointer(timeout)), uintptr(unsafe.Pointer(sigmask))) n = int(r0) if e1 != 0 { @@ -1868,6 +1868,17 @@ func munmap(addr uintptr, length uintptr) (err error) { // THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT +func mremap(oldaddr uintptr, oldlength uintptr, newlength uintptr, flags int, newaddr uintptr) (xaddr uintptr, err error) { + r0, _, e1 := Syscall6(SYS_MREMAP, uintptr(oldaddr), uintptr(oldlength), uintptr(newlength), uintptr(flags), uintptr(newaddr), 0) + xaddr = uintptr(r0) + if e1 != 0 { + err = errnoErr(e1) + } + return +} + +// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT + func Madvise(b []byte, advice int) (err error) { var _p0 unsafe.Pointer if len(b) > 0 { @@ -2172,3 +2183,37 @@ func rtSigprocmask(how int, set *Sigset_t, oldset *Sigset_t, sigsetsize uintptr) } return } + +// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT + +func getresuid(ruid *_C_int, euid *_C_int, suid *_C_int) { + RawSyscallNoError(SYS_GETRESUID, uintptr(unsafe.Pointer(ruid)), uintptr(unsafe.Pointer(euid)), uintptr(unsafe.Pointer(suid))) + return +} + +// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT + +func getresgid(rgid *_C_int, egid *_C_int, sgid *_C_int) { + RawSyscallNoError(SYS_GETRESGID, uintptr(unsafe.Pointer(rgid)), uintptr(unsafe.Pointer(egid)), uintptr(unsafe.Pointer(sgid))) + return +} + +// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT + +func schedSetattr(pid int, attr *SchedAttr, flags uint) (err error) { + _, _, e1 := Syscall(SYS_SCHED_SETATTR, uintptr(pid), uintptr(unsafe.Pointer(attr)), uintptr(flags)) + if e1 != 0 { + err = errnoErr(e1) + } + return +} + +// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT + +func schedGetattr(pid int, attr *SchedAttr, size uint, flags uint) (err error) { + _, _, e1 := Syscall6(SYS_SCHED_GETATTR, uintptr(pid), uintptr(unsafe.Pointer(attr)), uintptr(size), uintptr(flags), 0, 0) + if e1 != 0 { + err = errnoErr(e1) + } + return +} diff --git a/vendor/golang.org/x/sys/unix/zsyscall_linux_riscv64.go b/vendor/golang.org/x/sys/unix/zsyscall_linux_riscv64.go index 0b292395..0ab4f2ed 100644 --- a/vendor/golang.org/x/sys/unix/zsyscall_linux_riscv64.go +++ b/vendor/golang.org/x/sys/unix/zsyscall_linux_riscv64.go @@ -531,3 +531,19 @@ func kexecFileLoad(kernelFd int, initrdFd int, cmdlineLen int, cmdline string, f } return } + +// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT + +func riscvHWProbe(pairs []RISCVHWProbePairs, cpuCount uintptr, cpus *CPUSet, flags uint) (err error) { + var _p0 unsafe.Pointer + if len(pairs) > 0 { + _p0 = unsafe.Pointer(&pairs[0]) + } else { + _p0 = unsafe.Pointer(&_zero) + } + _, _, e1 := Syscall6(SYS_RISCV_HWPROBE, uintptr(_p0), uintptr(len(pairs)), uintptr(cpuCount), uintptr(unsafe.Pointer(cpus)), uintptr(flags), 0) + if e1 != 0 { + err = errnoErr(e1) + } + return +} diff --git a/vendor/golang.org/x/sys/unix/zsyscall_netbsd_386.go b/vendor/golang.org/x/sys/unix/zsyscall_netbsd_386.go index cdb2af5a..35f499b3 100644 --- a/vendor/golang.org/x/sys/unix/zsyscall_netbsd_386.go +++ b/vendor/golang.org/x/sys/unix/zsyscall_netbsd_386.go @@ -1858,3 +1858,14 @@ func utimensat(dirfd int, path string, times *[2]Timespec, flags int) (err error } return } + +// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT + +func mremapNetBSD(oldp uintptr, oldsize uintptr, newp uintptr, newsize uintptr, flags int) (xaddr uintptr, err error) { + r0, _, e1 := Syscall6(SYS_MREMAP, uintptr(oldp), uintptr(oldsize), uintptr(newp), uintptr(newsize), uintptr(flags), 0) + xaddr = uintptr(r0) + if e1 != 0 { + err = errnoErr(e1) + } + return +} diff --git a/vendor/golang.org/x/sys/unix/zsyscall_netbsd_amd64.go b/vendor/golang.org/x/sys/unix/zsyscall_netbsd_amd64.go index 9d25f76b..3cda65b0 100644 --- a/vendor/golang.org/x/sys/unix/zsyscall_netbsd_amd64.go +++ b/vendor/golang.org/x/sys/unix/zsyscall_netbsd_amd64.go @@ -1858,3 +1858,14 @@ func utimensat(dirfd int, path string, times *[2]Timespec, flags int) (err error } return } + +// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT + +func mremapNetBSD(oldp uintptr, oldsize uintptr, newp uintptr, newsize uintptr, flags int) (xaddr uintptr, err error) { + r0, _, e1 := Syscall6(SYS_MREMAP, uintptr(oldp), uintptr(oldsize), uintptr(newp), uintptr(newsize), uintptr(flags), 0) + xaddr = uintptr(r0) + if e1 != 0 { + err = errnoErr(e1) + } + return +} diff --git a/vendor/golang.org/x/sys/unix/zsyscall_netbsd_arm.go b/vendor/golang.org/x/sys/unix/zsyscall_netbsd_arm.go index d3f80351..1e1fea90 100644 --- a/vendor/golang.org/x/sys/unix/zsyscall_netbsd_arm.go +++ b/vendor/golang.org/x/sys/unix/zsyscall_netbsd_arm.go @@ -1858,3 +1858,14 @@ func utimensat(dirfd int, path string, times *[2]Timespec, flags int) (err error } return } + +// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT + +func mremapNetBSD(oldp uintptr, oldsize uintptr, newp uintptr, newsize uintptr, flags int) (xaddr uintptr, err error) { + r0, _, e1 := Syscall6(SYS_MREMAP, uintptr(oldp), uintptr(oldsize), uintptr(newp), uintptr(newsize), uintptr(flags), 0) + xaddr = uintptr(r0) + if e1 != 0 { + err = errnoErr(e1) + } + return +} diff --git a/vendor/golang.org/x/sys/unix/zsyscall_netbsd_arm64.go b/vendor/golang.org/x/sys/unix/zsyscall_netbsd_arm64.go index 887188a5..3b77da11 100644 --- a/vendor/golang.org/x/sys/unix/zsyscall_netbsd_arm64.go +++ b/vendor/golang.org/x/sys/unix/zsyscall_netbsd_arm64.go @@ -1858,3 +1858,14 @@ func utimensat(dirfd int, path string, times *[2]Timespec, flags int) (err error } return } + +// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT + +func mremapNetBSD(oldp uintptr, oldsize uintptr, newp uintptr, newsize uintptr, flags int) (xaddr uintptr, err error) { + r0, _, e1 := Syscall6(SYS_MREMAP, uintptr(oldp), uintptr(oldsize), uintptr(newp), uintptr(newsize), uintptr(flags), 0) + xaddr = uintptr(r0) + if e1 != 0 { + err = errnoErr(e1) + } + return +} diff --git a/vendor/golang.org/x/sys/unix/zsyscall_openbsd_386.go b/vendor/golang.org/x/sys/unix/zsyscall_openbsd_386.go index 6699a783..9ab9abf7 100644 --- a/vendor/golang.org/x/sys/unix/zsyscall_openbsd_386.go +++ b/vendor/golang.org/x/sys/unix/zsyscall_openbsd_386.go @@ -519,6 +519,28 @@ var libc_getcwd_trampoline_addr uintptr // THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT +func getresuid(ruid *_C_int, euid *_C_int, suid *_C_int) { + syscall_rawSyscall(libc_getresuid_trampoline_addr, uintptr(unsafe.Pointer(ruid)), uintptr(unsafe.Pointer(euid)), uintptr(unsafe.Pointer(suid))) + return +} + +var libc_getresuid_trampoline_addr uintptr + +//go:cgo_import_dynamic libc_getresuid getresuid "libc.so" + +// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT + +func getresgid(rgid *_C_int, egid *_C_int, sgid *_C_int) { + syscall_rawSyscall(libc_getresgid_trampoline_addr, uintptr(unsafe.Pointer(rgid)), uintptr(unsafe.Pointer(egid)), uintptr(unsafe.Pointer(sgid))) + return +} + +var libc_getresgid_trampoline_addr uintptr + +//go:cgo_import_dynamic libc_getresgid getresgid "libc.so" + +// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT + func ioctl(fd int, req uint, arg uintptr) (err error) { _, _, e1 := syscall_syscall(libc_ioctl_trampoline_addr, uintptr(fd), uintptr(req), uintptr(arg)) if e1 != 0 { diff --git a/vendor/golang.org/x/sys/unix/zsyscall_openbsd_386.s b/vendor/golang.org/x/sys/unix/zsyscall_openbsd_386.s index 04f0de34..3dcacd30 100644 --- a/vendor/golang.org/x/sys/unix/zsyscall_openbsd_386.s +++ b/vendor/golang.org/x/sys/unix/zsyscall_openbsd_386.s @@ -158,6 +158,16 @@ TEXT libc_getcwd_trampoline<>(SB),NOSPLIT,$0-0 GLOBL ·libc_getcwd_trampoline_addr(SB), RODATA, $4 DATA ·libc_getcwd_trampoline_addr(SB)/4, $libc_getcwd_trampoline<>(SB) +TEXT libc_getresuid_trampoline<>(SB),NOSPLIT,$0-0 + JMP libc_getresuid(SB) +GLOBL ·libc_getresuid_trampoline_addr(SB), RODATA, $4 +DATA ·libc_getresuid_trampoline_addr(SB)/4, $libc_getresuid_trampoline<>(SB) + +TEXT libc_getresgid_trampoline<>(SB),NOSPLIT,$0-0 + JMP libc_getresgid(SB) +GLOBL ·libc_getresgid_trampoline_addr(SB), RODATA, $4 +DATA ·libc_getresgid_trampoline_addr(SB)/4, $libc_getresgid_trampoline<>(SB) + TEXT libc_ioctl_trampoline<>(SB),NOSPLIT,$0-0 JMP libc_ioctl(SB) GLOBL ·libc_ioctl_trampoline_addr(SB), RODATA, $4 diff --git a/vendor/golang.org/x/sys/unix/zsyscall_openbsd_amd64.go b/vendor/golang.org/x/sys/unix/zsyscall_openbsd_amd64.go index 1e775fe0..915761ea 100644 --- a/vendor/golang.org/x/sys/unix/zsyscall_openbsd_amd64.go +++ b/vendor/golang.org/x/sys/unix/zsyscall_openbsd_amd64.go @@ -519,6 +519,28 @@ var libc_getcwd_trampoline_addr uintptr // THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT +func getresuid(ruid *_C_int, euid *_C_int, suid *_C_int) { + syscall_rawSyscall(libc_getresuid_trampoline_addr, uintptr(unsafe.Pointer(ruid)), uintptr(unsafe.Pointer(euid)), uintptr(unsafe.Pointer(suid))) + return +} + +var libc_getresuid_trampoline_addr uintptr + +//go:cgo_import_dynamic libc_getresuid getresuid "libc.so" + +// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT + +func getresgid(rgid *_C_int, egid *_C_int, sgid *_C_int) { + syscall_rawSyscall(libc_getresgid_trampoline_addr, uintptr(unsafe.Pointer(rgid)), uintptr(unsafe.Pointer(egid)), uintptr(unsafe.Pointer(sgid))) + return +} + +var libc_getresgid_trampoline_addr uintptr + +//go:cgo_import_dynamic libc_getresgid getresgid "libc.so" + +// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT + func ioctl(fd int, req uint, arg uintptr) (err error) { _, _, e1 := syscall_syscall(libc_ioctl_trampoline_addr, uintptr(fd), uintptr(req), uintptr(arg)) if e1 != 0 { @@ -527,6 +549,12 @@ func ioctl(fd int, req uint, arg uintptr) (err error) { return } +var libc_ioctl_trampoline_addr uintptr + +//go:cgo_import_dynamic libc_ioctl ioctl "libc.so" + +// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT + func ioctlPtr(fd int, req uint, arg unsafe.Pointer) (err error) { _, _, e1 := syscall_syscall(libc_ioctl_trampoline_addr, uintptr(fd), uintptr(req), uintptr(arg)) if e1 != 0 { @@ -535,10 +563,6 @@ func ioctlPtr(fd int, req uint, arg unsafe.Pointer) (err error) { return } -var libc_ioctl_trampoline_addr uintptr - -//go:cgo_import_dynamic libc_ioctl ioctl "libc.so" - // THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT func sysctl(mib []_C_int, old *byte, oldlen *uintptr, new *byte, newlen uintptr) (err error) { diff --git a/vendor/golang.org/x/sys/unix/zsyscall_openbsd_amd64.s b/vendor/golang.org/x/sys/unix/zsyscall_openbsd_amd64.s index 27b6f4df..2763620b 100644 --- a/vendor/golang.org/x/sys/unix/zsyscall_openbsd_amd64.s +++ b/vendor/golang.org/x/sys/unix/zsyscall_openbsd_amd64.s @@ -158,6 +158,16 @@ TEXT libc_getcwd_trampoline<>(SB),NOSPLIT,$0-0 GLOBL ·libc_getcwd_trampoline_addr(SB), RODATA, $8 DATA ·libc_getcwd_trampoline_addr(SB)/8, $libc_getcwd_trampoline<>(SB) +TEXT libc_getresuid_trampoline<>(SB),NOSPLIT,$0-0 + JMP libc_getresuid(SB) +GLOBL ·libc_getresuid_trampoline_addr(SB), RODATA, $8 +DATA ·libc_getresuid_trampoline_addr(SB)/8, $libc_getresuid_trampoline<>(SB) + +TEXT libc_getresgid_trampoline<>(SB),NOSPLIT,$0-0 + JMP libc_getresgid(SB) +GLOBL ·libc_getresgid_trampoline_addr(SB), RODATA, $8 +DATA ·libc_getresgid_trampoline_addr(SB)/8, $libc_getresgid_trampoline<>(SB) + TEXT libc_ioctl_trampoline<>(SB),NOSPLIT,$0-0 JMP libc_ioctl(SB) GLOBL ·libc_ioctl_trampoline_addr(SB), RODATA, $8 diff --git a/vendor/golang.org/x/sys/unix/zsyscall_openbsd_arm.go b/vendor/golang.org/x/sys/unix/zsyscall_openbsd_arm.go index 7f642789..8e87fdf1 100644 --- a/vendor/golang.org/x/sys/unix/zsyscall_openbsd_arm.go +++ b/vendor/golang.org/x/sys/unix/zsyscall_openbsd_arm.go @@ -519,6 +519,28 @@ var libc_getcwd_trampoline_addr uintptr // THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT +func getresuid(ruid *_C_int, euid *_C_int, suid *_C_int) { + syscall_rawSyscall(libc_getresuid_trampoline_addr, uintptr(unsafe.Pointer(ruid)), uintptr(unsafe.Pointer(euid)), uintptr(unsafe.Pointer(suid))) + return +} + +var libc_getresuid_trampoline_addr uintptr + +//go:cgo_import_dynamic libc_getresuid getresuid "libc.so" + +// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT + +func getresgid(rgid *_C_int, egid *_C_int, sgid *_C_int) { + syscall_rawSyscall(libc_getresgid_trampoline_addr, uintptr(unsafe.Pointer(rgid)), uintptr(unsafe.Pointer(egid)), uintptr(unsafe.Pointer(sgid))) + return +} + +var libc_getresgid_trampoline_addr uintptr + +//go:cgo_import_dynamic libc_getresgid getresgid "libc.so" + +// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT + func ioctl(fd int, req uint, arg uintptr) (err error) { _, _, e1 := syscall_syscall(libc_ioctl_trampoline_addr, uintptr(fd), uintptr(req), uintptr(arg)) if e1 != 0 { diff --git a/vendor/golang.org/x/sys/unix/zsyscall_openbsd_arm.s b/vendor/golang.org/x/sys/unix/zsyscall_openbsd_arm.s index b797045f..c9223140 100644 --- a/vendor/golang.org/x/sys/unix/zsyscall_openbsd_arm.s +++ b/vendor/golang.org/x/sys/unix/zsyscall_openbsd_arm.s @@ -158,6 +158,16 @@ TEXT libc_getcwd_trampoline<>(SB),NOSPLIT,$0-0 GLOBL ·libc_getcwd_trampoline_addr(SB), RODATA, $4 DATA ·libc_getcwd_trampoline_addr(SB)/4, $libc_getcwd_trampoline<>(SB) +TEXT libc_getresuid_trampoline<>(SB),NOSPLIT,$0-0 + JMP libc_getresuid(SB) +GLOBL ·libc_getresuid_trampoline_addr(SB), RODATA, $4 +DATA ·libc_getresuid_trampoline_addr(SB)/4, $libc_getresuid_trampoline<>(SB) + +TEXT libc_getresgid_trampoline<>(SB),NOSPLIT,$0-0 + JMP libc_getresgid(SB) +GLOBL ·libc_getresgid_trampoline_addr(SB), RODATA, $4 +DATA ·libc_getresgid_trampoline_addr(SB)/4, $libc_getresgid_trampoline<>(SB) + TEXT libc_ioctl_trampoline<>(SB),NOSPLIT,$0-0 JMP libc_ioctl(SB) GLOBL ·libc_ioctl_trampoline_addr(SB), RODATA, $4 diff --git a/vendor/golang.org/x/sys/unix/zsyscall_openbsd_arm64.go b/vendor/golang.org/x/sys/unix/zsyscall_openbsd_arm64.go index 756ef7b1..12a7a216 100644 --- a/vendor/golang.org/x/sys/unix/zsyscall_openbsd_arm64.go +++ b/vendor/golang.org/x/sys/unix/zsyscall_openbsd_arm64.go @@ -519,6 +519,28 @@ var libc_getcwd_trampoline_addr uintptr // THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT +func getresuid(ruid *_C_int, euid *_C_int, suid *_C_int) { + syscall_rawSyscall(libc_getresuid_trampoline_addr, uintptr(unsafe.Pointer(ruid)), uintptr(unsafe.Pointer(euid)), uintptr(unsafe.Pointer(suid))) + return +} + +var libc_getresuid_trampoline_addr uintptr + +//go:cgo_import_dynamic libc_getresuid getresuid "libc.so" + +// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT + +func getresgid(rgid *_C_int, egid *_C_int, sgid *_C_int) { + syscall_rawSyscall(libc_getresgid_trampoline_addr, uintptr(unsafe.Pointer(rgid)), uintptr(unsafe.Pointer(egid)), uintptr(unsafe.Pointer(sgid))) + return +} + +var libc_getresgid_trampoline_addr uintptr + +//go:cgo_import_dynamic libc_getresgid getresgid "libc.so" + +// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT + func ioctl(fd int, req uint, arg uintptr) (err error) { _, _, e1 := syscall_syscall(libc_ioctl_trampoline_addr, uintptr(fd), uintptr(req), uintptr(arg)) if e1 != 0 { diff --git a/vendor/golang.org/x/sys/unix/zsyscall_openbsd_arm64.s b/vendor/golang.org/x/sys/unix/zsyscall_openbsd_arm64.s index a8712662..a6bc32c9 100644 --- a/vendor/golang.org/x/sys/unix/zsyscall_openbsd_arm64.s +++ b/vendor/golang.org/x/sys/unix/zsyscall_openbsd_arm64.s @@ -158,6 +158,16 @@ TEXT libc_getcwd_trampoline<>(SB),NOSPLIT,$0-0 GLOBL ·libc_getcwd_trampoline_addr(SB), RODATA, $8 DATA ·libc_getcwd_trampoline_addr(SB)/8, $libc_getcwd_trampoline<>(SB) +TEXT libc_getresuid_trampoline<>(SB),NOSPLIT,$0-0 + JMP libc_getresuid(SB) +GLOBL ·libc_getresuid_trampoline_addr(SB), RODATA, $8 +DATA ·libc_getresuid_trampoline_addr(SB)/8, $libc_getresuid_trampoline<>(SB) + +TEXT libc_getresgid_trampoline<>(SB),NOSPLIT,$0-0 + JMP libc_getresgid(SB) +GLOBL ·libc_getresgid_trampoline_addr(SB), RODATA, $8 +DATA ·libc_getresgid_trampoline_addr(SB)/8, $libc_getresgid_trampoline<>(SB) + TEXT libc_ioctl_trampoline<>(SB),NOSPLIT,$0-0 JMP libc_ioctl(SB) GLOBL ·libc_ioctl_trampoline_addr(SB), RODATA, $8 diff --git a/vendor/golang.org/x/sys/unix/zsyscall_openbsd_mips64.go b/vendor/golang.org/x/sys/unix/zsyscall_openbsd_mips64.go index 7bc2e24e..b19e8aa0 100644 --- a/vendor/golang.org/x/sys/unix/zsyscall_openbsd_mips64.go +++ b/vendor/golang.org/x/sys/unix/zsyscall_openbsd_mips64.go @@ -519,6 +519,28 @@ var libc_getcwd_trampoline_addr uintptr // THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT +func getresuid(ruid *_C_int, euid *_C_int, suid *_C_int) { + syscall_rawSyscall(libc_getresuid_trampoline_addr, uintptr(unsafe.Pointer(ruid)), uintptr(unsafe.Pointer(euid)), uintptr(unsafe.Pointer(suid))) + return +} + +var libc_getresuid_trampoline_addr uintptr + +//go:cgo_import_dynamic libc_getresuid getresuid "libc.so" + +// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT + +func getresgid(rgid *_C_int, egid *_C_int, sgid *_C_int) { + syscall_rawSyscall(libc_getresgid_trampoline_addr, uintptr(unsafe.Pointer(rgid)), uintptr(unsafe.Pointer(egid)), uintptr(unsafe.Pointer(sgid))) + return +} + +var libc_getresgid_trampoline_addr uintptr + +//go:cgo_import_dynamic libc_getresgid getresgid "libc.so" + +// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT + func ioctl(fd int, req uint, arg uintptr) (err error) { _, _, e1 := syscall_syscall(libc_ioctl_trampoline_addr, uintptr(fd), uintptr(req), uintptr(arg)) if e1 != 0 { diff --git a/vendor/golang.org/x/sys/unix/zsyscall_openbsd_mips64.s b/vendor/golang.org/x/sys/unix/zsyscall_openbsd_mips64.s index 05d4bffd..b4e7bcea 100644 --- a/vendor/golang.org/x/sys/unix/zsyscall_openbsd_mips64.s +++ b/vendor/golang.org/x/sys/unix/zsyscall_openbsd_mips64.s @@ -158,6 +158,16 @@ TEXT libc_getcwd_trampoline<>(SB),NOSPLIT,$0-0 GLOBL ·libc_getcwd_trampoline_addr(SB), RODATA, $8 DATA ·libc_getcwd_trampoline_addr(SB)/8, $libc_getcwd_trampoline<>(SB) +TEXT libc_getresuid_trampoline<>(SB),NOSPLIT,$0-0 + JMP libc_getresuid(SB) +GLOBL ·libc_getresuid_trampoline_addr(SB), RODATA, $8 +DATA ·libc_getresuid_trampoline_addr(SB)/8, $libc_getresuid_trampoline<>(SB) + +TEXT libc_getresgid_trampoline<>(SB),NOSPLIT,$0-0 + JMP libc_getresgid(SB) +GLOBL ·libc_getresgid_trampoline_addr(SB), RODATA, $8 +DATA ·libc_getresgid_trampoline_addr(SB)/8, $libc_getresgid_trampoline<>(SB) + TEXT libc_ioctl_trampoline<>(SB),NOSPLIT,$0-0 JMP libc_ioctl(SB) GLOBL ·libc_ioctl_trampoline_addr(SB), RODATA, $8 diff --git a/vendor/golang.org/x/sys/unix/zsyscall_openbsd_ppc64.go b/vendor/golang.org/x/sys/unix/zsyscall_openbsd_ppc64.go index 739be621..fb99594c 100644 --- a/vendor/golang.org/x/sys/unix/zsyscall_openbsd_ppc64.go +++ b/vendor/golang.org/x/sys/unix/zsyscall_openbsd_ppc64.go @@ -519,6 +519,28 @@ var libc_getcwd_trampoline_addr uintptr // THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT +func getresuid(ruid *_C_int, euid *_C_int, suid *_C_int) { + syscall_rawSyscall(libc_getresuid_trampoline_addr, uintptr(unsafe.Pointer(ruid)), uintptr(unsafe.Pointer(euid)), uintptr(unsafe.Pointer(suid))) + return +} + +var libc_getresuid_trampoline_addr uintptr + +//go:cgo_import_dynamic libc_getresuid getresuid "libc.so" + +// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT + +func getresgid(rgid *_C_int, egid *_C_int, sgid *_C_int) { + syscall_rawSyscall(libc_getresgid_trampoline_addr, uintptr(unsafe.Pointer(rgid)), uintptr(unsafe.Pointer(egid)), uintptr(unsafe.Pointer(sgid))) + return +} + +var libc_getresgid_trampoline_addr uintptr + +//go:cgo_import_dynamic libc_getresgid getresgid "libc.so" + +// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT + func ioctl(fd int, req uint, arg uintptr) (err error) { _, _, e1 := syscall_syscall(libc_ioctl_trampoline_addr, uintptr(fd), uintptr(req), uintptr(arg)) if e1 != 0 { diff --git a/vendor/golang.org/x/sys/unix/zsyscall_openbsd_ppc64.s b/vendor/golang.org/x/sys/unix/zsyscall_openbsd_ppc64.s index 74a25f8d..ca3f7660 100644 --- a/vendor/golang.org/x/sys/unix/zsyscall_openbsd_ppc64.s +++ b/vendor/golang.org/x/sys/unix/zsyscall_openbsd_ppc64.s @@ -189,6 +189,18 @@ TEXT libc_getcwd_trampoline<>(SB),NOSPLIT,$0-0 GLOBL ·libc_getcwd_trampoline_addr(SB), RODATA, $8 DATA ·libc_getcwd_trampoline_addr(SB)/8, $libc_getcwd_trampoline<>(SB) +TEXT libc_getresuid_trampoline<>(SB),NOSPLIT,$0-0 + CALL libc_getresuid(SB) + RET +GLOBL ·libc_getresuid_trampoline_addr(SB), RODATA, $8 +DATA ·libc_getresuid_trampoline_addr(SB)/8, $libc_getresuid_trampoline<>(SB) + +TEXT libc_getresgid_trampoline<>(SB),NOSPLIT,$0-0 + CALL libc_getresgid(SB) + RET +GLOBL ·libc_getresgid_trampoline_addr(SB), RODATA, $8 +DATA ·libc_getresgid_trampoline_addr(SB)/8, $libc_getresgid_trampoline<>(SB) + TEXT libc_ioctl_trampoline<>(SB),NOSPLIT,$0-0 CALL libc_ioctl(SB) RET diff --git a/vendor/golang.org/x/sys/unix/zsyscall_openbsd_riscv64.go b/vendor/golang.org/x/sys/unix/zsyscall_openbsd_riscv64.go index 7d95a197..32cbbbc5 100644 --- a/vendor/golang.org/x/sys/unix/zsyscall_openbsd_riscv64.go +++ b/vendor/golang.org/x/sys/unix/zsyscall_openbsd_riscv64.go @@ -519,6 +519,28 @@ var libc_getcwd_trampoline_addr uintptr // THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT +func getresuid(ruid *_C_int, euid *_C_int, suid *_C_int) { + syscall_rawSyscall(libc_getresuid_trampoline_addr, uintptr(unsafe.Pointer(ruid)), uintptr(unsafe.Pointer(euid)), uintptr(unsafe.Pointer(suid))) + return +} + +var libc_getresuid_trampoline_addr uintptr + +//go:cgo_import_dynamic libc_getresuid getresuid "libc.so" + +// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT + +func getresgid(rgid *_C_int, egid *_C_int, sgid *_C_int) { + syscall_rawSyscall(libc_getresgid_trampoline_addr, uintptr(unsafe.Pointer(rgid)), uintptr(unsafe.Pointer(egid)), uintptr(unsafe.Pointer(sgid))) + return +} + +var libc_getresgid_trampoline_addr uintptr + +//go:cgo_import_dynamic libc_getresgid getresgid "libc.so" + +// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT + func ioctl(fd int, req uint, arg uintptr) (err error) { _, _, e1 := syscall_syscall(libc_ioctl_trampoline_addr, uintptr(fd), uintptr(req), uintptr(arg)) if e1 != 0 { diff --git a/vendor/golang.org/x/sys/unix/zsyscall_openbsd_riscv64.s b/vendor/golang.org/x/sys/unix/zsyscall_openbsd_riscv64.s index 990be245..477a7d5b 100644 --- a/vendor/golang.org/x/sys/unix/zsyscall_openbsd_riscv64.s +++ b/vendor/golang.org/x/sys/unix/zsyscall_openbsd_riscv64.s @@ -158,6 +158,16 @@ TEXT libc_getcwd_trampoline<>(SB),NOSPLIT,$0-0 GLOBL ·libc_getcwd_trampoline_addr(SB), RODATA, $8 DATA ·libc_getcwd_trampoline_addr(SB)/8, $libc_getcwd_trampoline<>(SB) +TEXT libc_getresuid_trampoline<>(SB),NOSPLIT,$0-0 + JMP libc_getresuid(SB) +GLOBL ·libc_getresuid_trampoline_addr(SB), RODATA, $8 +DATA ·libc_getresuid_trampoline_addr(SB)/8, $libc_getresuid_trampoline<>(SB) + +TEXT libc_getresgid_trampoline<>(SB),NOSPLIT,$0-0 + JMP libc_getresgid(SB) +GLOBL ·libc_getresgid_trampoline_addr(SB), RODATA, $8 +DATA ·libc_getresgid_trampoline_addr(SB)/8, $libc_getresgid_trampoline<>(SB) + TEXT libc_ioctl_trampoline<>(SB),NOSPLIT,$0-0 JMP libc_ioctl(SB) GLOBL ·libc_ioctl_trampoline_addr(SB), RODATA, $8 diff --git a/vendor/golang.org/x/sys/unix/zsysnum_linux_riscv64.go b/vendor/golang.org/x/sys/unix/zsysnum_linux_riscv64.go index 3e594a8c..ef285c56 100644 --- a/vendor/golang.org/x/sys/unix/zsysnum_linux_riscv64.go +++ b/vendor/golang.org/x/sys/unix/zsysnum_linux_riscv64.go @@ -251,6 +251,8 @@ const ( SYS_ACCEPT4 = 242 SYS_RECVMMSG = 243 SYS_ARCH_SPECIFIC_SYSCALL = 244 + SYS_RISCV_HWPROBE = 258 + SYS_RISCV_FLUSH_ICACHE = 259 SYS_WAIT4 = 260 SYS_PRLIMIT64 = 261 SYS_FANOTIFY_INIT = 262 diff --git a/vendor/golang.org/x/sys/unix/zsysnum_linux_s390x.go b/vendor/golang.org/x/sys/unix/zsysnum_linux_s390x.go index 7ea46520..e6ed7d63 100644 --- a/vendor/golang.org/x/sys/unix/zsysnum_linux_s390x.go +++ b/vendor/golang.org/x/sys/unix/zsysnum_linux_s390x.go @@ -372,6 +372,7 @@ const ( SYS_LANDLOCK_CREATE_RULESET = 444 SYS_LANDLOCK_ADD_RULE = 445 SYS_LANDLOCK_RESTRICT_SELF = 446 + SYS_MEMFD_SECRET = 447 SYS_PROCESS_MRELEASE = 448 SYS_FUTEX_WAITV = 449 SYS_SET_MEMPOLICY_HOME_NODE = 450 diff --git a/vendor/golang.org/x/sys/unix/ztypes_linux.go b/vendor/golang.org/x/sys/unix/ztypes_linux.go index ca84727c..494493c7 100644 --- a/vendor/golang.org/x/sys/unix/ztypes_linux.go +++ b/vendor/golang.org/x/sys/unix/ztypes_linux.go @@ -866,6 +866,11 @@ const ( POLLNVAL = 0x20 ) +type sigset_argpack struct { + ss *Sigset_t + ssLen uintptr +} + type SignalfdSiginfo struct { Signo uint32 Errno int32 @@ -1538,6 +1543,10 @@ const ( IFLA_GRO_MAX_SIZE = 0x3a IFLA_TSO_MAX_SIZE = 0x3b IFLA_TSO_MAX_SEGS = 0x3c + IFLA_ALLMULTI = 0x3d + IFLA_DEVLINK_PORT = 0x3e + IFLA_GSO_IPV4_MAX_SIZE = 0x3f + IFLA_GRO_IPV4_MAX_SIZE = 0x40 IFLA_PROTO_DOWN_REASON_UNSPEC = 0x0 IFLA_PROTO_DOWN_REASON_MASK = 0x1 IFLA_PROTO_DOWN_REASON_VALUE = 0x2 @@ -1968,7 +1977,7 @@ const ( NFT_MSG_GETFLOWTABLE = 0x17 NFT_MSG_DELFLOWTABLE = 0x18 NFT_MSG_GETRULE_RESET = 0x19 - NFT_MSG_MAX = 0x1a + NFT_MSG_MAX = 0x21 NFTA_LIST_UNSPEC = 0x0 NFTA_LIST_ELEM = 0x1 NFTA_HOOK_UNSPEC = 0x0 @@ -2555,6 +2564,11 @@ const ( BPF_REG_8 = 0x8 BPF_REG_9 = 0x9 BPF_REG_10 = 0xa + BPF_CGROUP_ITER_ORDER_UNSPEC = 0x0 + BPF_CGROUP_ITER_SELF_ONLY = 0x1 + BPF_CGROUP_ITER_DESCENDANTS_PRE = 0x2 + BPF_CGROUP_ITER_DESCENDANTS_POST = 0x3 + BPF_CGROUP_ITER_ANCESTORS_UP = 0x4 BPF_MAP_CREATE = 0x0 BPF_MAP_LOOKUP_ELEM = 0x1 BPF_MAP_UPDATE_ELEM = 0x2 @@ -2566,6 +2580,7 @@ const ( BPF_PROG_ATTACH = 0x8 BPF_PROG_DETACH = 0x9 BPF_PROG_TEST_RUN = 0xa + BPF_PROG_RUN = 0xa BPF_PROG_GET_NEXT_ID = 0xb BPF_MAP_GET_NEXT_ID = 0xc BPF_PROG_GET_FD_BY_ID = 0xd @@ -2610,6 +2625,7 @@ const ( BPF_MAP_TYPE_CPUMAP = 0x10 BPF_MAP_TYPE_XSKMAP = 0x11 BPF_MAP_TYPE_SOCKHASH = 0x12 + BPF_MAP_TYPE_CGROUP_STORAGE_DEPRECATED = 0x13 BPF_MAP_TYPE_CGROUP_STORAGE = 0x13 BPF_MAP_TYPE_REUSEPORT_SOCKARRAY = 0x14 BPF_MAP_TYPE_PERCPU_CGROUP_STORAGE = 0x15 @@ -2620,6 +2636,10 @@ const ( BPF_MAP_TYPE_STRUCT_OPS = 0x1a BPF_MAP_TYPE_RINGBUF = 0x1b BPF_MAP_TYPE_INODE_STORAGE = 0x1c + BPF_MAP_TYPE_TASK_STORAGE = 0x1d + BPF_MAP_TYPE_BLOOM_FILTER = 0x1e + BPF_MAP_TYPE_USER_RINGBUF = 0x1f + BPF_MAP_TYPE_CGRP_STORAGE = 0x20 BPF_PROG_TYPE_UNSPEC = 0x0 BPF_PROG_TYPE_SOCKET_FILTER = 0x1 BPF_PROG_TYPE_KPROBE = 0x2 @@ -2651,6 +2671,7 @@ const ( BPF_PROG_TYPE_EXT = 0x1c BPF_PROG_TYPE_LSM = 0x1d BPF_PROG_TYPE_SK_LOOKUP = 0x1e + BPF_PROG_TYPE_SYSCALL = 0x1f BPF_CGROUP_INET_INGRESS = 0x0 BPF_CGROUP_INET_EGRESS = 0x1 BPF_CGROUP_INET_SOCK_CREATE = 0x2 @@ -2689,6 +2710,12 @@ const ( BPF_XDP_CPUMAP = 0x23 BPF_SK_LOOKUP = 0x24 BPF_XDP = 0x25 + BPF_SK_SKB_VERDICT = 0x26 + BPF_SK_REUSEPORT_SELECT = 0x27 + BPF_SK_REUSEPORT_SELECT_OR_MIGRATE = 0x28 + BPF_PERF_EVENT = 0x29 + BPF_TRACE_KPROBE_MULTI = 0x2a + BPF_LSM_CGROUP = 0x2b BPF_LINK_TYPE_UNSPEC = 0x0 BPF_LINK_TYPE_RAW_TRACEPOINT = 0x1 BPF_LINK_TYPE_TRACING = 0x2 @@ -2696,6 +2723,9 @@ const ( BPF_LINK_TYPE_ITER = 0x4 BPF_LINK_TYPE_NETNS = 0x5 BPF_LINK_TYPE_XDP = 0x6 + BPF_LINK_TYPE_PERF_EVENT = 0x7 + BPF_LINK_TYPE_KPROBE_MULTI = 0x8 + BPF_LINK_TYPE_STRUCT_OPS = 0x9 BPF_ANY = 0x0 BPF_NOEXIST = 0x1 BPF_EXIST = 0x2 @@ -2733,6 +2763,7 @@ const ( BPF_F_ZERO_CSUM_TX = 0x2 BPF_F_DONT_FRAGMENT = 0x4 BPF_F_SEQ_NUMBER = 0x8 + BPF_F_TUNINFO_FLAGS = 0x10 BPF_F_INDEX_MASK = 0xffffffff BPF_F_CURRENT_CPU = 0xffffffff BPF_F_CTXLEN_MASK = 0xfffff00000000 @@ -2747,6 +2778,7 @@ const ( BPF_F_ADJ_ROOM_ENCAP_L4_GRE = 0x8 BPF_F_ADJ_ROOM_ENCAP_L4_UDP = 0x10 BPF_F_ADJ_ROOM_NO_CSUM_RESET = 0x20 + BPF_F_ADJ_ROOM_ENCAP_L2_ETH = 0x40 BPF_ADJ_ROOM_ENCAP_L2_MASK = 0xff BPF_ADJ_ROOM_ENCAP_L2_SHIFT = 0x38 BPF_F_SYSCTL_BASE_NAME = 0x1 @@ -2771,10 +2803,16 @@ const ( BPF_LWT_ENCAP_SEG6 = 0x0 BPF_LWT_ENCAP_SEG6_INLINE = 0x1 BPF_LWT_ENCAP_IP = 0x2 + BPF_F_BPRM_SECUREEXEC = 0x1 + BPF_F_BROADCAST = 0x8 + BPF_F_EXCLUDE_INGRESS = 0x10 + BPF_SKB_TSTAMP_UNSPEC = 0x0 + BPF_SKB_TSTAMP_DELIVERY_MONO = 0x1 BPF_OK = 0x0 BPF_DROP = 0x2 BPF_REDIRECT = 0x7 BPF_LWT_REROUTE = 0x80 + BPF_FLOW_DISSECTOR_CONTINUE = 0x81 BPF_SOCK_OPS_RTO_CB_FLAG = 0x1 BPF_SOCK_OPS_RETRANS_CB_FLAG = 0x2 BPF_SOCK_OPS_STATE_CB_FLAG = 0x4 @@ -2838,6 +2876,10 @@ const ( BPF_FIB_LKUP_RET_UNSUPP_LWT = 0x6 BPF_FIB_LKUP_RET_NO_NEIGH = 0x7 BPF_FIB_LKUP_RET_FRAG_NEEDED = 0x8 + BPF_MTU_CHK_SEGS = 0x1 + BPF_MTU_CHK_RET_SUCCESS = 0x0 + BPF_MTU_CHK_RET_FRAG_NEEDED = 0x1 + BPF_MTU_CHK_RET_SEGS_TOOBIG = 0x2 BPF_FD_TYPE_RAW_TRACEPOINT = 0x0 BPF_FD_TYPE_TRACEPOINT = 0x1 BPF_FD_TYPE_KPROBE = 0x2 @@ -2847,6 +2889,19 @@ const ( BPF_FLOW_DISSECTOR_F_PARSE_1ST_FRAG = 0x1 BPF_FLOW_DISSECTOR_F_STOP_AT_FLOW_LABEL = 0x2 BPF_FLOW_DISSECTOR_F_STOP_AT_ENCAP = 0x4 + BPF_CORE_FIELD_BYTE_OFFSET = 0x0 + BPF_CORE_FIELD_BYTE_SIZE = 0x1 + BPF_CORE_FIELD_EXISTS = 0x2 + BPF_CORE_FIELD_SIGNED = 0x3 + BPF_CORE_FIELD_LSHIFT_U64 = 0x4 + BPF_CORE_FIELD_RSHIFT_U64 = 0x5 + BPF_CORE_TYPE_ID_LOCAL = 0x6 + BPF_CORE_TYPE_ID_TARGET = 0x7 + BPF_CORE_TYPE_EXISTS = 0x8 + BPF_CORE_TYPE_SIZE = 0x9 + BPF_CORE_ENUMVAL_EXISTS = 0xa + BPF_CORE_ENUMVAL_VALUE = 0xb + BPF_CORE_TYPE_MATCHES = 0xc ) const ( @@ -3605,7 +3660,7 @@ const ( ETHTOOL_MSG_PSE_GET = 0x24 ETHTOOL_MSG_PSE_SET = 0x25 ETHTOOL_MSG_RSS_GET = 0x26 - ETHTOOL_MSG_USER_MAX = 0x26 + ETHTOOL_MSG_USER_MAX = 0x2b ETHTOOL_MSG_KERNEL_NONE = 0x0 ETHTOOL_MSG_STRSET_GET_REPLY = 0x1 ETHTOOL_MSG_LINKINFO_GET_REPLY = 0x2 @@ -3645,7 +3700,7 @@ const ( ETHTOOL_MSG_MODULE_NTF = 0x24 ETHTOOL_MSG_PSE_GET_REPLY = 0x25 ETHTOOL_MSG_RSS_GET_REPLY = 0x26 - ETHTOOL_MSG_KERNEL_MAX = 0x26 + ETHTOOL_MSG_KERNEL_MAX = 0x2b ETHTOOL_A_HEADER_UNSPEC = 0x0 ETHTOOL_A_HEADER_DEV_INDEX = 0x1 ETHTOOL_A_HEADER_DEV_NAME = 0x2 @@ -3749,7 +3804,7 @@ const ( ETHTOOL_A_RINGS_TCP_DATA_SPLIT = 0xb ETHTOOL_A_RINGS_CQE_SIZE = 0xc ETHTOOL_A_RINGS_TX_PUSH = 0xd - ETHTOOL_A_RINGS_MAX = 0xd + ETHTOOL_A_RINGS_MAX = 0x10 ETHTOOL_A_CHANNELS_UNSPEC = 0x0 ETHTOOL_A_CHANNELS_HEADER = 0x1 ETHTOOL_A_CHANNELS_RX_MAX = 0x2 @@ -3787,14 +3842,14 @@ const ( ETHTOOL_A_COALESCE_RATE_SAMPLE_INTERVAL = 0x17 ETHTOOL_A_COALESCE_USE_CQE_MODE_TX = 0x18 ETHTOOL_A_COALESCE_USE_CQE_MODE_RX = 0x19 - ETHTOOL_A_COALESCE_MAX = 0x19 + ETHTOOL_A_COALESCE_MAX = 0x1c ETHTOOL_A_PAUSE_UNSPEC = 0x0 ETHTOOL_A_PAUSE_HEADER = 0x1 ETHTOOL_A_PAUSE_AUTONEG = 0x2 ETHTOOL_A_PAUSE_RX = 0x3 ETHTOOL_A_PAUSE_TX = 0x4 ETHTOOL_A_PAUSE_STATS = 0x5 - ETHTOOL_A_PAUSE_MAX = 0x5 + ETHTOOL_A_PAUSE_MAX = 0x6 ETHTOOL_A_PAUSE_STAT_UNSPEC = 0x0 ETHTOOL_A_PAUSE_STAT_PAD = 0x1 ETHTOOL_A_PAUSE_STAT_TX_FRAMES = 0x2 @@ -4444,7 +4499,7 @@ const ( NL80211_ATTR_MAC_HINT = 0xc8 NL80211_ATTR_MAC_MASK = 0xd7 NL80211_ATTR_MAX_AP_ASSOC_STA = 0xca - NL80211_ATTR_MAX = 0x141 + NL80211_ATTR_MAX = 0x145 NL80211_ATTR_MAX_CRIT_PROT_DURATION = 0xb4 NL80211_ATTR_MAX_CSA_COUNTERS = 0xce NL80211_ATTR_MAX_MATCH_SETS = 0x85 @@ -4673,7 +4728,7 @@ const ( NL80211_BAND_ATTR_HT_CAPA = 0x4 NL80211_BAND_ATTR_HT_MCS_SET = 0x3 NL80211_BAND_ATTR_IFTYPE_DATA = 0x9 - NL80211_BAND_ATTR_MAX = 0xb + NL80211_BAND_ATTR_MAX = 0xd NL80211_BAND_ATTR_RATES = 0x2 NL80211_BAND_ATTR_VHT_CAPA = 0x8 NL80211_BAND_ATTR_VHT_MCS_SET = 0x7 @@ -4814,7 +4869,7 @@ const ( NL80211_CMD_LEAVE_IBSS = 0x2c NL80211_CMD_LEAVE_MESH = 0x45 NL80211_CMD_LEAVE_OCB = 0x6d - NL80211_CMD_MAX = 0x98 + NL80211_CMD_MAX = 0x99 NL80211_CMD_MICHAEL_MIC_FAILURE = 0x29 NL80211_CMD_MODIFY_LINK_STA = 0x97 NL80211_CMD_NAN_MATCH = 0x78 @@ -5795,6 +5850,8 @@ const ( TUN_F_TSO6 = 0x4 TUN_F_TSO_ECN = 0x8 TUN_F_UFO = 0x10 + TUN_F_USO4 = 0x20 + TUN_F_USO6 = 0x40 ) const ( @@ -5804,9 +5861,25 @@ const ( ) const ( - VIRTIO_NET_HDR_GSO_NONE = 0x0 - VIRTIO_NET_HDR_GSO_TCPV4 = 0x1 - VIRTIO_NET_HDR_GSO_UDP = 0x3 - VIRTIO_NET_HDR_GSO_TCPV6 = 0x4 - VIRTIO_NET_HDR_GSO_ECN = 0x80 + VIRTIO_NET_HDR_GSO_NONE = 0x0 + VIRTIO_NET_HDR_GSO_TCPV4 = 0x1 + VIRTIO_NET_HDR_GSO_UDP = 0x3 + VIRTIO_NET_HDR_GSO_TCPV6 = 0x4 + VIRTIO_NET_HDR_GSO_UDP_L4 = 0x5 + VIRTIO_NET_HDR_GSO_ECN = 0x80 ) + +type SchedAttr struct { + Size uint32 + Policy uint32 + Flags uint64 + Nice int32 + Priority uint32 + Runtime uint64 + Deadline uint64 + Period uint64 + Util_min uint32 + Util_max uint32 +} + +const SizeofSchedAttr = 0x38 diff --git a/vendor/golang.org/x/sys/unix/ztypes_linux_386.go b/vendor/golang.org/x/sys/unix/ztypes_linux_386.go index 4ecc1495..6d8acbcc 100644 --- a/vendor/golang.org/x/sys/unix/ztypes_linux_386.go +++ b/vendor/golang.org/x/sys/unix/ztypes_linux_386.go @@ -337,6 +337,8 @@ type Taskstats struct { Ac_exe_inode uint64 Wpcopy_count uint64 Wpcopy_delay_total uint64 + Irq_count uint64 + Irq_delay_total uint64 } type cpuMask uint32 diff --git a/vendor/golang.org/x/sys/unix/ztypes_linux_amd64.go b/vendor/golang.org/x/sys/unix/ztypes_linux_amd64.go index 34fddff9..59293c68 100644 --- a/vendor/golang.org/x/sys/unix/ztypes_linux_amd64.go +++ b/vendor/golang.org/x/sys/unix/ztypes_linux_amd64.go @@ -350,6 +350,8 @@ type Taskstats struct { Ac_exe_inode uint64 Wpcopy_count uint64 Wpcopy_delay_total uint64 + Irq_count uint64 + Irq_delay_total uint64 } type cpuMask uint64 diff --git a/vendor/golang.org/x/sys/unix/ztypes_linux_arm.go b/vendor/golang.org/x/sys/unix/ztypes_linux_arm.go index 3b14a603..40cfa38c 100644 --- a/vendor/golang.org/x/sys/unix/ztypes_linux_arm.go +++ b/vendor/golang.org/x/sys/unix/ztypes_linux_arm.go @@ -328,6 +328,8 @@ type Taskstats struct { Ac_exe_inode uint64 Wpcopy_count uint64 Wpcopy_delay_total uint64 + Irq_count uint64 + Irq_delay_total uint64 } type cpuMask uint32 diff --git a/vendor/golang.org/x/sys/unix/ztypes_linux_arm64.go b/vendor/golang.org/x/sys/unix/ztypes_linux_arm64.go index 0517651a..055bc421 100644 --- a/vendor/golang.org/x/sys/unix/ztypes_linux_arm64.go +++ b/vendor/golang.org/x/sys/unix/ztypes_linux_arm64.go @@ -329,6 +329,8 @@ type Taskstats struct { Ac_exe_inode uint64 Wpcopy_count uint64 Wpcopy_delay_total uint64 + Irq_count uint64 + Irq_delay_total uint64 } type cpuMask uint64 diff --git a/vendor/golang.org/x/sys/unix/ztypes_linux_loong64.go b/vendor/golang.org/x/sys/unix/ztypes_linux_loong64.go index 3b0c5181..f28affbc 100644 --- a/vendor/golang.org/x/sys/unix/ztypes_linux_loong64.go +++ b/vendor/golang.org/x/sys/unix/ztypes_linux_loong64.go @@ -330,6 +330,8 @@ type Taskstats struct { Ac_exe_inode uint64 Wpcopy_count uint64 Wpcopy_delay_total uint64 + Irq_count uint64 + Irq_delay_total uint64 } type cpuMask uint64 diff --git a/vendor/golang.org/x/sys/unix/ztypes_linux_mips.go b/vendor/golang.org/x/sys/unix/ztypes_linux_mips.go index fccdf4dd..9d71e7cc 100644 --- a/vendor/golang.org/x/sys/unix/ztypes_linux_mips.go +++ b/vendor/golang.org/x/sys/unix/ztypes_linux_mips.go @@ -333,6 +333,8 @@ type Taskstats struct { Ac_exe_inode uint64 Wpcopy_count uint64 Wpcopy_delay_total uint64 + Irq_count uint64 + Irq_delay_total uint64 } type cpuMask uint32 diff --git a/vendor/golang.org/x/sys/unix/ztypes_linux_mips64.go b/vendor/golang.org/x/sys/unix/ztypes_linux_mips64.go index 500de8fc..fd5ccd33 100644 --- a/vendor/golang.org/x/sys/unix/ztypes_linux_mips64.go +++ b/vendor/golang.org/x/sys/unix/ztypes_linux_mips64.go @@ -332,6 +332,8 @@ type Taskstats struct { Ac_exe_inode uint64 Wpcopy_count uint64 Wpcopy_delay_total uint64 + Irq_count uint64 + Irq_delay_total uint64 } type cpuMask uint64 diff --git a/vendor/golang.org/x/sys/unix/ztypes_linux_mips64le.go b/vendor/golang.org/x/sys/unix/ztypes_linux_mips64le.go index d0434cd2..7704de77 100644 --- a/vendor/golang.org/x/sys/unix/ztypes_linux_mips64le.go +++ b/vendor/golang.org/x/sys/unix/ztypes_linux_mips64le.go @@ -332,6 +332,8 @@ type Taskstats struct { Ac_exe_inode uint64 Wpcopy_count uint64 Wpcopy_delay_total uint64 + Irq_count uint64 + Irq_delay_total uint64 } type cpuMask uint64 diff --git a/vendor/golang.org/x/sys/unix/ztypes_linux_mipsle.go b/vendor/golang.org/x/sys/unix/ztypes_linux_mipsle.go index 84206ba5..df00b875 100644 --- a/vendor/golang.org/x/sys/unix/ztypes_linux_mipsle.go +++ b/vendor/golang.org/x/sys/unix/ztypes_linux_mipsle.go @@ -333,6 +333,8 @@ type Taskstats struct { Ac_exe_inode uint64 Wpcopy_count uint64 Wpcopy_delay_total uint64 + Irq_count uint64 + Irq_delay_total uint64 } type cpuMask uint32 diff --git a/vendor/golang.org/x/sys/unix/ztypes_linux_ppc.go b/vendor/golang.org/x/sys/unix/ztypes_linux_ppc.go index ab078cf1..0942840d 100644 --- a/vendor/golang.org/x/sys/unix/ztypes_linux_ppc.go +++ b/vendor/golang.org/x/sys/unix/ztypes_linux_ppc.go @@ -340,6 +340,8 @@ type Taskstats struct { Ac_exe_inode uint64 Wpcopy_count uint64 Wpcopy_delay_total uint64 + Irq_count uint64 + Irq_delay_total uint64 } type cpuMask uint32 diff --git a/vendor/golang.org/x/sys/unix/ztypes_linux_ppc64.go b/vendor/golang.org/x/sys/unix/ztypes_linux_ppc64.go index 42eb2c4c..03487439 100644 --- a/vendor/golang.org/x/sys/unix/ztypes_linux_ppc64.go +++ b/vendor/golang.org/x/sys/unix/ztypes_linux_ppc64.go @@ -339,6 +339,8 @@ type Taskstats struct { Ac_exe_inode uint64 Wpcopy_count uint64 Wpcopy_delay_total uint64 + Irq_count uint64 + Irq_delay_total uint64 } type cpuMask uint64 diff --git a/vendor/golang.org/x/sys/unix/ztypes_linux_ppc64le.go b/vendor/golang.org/x/sys/unix/ztypes_linux_ppc64le.go index 31304a4e..bad06704 100644 --- a/vendor/golang.org/x/sys/unix/ztypes_linux_ppc64le.go +++ b/vendor/golang.org/x/sys/unix/ztypes_linux_ppc64le.go @@ -339,6 +339,8 @@ type Taskstats struct { Ac_exe_inode uint64 Wpcopy_count uint64 Wpcopy_delay_total uint64 + Irq_count uint64 + Irq_delay_total uint64 } type cpuMask uint64 diff --git a/vendor/golang.org/x/sys/unix/ztypes_linux_riscv64.go b/vendor/golang.org/x/sys/unix/ztypes_linux_riscv64.go index c311f961..83c69c11 100644 --- a/vendor/golang.org/x/sys/unix/ztypes_linux_riscv64.go +++ b/vendor/golang.org/x/sys/unix/ztypes_linux_riscv64.go @@ -357,6 +357,8 @@ type Taskstats struct { Ac_exe_inode uint64 Wpcopy_count uint64 Wpcopy_delay_total uint64 + Irq_count uint64 + Irq_delay_total uint64 } type cpuMask uint64 @@ -716,3 +718,26 @@ type SysvShmDesc struct { _ uint64 _ uint64 } + +type RISCVHWProbePairs struct { + Key int64 + Value uint64 +} + +const ( + RISCV_HWPROBE_KEY_MVENDORID = 0x0 + RISCV_HWPROBE_KEY_MARCHID = 0x1 + RISCV_HWPROBE_KEY_MIMPID = 0x2 + RISCV_HWPROBE_KEY_BASE_BEHAVIOR = 0x3 + RISCV_HWPROBE_BASE_BEHAVIOR_IMA = 0x1 + RISCV_HWPROBE_KEY_IMA_EXT_0 = 0x4 + RISCV_HWPROBE_IMA_FD = 0x1 + RISCV_HWPROBE_IMA_C = 0x2 + RISCV_HWPROBE_KEY_CPUPERF_0 = 0x5 + RISCV_HWPROBE_MISALIGNED_UNKNOWN = 0x0 + RISCV_HWPROBE_MISALIGNED_EMULATED = 0x1 + RISCV_HWPROBE_MISALIGNED_SLOW = 0x2 + RISCV_HWPROBE_MISALIGNED_FAST = 0x3 + RISCV_HWPROBE_MISALIGNED_UNSUPPORTED = 0x4 + RISCV_HWPROBE_MISALIGNED_MASK = 0x7 +) diff --git a/vendor/golang.org/x/sys/unix/ztypes_linux_s390x.go b/vendor/golang.org/x/sys/unix/ztypes_linux_s390x.go index bba3cefa..aa268d02 100644 --- a/vendor/golang.org/x/sys/unix/ztypes_linux_s390x.go +++ b/vendor/golang.org/x/sys/unix/ztypes_linux_s390x.go @@ -352,6 +352,8 @@ type Taskstats struct { Ac_exe_inode uint64 Wpcopy_count uint64 Wpcopy_delay_total uint64 + Irq_count uint64 + Irq_delay_total uint64 } type cpuMask uint64 diff --git a/vendor/golang.org/x/sys/unix/ztypes_linux_sparc64.go b/vendor/golang.org/x/sys/unix/ztypes_linux_sparc64.go index ad8a0138..444045b6 100644 --- a/vendor/golang.org/x/sys/unix/ztypes_linux_sparc64.go +++ b/vendor/golang.org/x/sys/unix/ztypes_linux_sparc64.go @@ -334,6 +334,8 @@ type Taskstats struct { Ac_exe_inode uint64 Wpcopy_count uint64 Wpcopy_delay_total uint64 + Irq_count uint64 + Irq_delay_total uint64 } type cpuMask uint64 diff --git a/vendor/golang.org/x/sys/windows/service.go b/vendor/golang.org/x/sys/windows/service.go index c964b684..c44a1b96 100644 --- a/vendor/golang.org/x/sys/windows/service.go +++ b/vendor/golang.org/x/sys/windows/service.go @@ -218,6 +218,10 @@ type SERVICE_FAILURE_ACTIONS struct { Actions *SC_ACTION } +type SERVICE_FAILURE_ACTIONS_FLAG struct { + FailureActionsOnNonCrashFailures int32 +} + type SC_ACTION struct { Type uint32 Delay uint32 diff --git a/vendor/golang.org/x/sys/windows/syscall_windows.go b/vendor/golang.org/x/sys/windows/syscall_windows.go index 3723b2c2..67bad092 100644 --- a/vendor/golang.org/x/sys/windows/syscall_windows.go +++ b/vendor/golang.org/x/sys/windows/syscall_windows.go @@ -135,14 +135,14 @@ func Getpagesize() int { return 4096 } // NewCallback converts a Go function to a function pointer conforming to the stdcall calling convention. // This is useful when interoperating with Windows code requiring callbacks. -// The argument is expected to be a function with with one uintptr-sized result. The function must not have arguments with size larger than the size of uintptr. +// The argument is expected to be a function with one uintptr-sized result. The function must not have arguments with size larger than the size of uintptr. func NewCallback(fn interface{}) uintptr { return syscall.NewCallback(fn) } // NewCallbackCDecl converts a Go function to a function pointer conforming to the cdecl calling convention. // This is useful when interoperating with Windows code requiring callbacks. -// The argument is expected to be a function with with one uintptr-sized result. The function must not have arguments with size larger than the size of uintptr. +// The argument is expected to be a function with one uintptr-sized result. The function must not have arguments with size larger than the size of uintptr. func NewCallbackCDecl(fn interface{}) uintptr { return syscall.NewCallbackCDecl(fn) } @@ -216,7 +216,7 @@ func NewCallbackCDecl(fn interface{}) uintptr { //sys shGetKnownFolderPath(id *KNOWNFOLDERID, flags uint32, token Token, path **uint16) (ret error) = shell32.SHGetKnownFolderPath //sys TerminateProcess(handle Handle, exitcode uint32) (err error) //sys GetExitCodeProcess(handle Handle, exitcode *uint32) (err error) -//sys GetStartupInfo(startupInfo *StartupInfo) (err error) = GetStartupInfoW +//sys getStartupInfo(startupInfo *StartupInfo) = GetStartupInfoW //sys GetProcessTimes(handle Handle, creationTime *Filetime, exitTime *Filetime, kernelTime *Filetime, userTime *Filetime) (err error) //sys DuplicateHandle(hSourceProcessHandle Handle, hSourceHandle Handle, hTargetProcessHandle Handle, lpTargetHandle *Handle, dwDesiredAccess uint32, bInheritHandle bool, dwOptions uint32) (err error) //sys WaitForSingleObject(handle Handle, waitMilliseconds uint32) (event uint32, err error) [failretval==0xffffffff] @@ -405,7 +405,7 @@ func NewCallbackCDecl(fn interface{}) uintptr { //sys VerQueryValue(block unsafe.Pointer, subBlock string, pointerToBufferPointer unsafe.Pointer, bufSize *uint32) (err error) = version.VerQueryValueW // Process Status API (PSAPI) -//sys EnumProcesses(processIds []uint32, bytesReturned *uint32) (err error) = psapi.EnumProcesses +//sys enumProcesses(processIds *uint32, nSize uint32, bytesReturned *uint32) (err error) = psapi.EnumProcesses //sys EnumProcessModules(process Handle, module *Handle, cb uint32, cbNeeded *uint32) (err error) = psapi.EnumProcessModules //sys EnumProcessModulesEx(process Handle, module *Handle, cb uint32, cbNeeded *uint32, filterFlag uint32) (err error) = psapi.EnumProcessModulesEx //sys GetModuleInformation(process Handle, module Handle, modinfo *ModuleInfo, cb uint32) (err error) = psapi.GetModuleInformation @@ -437,6 +437,10 @@ func NewCallbackCDecl(fn interface{}) uintptr { //sys DwmGetWindowAttribute(hwnd HWND, attribute uint32, value unsafe.Pointer, size uint32) (ret error) = dwmapi.DwmGetWindowAttribute //sys DwmSetWindowAttribute(hwnd HWND, attribute uint32, value unsafe.Pointer, size uint32) (ret error) = dwmapi.DwmSetWindowAttribute +// Windows Multimedia API +//sys TimeBeginPeriod (period uint32) (err error) [failretval != 0] = winmm.timeBeginPeriod +//sys TimeEndPeriod (period uint32) (err error) [failretval != 0] = winmm.timeEndPeriod + // syscall interface implementation for other packages // GetCurrentProcess returns the handle for the current process. @@ -1354,6 +1358,17 @@ func SetsockoptIPv6Mreq(fd Handle, level, opt int, mreq *IPv6Mreq) (err error) { return syscall.EWINDOWS } +func EnumProcesses(processIds []uint32, bytesReturned *uint32) error { + // EnumProcesses syscall expects the size parameter to be in bytes, but the code generated with mksyscall uses + // the length of the processIds slice instead. Hence, this wrapper function is added to fix the discrepancy. + var p *uint32 + if len(processIds) > 0 { + p = &processIds[0] + } + size := uint32(len(processIds) * 4) + return enumProcesses(p, size, bytesReturned) +} + func Getpid() (pid int) { return int(GetCurrentProcessId()) } func FindFirstFile(name *uint16, data *Win32finddata) (handle Handle, err error) { @@ -1613,6 +1628,11 @@ func SetConsoleCursorPosition(console Handle, position Coord) error { return setConsoleCursorPosition(console, *((*uint32)(unsafe.Pointer(&position)))) } +func GetStartupInfo(startupInfo *StartupInfo) error { + getStartupInfo(startupInfo) + return nil +} + func (s NTStatus) Errno() syscall.Errno { return rtlNtStatusToDosErrorNoTeb(s) } diff --git a/vendor/golang.org/x/sys/windows/zsyscall_windows.go b/vendor/golang.org/x/sys/windows/zsyscall_windows.go index a81ea2c7..5c385580 100644 --- a/vendor/golang.org/x/sys/windows/zsyscall_windows.go +++ b/vendor/golang.org/x/sys/windows/zsyscall_windows.go @@ -55,6 +55,7 @@ var ( moduser32 = NewLazySystemDLL("user32.dll") moduserenv = NewLazySystemDLL("userenv.dll") modversion = NewLazySystemDLL("version.dll") + modwinmm = NewLazySystemDLL("winmm.dll") modwintrust = NewLazySystemDLL("wintrust.dll") modws2_32 = NewLazySystemDLL("ws2_32.dll") modwtsapi32 = NewLazySystemDLL("wtsapi32.dll") @@ -468,6 +469,8 @@ var ( procGetFileVersionInfoSizeW = modversion.NewProc("GetFileVersionInfoSizeW") procGetFileVersionInfoW = modversion.NewProc("GetFileVersionInfoW") procVerQueryValueW = modversion.NewProc("VerQueryValueW") + proctimeBeginPeriod = modwinmm.NewProc("timeBeginPeriod") + proctimeEndPeriod = modwinmm.NewProc("timeEndPeriod") procWinVerifyTrustEx = modwintrust.NewProc("WinVerifyTrustEx") procFreeAddrInfoW = modws2_32.NewProc("FreeAddrInfoW") procGetAddrInfoW = modws2_32.NewProc("GetAddrInfoW") @@ -2367,11 +2370,8 @@ func GetShortPathName(longpath *uint16, shortpath *uint16, buflen uint32) (n uin return } -func GetStartupInfo(startupInfo *StartupInfo) (err error) { - r1, _, e1 := syscall.Syscall(procGetStartupInfoW.Addr(), 1, uintptr(unsafe.Pointer(startupInfo)), 0, 0) - if r1 == 0 { - err = errnoErr(e1) - } +func getStartupInfo(startupInfo *StartupInfo) { + syscall.Syscall(procGetStartupInfoW.Addr(), 1, uintptr(unsafe.Pointer(startupInfo)), 0, 0) return } @@ -3516,12 +3516,8 @@ func EnumProcessModulesEx(process Handle, module *Handle, cb uint32, cbNeeded *u return } -func EnumProcesses(processIds []uint32, bytesReturned *uint32) (err error) { - var _p0 *uint32 - if len(processIds) > 0 { - _p0 = &processIds[0] - } - r1, _, e1 := syscall.Syscall(procEnumProcesses.Addr(), 3, uintptr(unsafe.Pointer(_p0)), uintptr(len(processIds)), uintptr(unsafe.Pointer(bytesReturned))) +func enumProcesses(processIds *uint32, nSize uint32, bytesReturned *uint32) (err error) { + r1, _, e1 := syscall.Syscall(procEnumProcesses.Addr(), 3, uintptr(unsafe.Pointer(processIds)), uintptr(nSize), uintptr(unsafe.Pointer(bytesReturned))) if r1 == 0 { err = errnoErr(e1) } @@ -4021,6 +4017,22 @@ func _VerQueryValue(block unsafe.Pointer, subBlock *uint16, pointerToBufferPoint return } +func TimeBeginPeriod(period uint32) (err error) { + r1, _, e1 := syscall.Syscall(proctimeBeginPeriod.Addr(), 1, uintptr(period), 0, 0) + if r1 != 0 { + err = errnoErr(e1) + } + return +} + +func TimeEndPeriod(period uint32) (err error) { + r1, _, e1 := syscall.Syscall(proctimeEndPeriod.Addr(), 1, uintptr(period), 0, 0) + if r1 != 0 { + err = errnoErr(e1) + } + return +} + func WinVerifyTrustEx(hwnd HWND, actionId *GUID, data *WinTrustData) (ret error) { r0, _, _ := syscall.Syscall(procWinVerifyTrustEx.Addr(), 3, uintptr(hwnd), uintptr(unsafe.Pointer(actionId)), uintptr(unsafe.Pointer(data))) if r0 != 0 { diff --git a/vendor/golang.org/x/term/term_unix.go b/vendor/golang.org/x/term/term_unix.go index a4e31ab1..62c2b3f4 100644 --- a/vendor/golang.org/x/term/term_unix.go +++ b/vendor/golang.org/x/term/term_unix.go @@ -60,7 +60,7 @@ func restore(fd int, state *State) error { func getSize(fd int) (width, height int, err error) { ws, err := unix.IoctlGetWinsize(fd, unix.TIOCGWINSZ) if err != nil { - return -1, -1, err + return 0, 0, err } return int(ws.Col), int(ws.Row), nil } diff --git a/vendor/golang.org/x/text/internal/language/compact/tables.go b/vendor/golang.org/x/text/internal/language/compact/tables.go index 32af9de5..a09ed198 100644 --- a/vendor/golang.org/x/text/internal/language/compact/tables.go +++ b/vendor/golang.org/x/text/internal/language/compact/tables.go @@ -790,226 +790,226 @@ const ( var coreTags = []language.CompactCoreInfo{ // 773 elements // Entry 0 - 1F - 0x00000000, 0x01600000, 0x016000d2, 0x01600161, - 0x01c00000, 0x01c00052, 0x02100000, 0x02100080, - 0x02700000, 0x0270006f, 0x03a00000, 0x03a00001, - 0x03a00023, 0x03a00039, 0x03a00062, 0x03a00067, - 0x03a0006b, 0x03a0006c, 0x03a0006d, 0x03a00097, - 0x03a0009b, 0x03a000a1, 0x03a000a8, 0x03a000ac, - 0x03a000b0, 0x03a000b9, 0x03a000ba, 0x03a000c9, - 0x03a000e1, 0x03a000ed, 0x03a000f3, 0x03a00108, + 0x00000000, 0x01600000, 0x016000d3, 0x01600162, + 0x01c00000, 0x01c00052, 0x02100000, 0x02100081, + 0x02700000, 0x02700070, 0x03a00000, 0x03a00001, + 0x03a00023, 0x03a00039, 0x03a00063, 0x03a00068, + 0x03a0006c, 0x03a0006d, 0x03a0006e, 0x03a00098, + 0x03a0009c, 0x03a000a2, 0x03a000a9, 0x03a000ad, + 0x03a000b1, 0x03a000ba, 0x03a000bb, 0x03a000ca, + 0x03a000e2, 0x03a000ee, 0x03a000f4, 0x03a00109, // Entry 20 - 3F - 0x03a0010b, 0x03a00115, 0x03a00117, 0x03a0011c, - 0x03a00120, 0x03a00128, 0x03a0015e, 0x04000000, - 0x04300000, 0x04300099, 0x04400000, 0x0440012f, - 0x04800000, 0x0480006e, 0x05800000, 0x05820000, - 0x05820032, 0x0585a000, 0x0585a032, 0x05e00000, + 0x03a0010c, 0x03a00116, 0x03a00118, 0x03a0011d, + 0x03a00121, 0x03a00129, 0x03a0015f, 0x04000000, + 0x04300000, 0x0430009a, 0x04400000, 0x04400130, + 0x04800000, 0x0480006f, 0x05800000, 0x05820000, + 0x05820032, 0x0585b000, 0x0585b032, 0x05e00000, 0x05e00052, 0x07100000, 0x07100047, 0x07500000, - 0x07500162, 0x07900000, 0x0790012f, 0x07e00000, - 0x07e00038, 0x08200000, 0x0a000000, 0x0a0000c3, + 0x07500163, 0x07900000, 0x07900130, 0x07e00000, + 0x07e00038, 0x08200000, 0x0a000000, 0x0a0000c4, // Entry 40 - 5F - 0x0a500000, 0x0a500035, 0x0a500099, 0x0a900000, - 0x0a900053, 0x0a900099, 0x0b200000, 0x0b200078, - 0x0b500000, 0x0b500099, 0x0b700000, 0x0b720000, - 0x0b720033, 0x0b75a000, 0x0b75a033, 0x0d700000, - 0x0d700022, 0x0d70006e, 0x0d700078, 0x0d70009e, - 0x0db00000, 0x0db00035, 0x0db00099, 0x0dc00000, - 0x0dc00106, 0x0df00000, 0x0df00131, 0x0e500000, - 0x0e500135, 0x0e900000, 0x0e90009b, 0x0e90009c, + 0x0a500000, 0x0a500035, 0x0a50009a, 0x0a900000, + 0x0a900053, 0x0a90009a, 0x0b200000, 0x0b200079, + 0x0b500000, 0x0b50009a, 0x0b700000, 0x0b720000, + 0x0b720033, 0x0b75b000, 0x0b75b033, 0x0d700000, + 0x0d700022, 0x0d70006f, 0x0d700079, 0x0d70009f, + 0x0db00000, 0x0db00035, 0x0db0009a, 0x0dc00000, + 0x0dc00107, 0x0df00000, 0x0df00132, 0x0e500000, + 0x0e500136, 0x0e900000, 0x0e90009c, 0x0e90009d, // Entry 60 - 7F - 0x0fa00000, 0x0fa0005e, 0x0fe00000, 0x0fe00106, - 0x10000000, 0x1000007b, 0x10100000, 0x10100063, - 0x10100082, 0x10800000, 0x108000a4, 0x10d00000, - 0x10d0002e, 0x10d00036, 0x10d0004e, 0x10d00060, - 0x10d0009e, 0x10d000b2, 0x10d000b7, 0x11700000, - 0x117000d4, 0x11f00000, 0x11f00060, 0x12400000, - 0x12400052, 0x12800000, 0x12b00000, 0x12b00114, - 0x12d00000, 0x12d00043, 0x12f00000, 0x12f000a4, + 0x0fa00000, 0x0fa0005f, 0x0fe00000, 0x0fe00107, + 0x10000000, 0x1000007c, 0x10100000, 0x10100064, + 0x10100083, 0x10800000, 0x108000a5, 0x10d00000, + 0x10d0002e, 0x10d00036, 0x10d0004e, 0x10d00061, + 0x10d0009f, 0x10d000b3, 0x10d000b8, 0x11700000, + 0x117000d5, 0x11f00000, 0x11f00061, 0x12400000, + 0x12400052, 0x12800000, 0x12b00000, 0x12b00115, + 0x12d00000, 0x12d00043, 0x12f00000, 0x12f000a5, // Entry 80 - 9F - 0x13000000, 0x13000080, 0x13000122, 0x13600000, - 0x1360005d, 0x13600087, 0x13900000, 0x13900001, + 0x13000000, 0x13000081, 0x13000123, 0x13600000, + 0x1360005e, 0x13600088, 0x13900000, 0x13900001, 0x1390001a, 0x13900025, 0x13900026, 0x1390002d, 0x1390002e, 0x1390002f, 0x13900034, 0x13900036, 0x1390003a, 0x1390003d, 0x13900042, 0x13900046, 0x13900048, 0x13900049, 0x1390004a, 0x1390004e, - 0x13900050, 0x13900052, 0x1390005c, 0x1390005d, - 0x13900060, 0x13900061, 0x13900063, 0x13900064, + 0x13900050, 0x13900052, 0x1390005d, 0x1390005e, + 0x13900061, 0x13900062, 0x13900064, 0x13900065, // Entry A0 - BF - 0x1390006d, 0x13900072, 0x13900073, 0x13900074, - 0x13900075, 0x1390007b, 0x1390007c, 0x1390007f, - 0x13900080, 0x13900081, 0x13900083, 0x1390008a, - 0x1390008c, 0x1390008d, 0x13900096, 0x13900097, - 0x13900098, 0x13900099, 0x1390009a, 0x1390009f, - 0x139000a0, 0x139000a4, 0x139000a7, 0x139000a9, - 0x139000ad, 0x139000b1, 0x139000b4, 0x139000b5, - 0x139000bf, 0x139000c0, 0x139000c6, 0x139000c7, + 0x1390006e, 0x13900073, 0x13900074, 0x13900075, + 0x13900076, 0x1390007c, 0x1390007d, 0x13900080, + 0x13900081, 0x13900082, 0x13900084, 0x1390008b, + 0x1390008d, 0x1390008e, 0x13900097, 0x13900098, + 0x13900099, 0x1390009a, 0x1390009b, 0x139000a0, + 0x139000a1, 0x139000a5, 0x139000a8, 0x139000aa, + 0x139000ae, 0x139000b2, 0x139000b5, 0x139000b6, + 0x139000c0, 0x139000c1, 0x139000c7, 0x139000c8, // Entry C0 - DF - 0x139000ca, 0x139000cb, 0x139000cc, 0x139000ce, - 0x139000d0, 0x139000d2, 0x139000d5, 0x139000d6, - 0x139000d9, 0x139000dd, 0x139000df, 0x139000e0, - 0x139000e6, 0x139000e7, 0x139000e8, 0x139000eb, - 0x139000ec, 0x139000f0, 0x13900107, 0x13900109, - 0x1390010a, 0x1390010b, 0x1390010c, 0x1390010d, - 0x1390010e, 0x1390010f, 0x13900112, 0x13900117, - 0x1390011b, 0x1390011d, 0x1390011f, 0x13900125, + 0x139000cb, 0x139000cc, 0x139000cd, 0x139000cf, + 0x139000d1, 0x139000d3, 0x139000d6, 0x139000d7, + 0x139000da, 0x139000de, 0x139000e0, 0x139000e1, + 0x139000e7, 0x139000e8, 0x139000e9, 0x139000ec, + 0x139000ed, 0x139000f1, 0x13900108, 0x1390010a, + 0x1390010b, 0x1390010c, 0x1390010d, 0x1390010e, + 0x1390010f, 0x13900110, 0x13900113, 0x13900118, + 0x1390011c, 0x1390011e, 0x13900120, 0x13900126, // Entry E0 - FF - 0x13900129, 0x1390012c, 0x1390012d, 0x1390012f, - 0x13900131, 0x13900133, 0x13900135, 0x13900139, - 0x1390013c, 0x1390013d, 0x1390013f, 0x13900142, - 0x13900161, 0x13900162, 0x13900164, 0x13c00000, + 0x1390012a, 0x1390012d, 0x1390012e, 0x13900130, + 0x13900132, 0x13900134, 0x13900136, 0x1390013a, + 0x1390013d, 0x1390013e, 0x13900140, 0x13900143, + 0x13900162, 0x13900163, 0x13900165, 0x13c00000, 0x13c00001, 0x13e00000, 0x13e0001f, 0x13e0002c, 0x13e0003f, 0x13e00041, 0x13e00048, 0x13e00051, - 0x13e00054, 0x13e00056, 0x13e00059, 0x13e00065, - 0x13e00068, 0x13e00069, 0x13e0006e, 0x13e00086, + 0x13e00054, 0x13e00057, 0x13e0005a, 0x13e00066, + 0x13e00069, 0x13e0006a, 0x13e0006f, 0x13e00087, // Entry 100 - 11F - 0x13e00089, 0x13e0008f, 0x13e00094, 0x13e000cf, - 0x13e000d8, 0x13e000e2, 0x13e000e4, 0x13e000e7, - 0x13e000ec, 0x13e000f1, 0x13e0011a, 0x13e00135, - 0x13e00136, 0x13e0013b, 0x14000000, 0x1400006a, - 0x14500000, 0x1450006e, 0x14600000, 0x14600052, - 0x14800000, 0x14800024, 0x1480009c, 0x14e00000, - 0x14e00052, 0x14e00084, 0x14e000c9, 0x14e00114, - 0x15100000, 0x15100072, 0x15300000, 0x153000e7, + 0x13e0008a, 0x13e00090, 0x13e00095, 0x13e000d0, + 0x13e000d9, 0x13e000e3, 0x13e000e5, 0x13e000e8, + 0x13e000ed, 0x13e000f2, 0x13e0011b, 0x13e00136, + 0x13e00137, 0x13e0013c, 0x14000000, 0x1400006b, + 0x14500000, 0x1450006f, 0x14600000, 0x14600052, + 0x14800000, 0x14800024, 0x1480009d, 0x14e00000, + 0x14e00052, 0x14e00085, 0x14e000ca, 0x14e00115, + 0x15100000, 0x15100073, 0x15300000, 0x153000e8, // Entry 120 - 13F - 0x15800000, 0x15800063, 0x15800076, 0x15e00000, + 0x15800000, 0x15800064, 0x15800077, 0x15e00000, 0x15e00036, 0x15e00037, 0x15e0003a, 0x15e0003b, 0x15e0003c, 0x15e00049, 0x15e0004b, 0x15e0004c, 0x15e0004d, 0x15e0004e, 0x15e0004f, 0x15e00052, - 0x15e00062, 0x15e00067, 0x15e00078, 0x15e0007a, - 0x15e0007e, 0x15e00084, 0x15e00085, 0x15e00086, - 0x15e00091, 0x15e000a8, 0x15e000b7, 0x15e000ba, - 0x15e000bb, 0x15e000be, 0x15e000bf, 0x15e000c3, + 0x15e00063, 0x15e00068, 0x15e00079, 0x15e0007b, + 0x15e0007f, 0x15e00085, 0x15e00086, 0x15e00087, + 0x15e00092, 0x15e000a9, 0x15e000b8, 0x15e000bb, + 0x15e000bc, 0x15e000bf, 0x15e000c0, 0x15e000c4, // Entry 140 - 15F - 0x15e000c8, 0x15e000c9, 0x15e000cc, 0x15e000d3, - 0x15e000d4, 0x15e000e5, 0x15e000ea, 0x15e00102, - 0x15e00107, 0x15e0010a, 0x15e00114, 0x15e0011c, - 0x15e00120, 0x15e00122, 0x15e00128, 0x15e0013f, - 0x15e00140, 0x15e0015f, 0x16900000, 0x1690009e, - 0x16d00000, 0x16d000d9, 0x16e00000, 0x16e00096, - 0x17e00000, 0x17e0007b, 0x19000000, 0x1900006e, - 0x1a300000, 0x1a30004e, 0x1a300078, 0x1a3000b2, + 0x15e000c9, 0x15e000ca, 0x15e000cd, 0x15e000d4, + 0x15e000d5, 0x15e000e6, 0x15e000eb, 0x15e00103, + 0x15e00108, 0x15e0010b, 0x15e00115, 0x15e0011d, + 0x15e00121, 0x15e00123, 0x15e00129, 0x15e00140, + 0x15e00141, 0x15e00160, 0x16900000, 0x1690009f, + 0x16d00000, 0x16d000da, 0x16e00000, 0x16e00097, + 0x17e00000, 0x17e0007c, 0x19000000, 0x1900006f, + 0x1a300000, 0x1a30004e, 0x1a300079, 0x1a3000b3, // Entry 160 - 17F - 0x1a400000, 0x1a400099, 0x1a900000, 0x1ab00000, - 0x1ab000a4, 0x1ac00000, 0x1ac00098, 0x1b400000, - 0x1b400080, 0x1b4000d4, 0x1b4000d6, 0x1b800000, - 0x1b800135, 0x1bc00000, 0x1bc00097, 0x1be00000, - 0x1be00099, 0x1d100000, 0x1d100033, 0x1d100090, - 0x1d200000, 0x1d200060, 0x1d500000, 0x1d500092, - 0x1d700000, 0x1d700028, 0x1e100000, 0x1e100095, - 0x1e700000, 0x1e7000d6, 0x1ea00000, 0x1ea00053, + 0x1a400000, 0x1a40009a, 0x1a900000, 0x1ab00000, + 0x1ab000a5, 0x1ac00000, 0x1ac00099, 0x1b400000, + 0x1b400081, 0x1b4000d5, 0x1b4000d7, 0x1b800000, + 0x1b800136, 0x1bc00000, 0x1bc00098, 0x1be00000, + 0x1be0009a, 0x1d100000, 0x1d100033, 0x1d100091, + 0x1d200000, 0x1d200061, 0x1d500000, 0x1d500093, + 0x1d700000, 0x1d700028, 0x1e100000, 0x1e100096, + 0x1e700000, 0x1e7000d7, 0x1ea00000, 0x1ea00053, // Entry 180 - 19F - 0x1f300000, 0x1f500000, 0x1f800000, 0x1f80009d, - 0x1f900000, 0x1f90004e, 0x1f90009e, 0x1f900113, - 0x1f900138, 0x1fa00000, 0x1fb00000, 0x20000000, - 0x200000a2, 0x20300000, 0x20700000, 0x20700052, - 0x20800000, 0x20a00000, 0x20a0012f, 0x20e00000, - 0x20f00000, 0x21000000, 0x2100007d, 0x21200000, - 0x21200067, 0x21600000, 0x21700000, 0x217000a4, - 0x21f00000, 0x22300000, 0x2230012f, 0x22700000, + 0x1f300000, 0x1f500000, 0x1f800000, 0x1f80009e, + 0x1f900000, 0x1f90004e, 0x1f90009f, 0x1f900114, + 0x1f900139, 0x1fa00000, 0x1fb00000, 0x20000000, + 0x200000a3, 0x20300000, 0x20700000, 0x20700052, + 0x20800000, 0x20a00000, 0x20a00130, 0x20e00000, + 0x20f00000, 0x21000000, 0x2100007e, 0x21200000, + 0x21200068, 0x21600000, 0x21700000, 0x217000a5, + 0x21f00000, 0x22300000, 0x22300130, 0x22700000, // Entry 1A0 - 1BF - 0x2270005a, 0x23400000, 0x234000c3, 0x23900000, - 0x239000a4, 0x24200000, 0x242000ae, 0x24400000, - 0x24400052, 0x24500000, 0x24500082, 0x24600000, - 0x246000a4, 0x24a00000, 0x24a000a6, 0x25100000, - 0x25100099, 0x25400000, 0x254000aa, 0x254000ab, - 0x25600000, 0x25600099, 0x26a00000, 0x26a00099, - 0x26b00000, 0x26b0012f, 0x26d00000, 0x26d00052, - 0x26e00000, 0x26e00060, 0x27400000, 0x28100000, + 0x2270005b, 0x23400000, 0x234000c4, 0x23900000, + 0x239000a5, 0x24200000, 0x242000af, 0x24400000, + 0x24400052, 0x24500000, 0x24500083, 0x24600000, + 0x246000a5, 0x24a00000, 0x24a000a7, 0x25100000, + 0x2510009a, 0x25400000, 0x254000ab, 0x254000ac, + 0x25600000, 0x2560009a, 0x26a00000, 0x26a0009a, + 0x26b00000, 0x26b00130, 0x26d00000, 0x26d00052, + 0x26e00000, 0x26e00061, 0x27400000, 0x28100000, // Entry 1C0 - 1DF - 0x2810007b, 0x28a00000, 0x28a000a5, 0x29100000, - 0x2910012f, 0x29500000, 0x295000b7, 0x2a300000, - 0x2a300131, 0x2af00000, 0x2af00135, 0x2b500000, + 0x2810007c, 0x28a00000, 0x28a000a6, 0x29100000, + 0x29100130, 0x29500000, 0x295000b8, 0x2a300000, + 0x2a300132, 0x2af00000, 0x2af00136, 0x2b500000, 0x2b50002a, 0x2b50004b, 0x2b50004c, 0x2b50004d, - 0x2b800000, 0x2b8000af, 0x2bf00000, 0x2bf0009b, - 0x2bf0009c, 0x2c000000, 0x2c0000b6, 0x2c200000, - 0x2c20004b, 0x2c400000, 0x2c4000a4, 0x2c500000, - 0x2c5000a4, 0x2c700000, 0x2c7000b8, 0x2d100000, + 0x2b800000, 0x2b8000b0, 0x2bf00000, 0x2bf0009c, + 0x2bf0009d, 0x2c000000, 0x2c0000b7, 0x2c200000, + 0x2c20004b, 0x2c400000, 0x2c4000a5, 0x2c500000, + 0x2c5000a5, 0x2c700000, 0x2c7000b9, 0x2d100000, // Entry 1E0 - 1FF - 0x2d1000a4, 0x2d10012f, 0x2e900000, 0x2e9000a4, - 0x2ed00000, 0x2ed000cc, 0x2f100000, 0x2f1000bf, - 0x2f200000, 0x2f2000d1, 0x2f400000, 0x2f400052, - 0x2ff00000, 0x2ff000c2, 0x30400000, 0x30400099, - 0x30b00000, 0x30b000c5, 0x31000000, 0x31b00000, - 0x31b00099, 0x31f00000, 0x31f0003e, 0x31f000d0, - 0x31f0010d, 0x32000000, 0x320000cb, 0x32500000, - 0x32500052, 0x33100000, 0x331000c4, 0x33a00000, + 0x2d1000a5, 0x2d100130, 0x2e900000, 0x2e9000a5, + 0x2ed00000, 0x2ed000cd, 0x2f100000, 0x2f1000c0, + 0x2f200000, 0x2f2000d2, 0x2f400000, 0x2f400052, + 0x2ff00000, 0x2ff000c3, 0x30400000, 0x3040009a, + 0x30b00000, 0x30b000c6, 0x31000000, 0x31b00000, + 0x31b0009a, 0x31f00000, 0x31f0003e, 0x31f000d1, + 0x31f0010e, 0x32000000, 0x320000cc, 0x32500000, + 0x32500052, 0x33100000, 0x331000c5, 0x33a00000, // Entry 200 - 21F - 0x33a0009c, 0x34100000, 0x34500000, 0x345000d2, - 0x34700000, 0x347000da, 0x34700110, 0x34e00000, - 0x34e00164, 0x35000000, 0x35000060, 0x350000d9, - 0x35100000, 0x35100099, 0x351000db, 0x36700000, - 0x36700030, 0x36700036, 0x36700040, 0x3670005b, - 0x367000d9, 0x36700116, 0x3670011b, 0x36800000, - 0x36800052, 0x36a00000, 0x36a000da, 0x36c00000, + 0x33a0009d, 0x34100000, 0x34500000, 0x345000d3, + 0x34700000, 0x347000db, 0x34700111, 0x34e00000, + 0x34e00165, 0x35000000, 0x35000061, 0x350000da, + 0x35100000, 0x3510009a, 0x351000dc, 0x36700000, + 0x36700030, 0x36700036, 0x36700040, 0x3670005c, + 0x367000da, 0x36700117, 0x3670011c, 0x36800000, + 0x36800052, 0x36a00000, 0x36a000db, 0x36c00000, 0x36c00052, 0x36f00000, 0x37500000, 0x37600000, // Entry 220 - 23F - 0x37a00000, 0x38000000, 0x38000117, 0x38700000, - 0x38900000, 0x38900131, 0x39000000, 0x3900006f, - 0x390000a4, 0x39500000, 0x39500099, 0x39800000, - 0x3980007d, 0x39800106, 0x39d00000, 0x39d05000, - 0x39d050e8, 0x39d36000, 0x39d36099, 0x3a100000, - 0x3b300000, 0x3b3000e9, 0x3bd00000, 0x3bd00001, + 0x37a00000, 0x38000000, 0x38000118, 0x38700000, + 0x38900000, 0x38900132, 0x39000000, 0x39000070, + 0x390000a5, 0x39500000, 0x3950009a, 0x39800000, + 0x3980007e, 0x39800107, 0x39d00000, 0x39d05000, + 0x39d050e9, 0x39d36000, 0x39d3609a, 0x3a100000, + 0x3b300000, 0x3b3000ea, 0x3bd00000, 0x3bd00001, 0x3be00000, 0x3be00024, 0x3c000000, 0x3c00002a, - 0x3c000041, 0x3c00004e, 0x3c00005a, 0x3c000086, + 0x3c000041, 0x3c00004e, 0x3c00005b, 0x3c000087, // Entry 240 - 25F - 0x3c00008b, 0x3c0000b7, 0x3c0000c6, 0x3c0000d1, - 0x3c0000ee, 0x3c000118, 0x3c000126, 0x3c400000, - 0x3c40003f, 0x3c400069, 0x3c4000e4, 0x3d400000, + 0x3c00008c, 0x3c0000b8, 0x3c0000c7, 0x3c0000d2, + 0x3c0000ef, 0x3c000119, 0x3c000127, 0x3c400000, + 0x3c40003f, 0x3c40006a, 0x3c4000e5, 0x3d400000, 0x3d40004e, 0x3d900000, 0x3d90003a, 0x3dc00000, - 0x3dc000bc, 0x3dc00104, 0x3de00000, 0x3de0012f, - 0x3e200000, 0x3e200047, 0x3e2000a5, 0x3e2000ae, - 0x3e2000bc, 0x3e200106, 0x3e200130, 0x3e500000, - 0x3e500107, 0x3e600000, 0x3e60012f, 0x3eb00000, + 0x3dc000bd, 0x3dc00105, 0x3de00000, 0x3de00130, + 0x3e200000, 0x3e200047, 0x3e2000a6, 0x3e2000af, + 0x3e2000bd, 0x3e200107, 0x3e200131, 0x3e500000, + 0x3e500108, 0x3e600000, 0x3e600130, 0x3eb00000, // Entry 260 - 27F - 0x3eb00106, 0x3ec00000, 0x3ec000a4, 0x3f300000, - 0x3f30012f, 0x3fa00000, 0x3fa000e8, 0x3fc00000, - 0x3fd00000, 0x3fd00072, 0x3fd000da, 0x3fd0010c, - 0x3ff00000, 0x3ff000d1, 0x40100000, 0x401000c3, + 0x3eb00107, 0x3ec00000, 0x3ec000a5, 0x3f300000, + 0x3f300130, 0x3fa00000, 0x3fa000e9, 0x3fc00000, + 0x3fd00000, 0x3fd00073, 0x3fd000db, 0x3fd0010d, + 0x3ff00000, 0x3ff000d2, 0x40100000, 0x401000c4, 0x40200000, 0x4020004c, 0x40700000, 0x40800000, - 0x4085a000, 0x4085a0ba, 0x408e8000, 0x408e80ba, - 0x40c00000, 0x40c000b3, 0x41200000, 0x41200111, - 0x41600000, 0x4160010f, 0x41c00000, 0x41d00000, + 0x4085b000, 0x4085b0bb, 0x408eb000, 0x408eb0bb, + 0x40c00000, 0x40c000b4, 0x41200000, 0x41200112, + 0x41600000, 0x41600110, 0x41c00000, 0x41d00000, // Entry 280 - 29F - 0x41e00000, 0x41f00000, 0x41f00072, 0x42200000, - 0x42300000, 0x42300164, 0x42900000, 0x42900062, - 0x4290006f, 0x429000a4, 0x42900115, 0x43100000, - 0x43100027, 0x431000c2, 0x4310014d, 0x43200000, - 0x43220000, 0x43220033, 0x432200bd, 0x43220105, - 0x4322014d, 0x4325a000, 0x4325a033, 0x4325a0bd, - 0x4325a105, 0x4325a14d, 0x43700000, 0x43a00000, - 0x43b00000, 0x44400000, 0x44400031, 0x44400072, + 0x41e00000, 0x41f00000, 0x41f00073, 0x42200000, + 0x42300000, 0x42300165, 0x42900000, 0x42900063, + 0x42900070, 0x429000a5, 0x42900116, 0x43100000, + 0x43100027, 0x431000c3, 0x4310014e, 0x43200000, + 0x43220000, 0x43220033, 0x432200be, 0x43220106, + 0x4322014e, 0x4325b000, 0x4325b033, 0x4325b0be, + 0x4325b106, 0x4325b14e, 0x43700000, 0x43a00000, + 0x43b00000, 0x44400000, 0x44400031, 0x44400073, // Entry 2A0 - 2BF - 0x4440010c, 0x44500000, 0x4450004b, 0x445000a4, - 0x4450012f, 0x44500131, 0x44e00000, 0x45000000, - 0x45000099, 0x450000b3, 0x450000d0, 0x4500010d, - 0x46100000, 0x46100099, 0x46400000, 0x464000a4, - 0x46400131, 0x46700000, 0x46700124, 0x46b00000, - 0x46b00123, 0x46f00000, 0x46f0006d, 0x46f0006f, - 0x47100000, 0x47600000, 0x47600127, 0x47a00000, - 0x48000000, 0x48200000, 0x48200129, 0x48a00000, + 0x4440010d, 0x44500000, 0x4450004b, 0x445000a5, + 0x44500130, 0x44500132, 0x44e00000, 0x45000000, + 0x4500009a, 0x450000b4, 0x450000d1, 0x4500010e, + 0x46100000, 0x4610009a, 0x46400000, 0x464000a5, + 0x46400132, 0x46700000, 0x46700125, 0x46b00000, + 0x46b00124, 0x46f00000, 0x46f0006e, 0x46f00070, + 0x47100000, 0x47600000, 0x47600128, 0x47a00000, + 0x48000000, 0x48200000, 0x4820012a, 0x48a00000, // Entry 2C0 - 2DF - 0x48a0005d, 0x48a0012b, 0x48e00000, 0x49400000, - 0x49400106, 0x4a400000, 0x4a4000d4, 0x4a900000, - 0x4a9000ba, 0x4ac00000, 0x4ac00053, 0x4ae00000, - 0x4ae00130, 0x4b400000, 0x4b400099, 0x4b4000e8, + 0x48a0005e, 0x48a0012c, 0x48e00000, 0x49400000, + 0x49400107, 0x4a400000, 0x4a4000d5, 0x4a900000, + 0x4a9000bb, 0x4ac00000, 0x4ac00053, 0x4ae00000, + 0x4ae00131, 0x4b400000, 0x4b40009a, 0x4b4000e9, 0x4bc00000, 0x4bc05000, 0x4bc05024, 0x4bc20000, - 0x4bc20137, 0x4bc5a000, 0x4bc5a137, 0x4be00000, - 0x4be5a000, 0x4be5a0b4, 0x4bef1000, 0x4bef10b4, - 0x4c000000, 0x4c300000, 0x4c30013e, 0x4c900000, + 0x4bc20138, 0x4bc5b000, 0x4bc5b138, 0x4be00000, + 0x4be5b000, 0x4be5b0b5, 0x4bef4000, 0x4bef40b5, + 0x4c000000, 0x4c300000, 0x4c30013f, 0x4c900000, // Entry 2E0 - 2FF - 0x4c900001, 0x4cc00000, 0x4cc0012f, 0x4ce00000, - 0x4cf00000, 0x4cf0004e, 0x4e500000, 0x4e500114, - 0x4f200000, 0x4fb00000, 0x4fb00131, 0x50900000, + 0x4c900001, 0x4cc00000, 0x4cc00130, 0x4ce00000, + 0x4cf00000, 0x4cf0004e, 0x4e500000, 0x4e500115, + 0x4f200000, 0x4fb00000, 0x4fb00132, 0x50900000, 0x50900052, 0x51200000, 0x51200001, 0x51800000, - 0x5180003b, 0x518000d6, 0x51f00000, 0x51f3b000, - 0x51f3b053, 0x51f3c000, 0x51f3c08d, 0x52800000, - 0x528000ba, 0x52900000, 0x5293b000, 0x5293b053, - 0x5293b08d, 0x5293b0c6, 0x5293b10d, 0x5293c000, + 0x5180003b, 0x518000d7, 0x51f00000, 0x51f3b000, + 0x51f3b053, 0x51f3c000, 0x51f3c08e, 0x52800000, + 0x528000bb, 0x52900000, 0x5293b000, 0x5293b053, + 0x5293b08e, 0x5293b0c7, 0x5293b10e, 0x5293c000, // Entry 300 - 31F - 0x5293c08d, 0x5293c0c6, 0x5293c12e, 0x52f00000, - 0x52f00161, + 0x5293c08e, 0x5293c0c7, 0x5293c12f, 0x52f00000, + 0x52f00162, } // Size: 3116 bytes const specialTagsStr string = "ca-ES-valencia en-US-u-va-posix" -// Total table size 3147 bytes (3KiB); checksum: 6772C83C +// Total table size 3147 bytes (3KiB); checksum: 5A8FFFA5 diff --git a/vendor/golang.org/x/text/internal/language/tables.go b/vendor/golang.org/x/text/internal/language/tables.go index fb6b5837..14167e74 100644 --- a/vendor/golang.org/x/text/internal/language/tables.go +++ b/vendor/golang.org/x/text/internal/language/tables.go @@ -7,11 +7,11 @@ import "golang.org/x/text/internal/tag" // CLDRVersion is the CLDR version from which the tables in this package are derived. const CLDRVersion = "32" -const NumLanguages = 8752 +const NumLanguages = 8798 -const NumScripts = 258 +const NumScripts = 261 -const NumRegions = 357 +const NumRegions = 358 type FromTo struct { From uint16 @@ -263,7 +263,7 @@ var langNoIndex = [2197]uint8{ 0xff, 0xf8, 0xed, 0xfe, 0xeb, 0xd3, 0x3b, 0xd2, 0xfb, 0xbf, 0x7a, 0xfa, 0x37, 0x1d, 0x3c, 0x57, 0x6e, 0x97, 0x73, 0x38, 0xfb, 0xea, 0xbf, 0x70, - 0xad, 0x03, 0xff, 0xff, 0xcf, 0x05, 0x84, 0x62, + 0xad, 0x03, 0xff, 0xff, 0xcf, 0x05, 0x84, 0x72, 0xe9, 0xbf, 0xfd, 0xbf, 0xbf, 0xf7, 0xfd, 0x77, 0x0f, 0xff, 0xef, 0x6f, 0xff, 0xfb, 0xdf, 0xe2, 0xc9, 0xf8, 0x7f, 0x7e, 0x4d, 0xbc, 0x0a, 0x6a, @@ -278,7 +278,7 @@ var langNoIndex = [2197]uint8{ 0xa8, 0xff, 0x1f, 0x67, 0x7d, 0xeb, 0xef, 0xce, 0xff, 0xff, 0x9f, 0xff, 0xb7, 0xef, 0xfe, 0xcf, // Entry 80 - BF - 0xdb, 0xff, 0xf3, 0xcd, 0xfb, 0x6f, 0xff, 0xff, + 0xdb, 0xff, 0xf3, 0xcd, 0xfb, 0x7f, 0xff, 0xff, 0xbb, 0xee, 0xf7, 0xbd, 0xdb, 0xff, 0x5f, 0xf7, 0xfd, 0xf2, 0xfd, 0xff, 0x5e, 0x2f, 0x3b, 0xba, 0x7e, 0xff, 0xff, 0xfe, 0xf7, 0xff, 0xdd, 0xff, @@ -289,11 +289,11 @@ var langNoIndex = [2197]uint8{ // Entry C0 - FF 0xfb, 0x4a, 0xf2, 0x9f, 0xb4, 0x42, 0x41, 0x96, 0x1b, 0x14, 0x08, 0xf3, 0x2b, 0xe7, 0x17, 0x56, - 0x05, 0x7d, 0x0e, 0x1c, 0x37, 0x7b, 0xf3, 0xef, + 0x05, 0x7d, 0x0e, 0x1c, 0x37, 0x7f, 0xf3, 0xef, 0x97, 0xff, 0x5d, 0x38, 0x64, 0x08, 0x00, 0x10, 0xbc, 0x85, 0xaf, 0xdf, 0xff, 0xff, 0x7b, 0x35, 0x3e, 0xc7, 0xc7, 0xdf, 0xff, 0x01, 0x81, 0x00, - 0xb0, 0x05, 0x80, 0x00, 0x00, 0x00, 0x00, 0x03, + 0xb0, 0x05, 0x80, 0x00, 0x20, 0x00, 0x00, 0x03, 0x40, 0x00, 0x40, 0x92, 0x21, 0x50, 0xb1, 0x5d, // Entry 100 - 13F 0xfd, 0xdc, 0xbe, 0x5e, 0x00, 0x00, 0x02, 0x64, @@ -303,20 +303,20 @@ var langNoIndex = [2197]uint8{ 0x86, 0x00, 0xd1, 0x00, 0xf0, 0xc7, 0x67, 0x5f, 0x56, 0x99, 0x5e, 0xb5, 0x6c, 0xaf, 0x03, 0x00, 0x02, 0x00, 0x00, 0x00, 0xc0, 0x37, 0xda, 0x56, - 0x90, 0x69, 0x01, 0x2c, 0x96, 0x69, 0x20, 0xfb, + 0x90, 0x6d, 0x01, 0x2e, 0x96, 0x69, 0x20, 0xfb, // Entry 140 - 17F 0xff, 0x3f, 0x00, 0x00, 0x00, 0x01, 0x0c, 0x16, - 0x03, 0x00, 0x00, 0xb0, 0x14, 0x03, 0x50, 0x06, + 0x03, 0x00, 0x00, 0xb0, 0x14, 0x23, 0x50, 0x06, 0x0a, 0x00, 0x01, 0x00, 0x00, 0x10, 0x11, 0x09, 0x00, 0x00, 0x60, 0x10, 0x00, 0x00, 0x00, 0x10, - 0x00, 0x00, 0x44, 0x00, 0x00, 0x10, 0x00, 0x04, + 0x00, 0x00, 0x44, 0x00, 0x00, 0x10, 0x00, 0x05, 0x08, 0x00, 0x00, 0x05, 0x00, 0x80, 0x28, 0x04, 0x00, 0x00, 0x40, 0xd5, 0x2d, 0x00, 0x64, 0x35, 0x24, 0x52, 0xf4, 0xd5, 0xbf, 0x62, 0xc9, 0x03, // Entry 180 - 1BF 0x00, 0x80, 0x00, 0x40, 0x00, 0x00, 0x00, 0x00, 0x00, 0x04, 0x13, 0x39, 0x01, 0xdd, 0x57, 0x98, - 0x21, 0x18, 0x81, 0x00, 0x00, 0x01, 0x40, 0x82, + 0x21, 0x18, 0x81, 0x08, 0x00, 0x01, 0x40, 0x82, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x01, 0x40, 0x00, 0x44, 0x00, 0x00, 0x80, 0xea, 0xa9, 0x39, 0x00, 0x02, 0x00, 0x00, 0x00, 0x04, @@ -337,7 +337,7 @@ var langNoIndex = [2197]uint8{ 0xa4, 0x45, 0x25, 0x9b, 0x02, 0xdf, 0xe1, 0xdf, 0x03, 0x44, 0x08, 0x90, 0x01, 0x04, 0x81, 0xe3, 0x92, 0x54, 0xdb, 0x28, 0xd3, 0x5f, 0xfe, 0x6d, - 0x79, 0xed, 0x1c, 0x7d, 0x04, 0x08, 0x00, 0x01, + 0x79, 0xed, 0x1c, 0x7f, 0x04, 0x08, 0x00, 0x01, 0x21, 0x12, 0x64, 0x5f, 0xdd, 0x0e, 0x85, 0x4f, 0x40, 0x40, 0x00, 0x04, 0xf1, 0xfd, 0x3d, 0x54, // Entry 240 - 27F @@ -359,13 +359,13 @@ var langNoIndex = [2197]uint8{ 0x03, 0x00, 0x00, 0x00, 0x8c, 0x50, 0x40, 0x04, 0x84, 0x47, 0x84, 0x40, 0x20, 0x10, 0x00, 0x20, // Entry 2C0 - 2FF - 0x02, 0x50, 0x80, 0x11, 0x00, 0x91, 0x6c, 0xe2, - 0x50, 0x27, 0x1d, 0x11, 0x29, 0x06, 0x59, 0xe9, + 0x02, 0x50, 0x80, 0x11, 0x00, 0x99, 0x6c, 0xe2, + 0x50, 0x27, 0x1d, 0x11, 0x29, 0x0e, 0x59, 0xe9, 0x33, 0x08, 0x00, 0x20, 0x04, 0x40, 0x10, 0x00, 0x00, 0x00, 0x50, 0x44, 0x92, 0x49, 0xd6, 0x5d, 0xa7, 0x81, 0x47, 0x97, 0xfb, 0x00, 0x10, 0x00, 0x08, 0x00, 0x80, 0x00, 0x40, 0x04, 0x00, 0x01, - 0x02, 0x00, 0x01, 0x40, 0x80, 0x00, 0x00, 0x08, + 0x02, 0x00, 0x01, 0x40, 0x80, 0x00, 0x40, 0x08, 0xd8, 0xeb, 0xf6, 0x39, 0xc4, 0x8d, 0x12, 0x00, // Entry 300 - 33F 0x00, 0x0c, 0x04, 0x01, 0x20, 0x20, 0xdd, 0xa0, @@ -392,14 +392,14 @@ var langNoIndex = [2197]uint8{ 0xee, 0xdb, 0x6f, 0xef, 0xff, 0x7f, 0xff, 0xff, 0xf7, 0x5f, 0xd3, 0x3b, 0xfd, 0xd9, 0xdf, 0xeb, 0xbc, 0x08, 0x05, 0x24, 0xff, 0x07, 0x70, 0xfe, - 0xe6, 0x5e, 0x00, 0x08, 0x00, 0x83, 0x3d, 0x1b, + 0xe6, 0x5e, 0x00, 0x08, 0x00, 0x83, 0x7d, 0x1f, 0x06, 0xe6, 0x72, 0x60, 0xd1, 0x3c, 0x7f, 0x44, // Entry 3C0 - 3FF 0x02, 0x30, 0x9f, 0x7a, 0x16, 0xbd, 0x7f, 0x57, 0xf2, 0xff, 0x31, 0xff, 0xf2, 0x1e, 0x90, 0xf7, - 0xf1, 0xf9, 0x45, 0x80, 0x01, 0x02, 0x00, 0x00, - 0x40, 0x54, 0x9f, 0x8a, 0xdb, 0xf9, 0x2e, 0x11, - 0x86, 0x51, 0xc0, 0xf3, 0xfb, 0x47, 0x40, 0x01, + 0xf1, 0xf9, 0x45, 0x80, 0x01, 0x02, 0x00, 0x20, + 0x40, 0x54, 0x9f, 0x8a, 0xdf, 0xf9, 0x6e, 0x11, + 0x86, 0x51, 0xc0, 0xf3, 0xfb, 0x47, 0x40, 0x03, 0x05, 0xd1, 0x50, 0x5c, 0x00, 0x40, 0x00, 0x10, 0x04, 0x02, 0x00, 0x00, 0x0a, 0x00, 0x17, 0xd2, 0xb9, 0xfd, 0xfc, 0xba, 0xfe, 0xef, 0xc7, 0xbe, @@ -424,12 +424,12 @@ var langNoIndex = [2197]uint8{ // Entry 480 - 4BF 0x93, 0x50, 0x5d, 0xaf, 0xa6, 0xff, 0x99, 0xfb, 0x63, 0x1d, 0x53, 0xff, 0xef, 0xb7, 0x35, 0x20, - 0x14, 0x00, 0x55, 0x51, 0x82, 0x65, 0xf5, 0x41, - 0xe2, 0xff, 0xfc, 0xdf, 0x02, 0x05, 0xc5, 0x05, + 0x14, 0x00, 0x55, 0x51, 0xc2, 0x65, 0xf5, 0x41, + 0xe2, 0xff, 0xfc, 0xdf, 0x02, 0x85, 0xc5, 0x05, 0x00, 0x22, 0x00, 0x74, 0x69, 0x10, 0x08, 0x05, 0x41, 0x00, 0x01, 0x06, 0x00, 0x00, 0x00, 0x00, 0x00, 0x51, 0x20, 0x05, 0x04, 0x01, 0x00, 0x00, - 0x06, 0x01, 0x20, 0x00, 0x18, 0x01, 0x92, 0xf1, + 0x06, 0x11, 0x20, 0x00, 0x18, 0x01, 0x92, 0xf1, // Entry 4C0 - 4FF 0xfd, 0x47, 0x69, 0x06, 0x95, 0x06, 0x57, 0xed, 0xfb, 0x4d, 0x1c, 0x6b, 0x83, 0x04, 0x62, 0x40, @@ -441,7 +441,7 @@ var langNoIndex = [2197]uint8{ 0xbe, 0xcf, 0xf7, 0xaf, 0x42, 0x04, 0x84, 0x41, // Entry 500 - 53F 0x30, 0xff, 0x79, 0x72, 0x04, 0x00, 0x00, 0x49, - 0x2d, 0x14, 0x27, 0x57, 0xed, 0xf1, 0x3f, 0xe7, + 0x2d, 0x14, 0x27, 0x5f, 0xed, 0xf1, 0x3f, 0xe7, 0x3f, 0x00, 0x00, 0x02, 0xc6, 0xa0, 0x1e, 0xf8, 0xbb, 0xff, 0xfd, 0xfb, 0xb7, 0xfd, 0xe7, 0xf7, 0xfd, 0xfc, 0xd5, 0xed, 0x47, 0xf4, 0x7e, 0x10, @@ -449,7 +449,7 @@ var langNoIndex = [2197]uint8{ 0x5b, 0x05, 0x86, 0xed, 0xf5, 0x77, 0xbd, 0x3c, 0x00, 0x00, 0x00, 0x42, 0x71, 0x42, 0x00, 0x40, // Entry 540 - 57F - 0x00, 0x00, 0x01, 0x43, 0x19, 0x00, 0x08, 0x00, + 0x00, 0x00, 0x01, 0x43, 0x19, 0x24, 0x08, 0x00, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, @@ -464,13 +464,13 @@ var langNoIndex = [2197]uint8{ 0x00, 0x00, 0x00, 0x00, 0xf0, 0xce, 0xfb, 0xbf, 0x00, 0x23, 0x00, 0x00, 0x00, 0x00, 0x08, 0x00, 0x00, 0x30, 0x15, 0xa3, 0x10, 0x00, 0x00, 0x00, - 0x11, 0x04, 0x16, 0x00, 0x00, 0x02, 0x00, 0x81, + 0x11, 0x04, 0x16, 0x00, 0x00, 0x02, 0x20, 0x81, 0xa3, 0x01, 0x50, 0x00, 0x00, 0x83, 0x11, 0x40, // Entry 5C0 - 5FF - 0x00, 0x00, 0x00, 0xf0, 0xdd, 0x7b, 0x3e, 0x02, + 0x00, 0x00, 0x00, 0xf0, 0xdd, 0x7b, 0xbe, 0x02, 0xaa, 0x10, 0x5d, 0x98, 0x52, 0x00, 0x80, 0x20, 0x00, 0x00, 0x00, 0x00, 0x40, 0x00, 0x02, 0x02, - 0x19, 0x00, 0x10, 0x02, 0x10, 0x61, 0x5a, 0x9d, + 0x3d, 0x40, 0x10, 0x02, 0x10, 0x61, 0x5a, 0x9d, 0x31, 0x00, 0x00, 0x00, 0x01, 0x18, 0x02, 0x20, 0x00, 0x00, 0x01, 0x00, 0x42, 0x00, 0x20, 0x00, 0x00, 0x1f, 0xdf, 0xd2, 0xb9, 0xff, 0xfd, 0x3f, @@ -491,20 +491,20 @@ var langNoIndex = [2197]uint8{ 0x02, 0xfb, 0xa3, 0xef, 0xf3, 0xd6, 0xf2, 0xff, 0xb9, 0xda, 0x7d, 0xd0, 0x3e, 0x15, 0x7b, 0xb4, 0xf5, 0x3e, 0xff, 0xff, 0xf1, 0xf7, 0xff, 0xe7, - 0x5f, 0xff, 0xff, 0x9e, 0xdb, 0xf6, 0xd7, 0xb9, + 0x5f, 0xff, 0xff, 0x9e, 0xdf, 0xf6, 0xd7, 0xb9, 0xef, 0x27, 0x80, 0xbb, 0xc5, 0xff, 0xff, 0xe3, // Entry 680 - 6BF 0x97, 0x9d, 0xbf, 0x9f, 0xf7, 0xc7, 0xfd, 0x37, - 0xce, 0x7f, 0x04, 0x1d, 0x73, 0x7f, 0xf8, 0xda, + 0xce, 0x7f, 0x44, 0x1d, 0x73, 0x7f, 0xf8, 0xda, 0x5d, 0xce, 0x7d, 0x06, 0xb9, 0xea, 0x79, 0xa0, 0x1a, 0x20, 0x00, 0x30, 0x02, 0x04, 0x24, 0x08, 0x04, 0x00, 0x00, 0x40, 0xd4, 0x02, 0x04, 0x00, - 0x00, 0x04, 0x00, 0x04, 0x00, 0x20, 0x01, 0x06, + 0x00, 0x04, 0x00, 0x04, 0x00, 0x20, 0x09, 0x06, 0x50, 0x00, 0x08, 0x00, 0x00, 0x00, 0x24, 0x00, 0x04, 0x00, 0x10, 0xdc, 0x58, 0xd7, 0x0d, 0x0f, // Entry 6C0 - 6FF - 0x14, 0x4d, 0xf1, 0x16, 0x44, 0xd5, 0x42, 0x08, - 0x40, 0x00, 0x00, 0x40, 0x00, 0x08, 0x00, 0x00, + 0x54, 0x4d, 0xf1, 0x16, 0x44, 0xd5, 0x42, 0x08, + 0x40, 0x02, 0x00, 0x40, 0x00, 0x08, 0x00, 0x00, 0x00, 0xdc, 0xfb, 0xcb, 0x0e, 0x58, 0x48, 0x41, 0x24, 0x20, 0x04, 0x00, 0x30, 0x12, 0x40, 0x00, 0x00, 0x10, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, @@ -513,7 +513,7 @@ var langNoIndex = [2197]uint8{ 0x00, 0x00, 0x00, 0x80, 0x80, 0x25, 0x00, 0x00, // Entry 700 - 73F 0x00, 0x00, 0x00, 0x00, 0x0a, 0x00, 0x00, 0x00, - 0x80, 0x86, 0xc2, 0x00, 0x00, 0x00, 0x00, 0x01, + 0x80, 0x86, 0xc2, 0x00, 0x00, 0x01, 0x00, 0x01, 0xff, 0x18, 0x02, 0x00, 0x02, 0xf0, 0xfd, 0x79, 0x3b, 0x00, 0x25, 0x00, 0x00, 0x00, 0x02, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x40, 0x00, 0x00, @@ -522,7 +522,7 @@ var langNoIndex = [2197]uint8{ 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, // Entry 740 - 77F 0x00, 0x00, 0x00, 0xef, 0xd5, 0xfd, 0xcf, 0x7e, - 0xb0, 0x11, 0x00, 0x00, 0x00, 0x92, 0x01, 0x44, + 0xb0, 0x11, 0x00, 0x00, 0x00, 0x92, 0x01, 0x46, 0xcd, 0xf9, 0x5c, 0x00, 0x01, 0x00, 0x30, 0x04, 0x04, 0x55, 0x00, 0x01, 0x04, 0xf4, 0x3f, 0x4a, 0x01, 0x00, 0x00, 0xb0, 0x80, 0x20, 0x55, 0x75, @@ -530,12 +530,12 @@ var langNoIndex = [2197]uint8{ 0xd5, 0x57, 0x27, 0x14, 0x01, 0x00, 0x00, 0x00, 0x00, 0x00, 0x2c, 0xf7, 0xcb, 0x1f, 0x14, 0x60, // Entry 780 - 7BF - 0x03, 0x68, 0x01, 0x10, 0x8b, 0x38, 0x8a, 0x01, + 0x83, 0x68, 0x01, 0x10, 0x8b, 0x38, 0x8a, 0x01, 0x00, 0x00, 0x20, 0x00, 0x24, 0x44, 0x00, 0x00, - 0x10, 0x03, 0x11, 0x02, 0x01, 0x00, 0x00, 0xf0, + 0x10, 0x03, 0x31, 0x02, 0x01, 0x00, 0x00, 0xf0, 0xf5, 0xff, 0xd5, 0x97, 0xbc, 0x70, 0xd6, 0x78, - 0x78, 0x15, 0x50, 0x01, 0xa4, 0x84, 0xa9, 0x41, - 0x00, 0x00, 0x00, 0x6b, 0x39, 0x52, 0x74, 0x00, + 0x78, 0x15, 0x50, 0x05, 0xa4, 0x84, 0xa9, 0x41, + 0x00, 0x00, 0x00, 0x6b, 0x39, 0x52, 0x74, 0x40, 0xe8, 0x30, 0x90, 0x6a, 0x92, 0x00, 0x00, 0x02, 0xff, 0xef, 0xff, 0x4b, 0x85, 0x53, 0xf4, 0xed, // Entry 7C0 - 7FF @@ -545,11 +545,11 @@ var langNoIndex = [2197]uint8{ 0xbd, 0xa4, 0xaf, 0x01, 0x44, 0x18, 0x01, 0x4d, 0x4e, 0x4a, 0x08, 0x50, 0x28, 0x30, 0xe0, 0x80, 0x10, 0x20, 0x24, 0x00, 0xff, 0x2f, 0xd3, 0x60, - 0xfe, 0x01, 0x02, 0x88, 0x0a, 0x40, 0x16, 0x01, + 0xfe, 0x01, 0x02, 0x88, 0x2a, 0x40, 0x16, 0x01, 0x01, 0x15, 0x2b, 0x3c, 0x01, 0x00, 0x00, 0x10, // Entry 800 - 83F 0x90, 0x49, 0x41, 0x02, 0x02, 0x01, 0xe1, 0xbf, - 0xbf, 0x03, 0x00, 0x00, 0x10, 0xd4, 0xa3, 0xd1, + 0xbf, 0x03, 0x00, 0x00, 0x10, 0xdc, 0xa3, 0xd1, 0x40, 0x9c, 0x44, 0xdf, 0xf5, 0x8f, 0x66, 0xb3, 0x55, 0x20, 0xd4, 0xc1, 0xd8, 0x30, 0x3d, 0x80, 0x00, 0x00, 0x00, 0x04, 0xd4, 0x11, 0xc5, 0x84, @@ -557,11 +557,11 @@ var langNoIndex = [2197]uint8{ 0x07, 0x00, 0x20, 0x10, 0x84, 0xb2, 0x45, 0x10, 0x06, 0x44, 0x00, 0x00, 0x12, 0x02, 0x11, 0x00, // Entry 840 - 87F - 0xf0, 0xfb, 0xfd, 0x7f, 0x05, 0x00, 0x16, 0x81, - 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x0c, 0x02, + 0xf0, 0xfb, 0xfd, 0x7f, 0x05, 0x00, 0x16, 0x89, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x0c, 0x03, 0x00, 0x00, 0x00, 0x00, 0x03, 0x30, 0x02, 0x28, 0x84, 0x00, 0x21, 0xc0, 0x23, 0x24, 0x00, 0x00, - 0x00, 0xcb, 0xe4, 0x3a, 0x46, 0x88, 0x14, 0xf1, + 0x00, 0xcb, 0xe4, 0x3a, 0x46, 0x88, 0x54, 0xf1, 0xef, 0xff, 0x7f, 0x12, 0x01, 0x01, 0x84, 0x50, 0x07, 0xfc, 0xff, 0xff, 0x0f, 0x01, 0x00, 0x40, 0x10, 0x38, 0x01, 0x01, 0x1c, 0x12, 0x40, 0xe1, @@ -583,8 +583,8 @@ var altLangIndex = [6]uint16{ } // AliasMap maps langIDs to their suggested replacements. -// Size: 716 bytes, 179 elements -var AliasMap = [179]FromTo{ +// Size: 772 bytes, 193 elements +var AliasMap = [193]FromTo{ 0: {From: 0x82, To: 0x88}, 1: {From: 0x187, To: 0x1ae}, 2: {From: 0x1f3, To: 0x1e1}, @@ -599,223 +599,239 @@ var AliasMap = [179]FromTo{ 11: {From: 0x4a2, To: 0x21}, 12: {From: 0x53e, To: 0x544}, 13: {From: 0x58f, To: 0x12d}, - 14: {From: 0x630, To: 0x1eb1}, - 15: {From: 0x651, To: 0x431}, - 16: {From: 0x662, To: 0x431}, - 17: {From: 0x6ed, To: 0x3a}, - 18: {From: 0x6f8, To: 0x1d7}, - 19: {From: 0x709, To: 0x3625}, - 20: {From: 0x73e, To: 0x21a1}, - 21: {From: 0x7b3, To: 0x56}, - 22: {From: 0x7b9, To: 0x299b}, - 23: {From: 0x7c5, To: 0x58}, - 24: {From: 0x7e6, To: 0x145}, - 25: {From: 0x80c, To: 0x5a}, - 26: {From: 0x815, To: 0x8d}, - 27: {From: 0x87e, To: 0x810}, - 28: {From: 0x8a8, To: 0x8b7}, - 29: {From: 0x8c3, To: 0xee3}, - 30: {From: 0x8fa, To: 0x1dc}, - 31: {From: 0x9ef, To: 0x331}, - 32: {From: 0xa36, To: 0x2c5}, - 33: {From: 0xa3d, To: 0xbf}, - 34: {From: 0xabe, To: 0x3322}, - 35: {From: 0xb38, To: 0x529}, - 36: {From: 0xb75, To: 0x265a}, - 37: {From: 0xb7e, To: 0xbc3}, - 38: {From: 0xb9b, To: 0x44e}, - 39: {From: 0xbbc, To: 0x4229}, - 40: {From: 0xbbf, To: 0x529}, - 41: {From: 0xbfe, To: 0x2da7}, - 42: {From: 0xc2e, To: 0x3181}, - 43: {From: 0xcb9, To: 0xf3}, - 44: {From: 0xd08, To: 0xfa}, - 45: {From: 0xdc8, To: 0x11a}, - 46: {From: 0xdd7, To: 0x32d}, - 47: {From: 0xdf8, To: 0xdfb}, - 48: {From: 0xdfe, To: 0x531}, - 49: {From: 0xe01, To: 0xdf3}, - 50: {From: 0xedf, To: 0x205a}, - 51: {From: 0xee9, To: 0x222e}, - 52: {From: 0xeee, To: 0x2e9a}, - 53: {From: 0xf39, To: 0x367}, - 54: {From: 0x10d0, To: 0x140}, - 55: {From: 0x1104, To: 0x2d0}, - 56: {From: 0x11a0, To: 0x1ec}, - 57: {From: 0x1279, To: 0x21}, - 58: {From: 0x1424, To: 0x15e}, - 59: {From: 0x1470, To: 0x14e}, - 60: {From: 0x151f, To: 0xd9b}, - 61: {From: 0x1523, To: 0x390}, - 62: {From: 0x1532, To: 0x19f}, - 63: {From: 0x1580, To: 0x210}, - 64: {From: 0x1583, To: 0x10d}, - 65: {From: 0x15a3, To: 0x3caf}, - 66: {From: 0x1630, To: 0x222e}, - 67: {From: 0x166a, To: 0x19b}, - 68: {From: 0x16c8, To: 0x136}, - 69: {From: 0x1700, To: 0x29f8}, - 70: {From: 0x1718, To: 0x194}, - 71: {From: 0x1727, To: 0xf3f}, - 72: {From: 0x177a, To: 0x178}, - 73: {From: 0x1809, To: 0x17b6}, - 74: {From: 0x1816, To: 0x18f3}, - 75: {From: 0x188a, To: 0x436}, - 76: {From: 0x1979, To: 0x1d01}, - 77: {From: 0x1a74, To: 0x2bb0}, - 78: {From: 0x1a8a, To: 0x1f8}, - 79: {From: 0x1b5a, To: 0x1fa}, - 80: {From: 0x1b86, To: 0x1515}, - 81: {From: 0x1d64, To: 0x2c9b}, - 82: {From: 0x2038, To: 0x37b1}, - 83: {From: 0x203d, To: 0x20dd}, - 84: {From: 0x205a, To: 0x30b}, - 85: {From: 0x20e3, To: 0x274}, - 86: {From: 0x20ee, To: 0x263}, - 87: {From: 0x20f2, To: 0x22d}, - 88: {From: 0x20f9, To: 0x256}, - 89: {From: 0x210f, To: 0x21eb}, - 90: {From: 0x2135, To: 0x27d}, - 91: {From: 0x2160, To: 0x913}, - 92: {From: 0x2199, To: 0x121}, - 93: {From: 0x21ce, To: 0x1561}, - 94: {From: 0x21e6, To: 0x504}, - 95: {From: 0x21f4, To: 0x49f}, - 96: {From: 0x21fb, To: 0x269}, - 97: {From: 0x222d, To: 0x121}, - 98: {From: 0x2237, To: 0x121}, - 99: {From: 0x2262, To: 0x92a}, - 100: {From: 0x2316, To: 0x3226}, - 101: {From: 0x236a, To: 0x2835}, - 102: {From: 0x2382, To: 0x3365}, - 103: {From: 0x2472, To: 0x2c7}, - 104: {From: 0x24e4, To: 0x2ff}, - 105: {From: 0x24f0, To: 0x2fa}, - 106: {From: 0x24fa, To: 0x31f}, - 107: {From: 0x2550, To: 0xb5b}, - 108: {From: 0x25a9, To: 0xe2}, - 109: {From: 0x263e, To: 0x2d0}, - 110: {From: 0x26c9, To: 0x26b4}, - 111: {From: 0x26f9, To: 0x3c8}, - 112: {From: 0x2727, To: 0x3caf}, - 113: {From: 0x2755, To: 0x6a4}, - 114: {From: 0x2765, To: 0x26b4}, - 115: {From: 0x2789, To: 0x4358}, - 116: {From: 0x27c9, To: 0x2001}, - 117: {From: 0x28ea, To: 0x27b1}, - 118: {From: 0x28ef, To: 0x2837}, - 119: {From: 0x2914, To: 0x351}, - 120: {From: 0x2986, To: 0x2da7}, - 121: {From: 0x29f0, To: 0x96b}, - 122: {From: 0x2b1a, To: 0x38d}, - 123: {From: 0x2bfc, To: 0x395}, - 124: {From: 0x2c3f, To: 0x3caf}, - 125: {From: 0x2ce1, To: 0x2201}, - 126: {From: 0x2cfc, To: 0x3be}, - 127: {From: 0x2d13, To: 0x597}, - 128: {From: 0x2d47, To: 0x148}, - 129: {From: 0x2d48, To: 0x148}, - 130: {From: 0x2dff, To: 0x2f1}, - 131: {From: 0x2e08, To: 0x19cc}, - 132: {From: 0x2e1a, To: 0x2d95}, - 133: {From: 0x2e21, To: 0x292}, - 134: {From: 0x2e54, To: 0x7d}, - 135: {From: 0x2e65, To: 0x2282}, - 136: {From: 0x2ea0, To: 0x2e9b}, - 137: {From: 0x2eef, To: 0x2ed7}, - 138: {From: 0x3193, To: 0x3c4}, - 139: {From: 0x3366, To: 0x338e}, - 140: {From: 0x342a, To: 0x3dc}, - 141: {From: 0x34ee, To: 0x18d0}, - 142: {From: 0x35c8, To: 0x2c9b}, - 143: {From: 0x35e6, To: 0x412}, - 144: {From: 0x3658, To: 0x246}, - 145: {From: 0x3676, To: 0x3f4}, - 146: {From: 0x36fd, To: 0x445}, - 147: {From: 0x37c0, To: 0x121}, - 148: {From: 0x3816, To: 0x38f2}, - 149: {From: 0x382a, To: 0x2b48}, - 150: {From: 0x382b, To: 0x2c9b}, - 151: {From: 0x382f, To: 0xa9}, - 152: {From: 0x3832, To: 0x3228}, - 153: {From: 0x386c, To: 0x39a6}, - 154: {From: 0x3892, To: 0x3fc0}, - 155: {From: 0x38a5, To: 0x39d7}, - 156: {From: 0x38b4, To: 0x1fa4}, - 157: {From: 0x38b5, To: 0x2e9a}, - 158: {From: 0x395c, To: 0x47e}, - 159: {From: 0x3b4e, To: 0xd91}, - 160: {From: 0x3b78, To: 0x137}, - 161: {From: 0x3c99, To: 0x4bc}, - 162: {From: 0x3fbd, To: 0x100}, - 163: {From: 0x4208, To: 0xa91}, - 164: {From: 0x42be, To: 0x573}, - 165: {From: 0x42f9, To: 0x3f60}, - 166: {From: 0x4378, To: 0x25a}, - 167: {From: 0x43b8, To: 0xe6c}, - 168: {From: 0x43cd, To: 0x10f}, - 169: {From: 0x44af, To: 0x3322}, - 170: {From: 0x44e3, To: 0x512}, - 171: {From: 0x45ca, To: 0x2409}, - 172: {From: 0x45dd, To: 0x26dc}, - 173: {From: 0x4610, To: 0x48ae}, - 174: {From: 0x46ae, To: 0x46a0}, - 175: {From: 0x473e, To: 0x4745}, - 176: {From: 0x4817, To: 0x3503}, - 177: {From: 0x4916, To: 0x31f}, - 178: {From: 0x49a7, To: 0x523}, + 14: {From: 0x62b, To: 0x34}, + 15: {From: 0x62f, To: 0x14}, + 16: {From: 0x630, To: 0x1eb1}, + 17: {From: 0x651, To: 0x431}, + 18: {From: 0x662, To: 0x431}, + 19: {From: 0x6ed, To: 0x3a}, + 20: {From: 0x6f8, To: 0x1d7}, + 21: {From: 0x709, To: 0x3625}, + 22: {From: 0x73e, To: 0x21a1}, + 23: {From: 0x7b3, To: 0x56}, + 24: {From: 0x7b9, To: 0x299b}, + 25: {From: 0x7c5, To: 0x58}, + 26: {From: 0x7e6, To: 0x145}, + 27: {From: 0x80c, To: 0x5a}, + 28: {From: 0x815, To: 0x8d}, + 29: {From: 0x87e, To: 0x810}, + 30: {From: 0x8a8, To: 0x8b7}, + 31: {From: 0x8c3, To: 0xee3}, + 32: {From: 0x8fa, To: 0x1dc}, + 33: {From: 0x9ef, To: 0x331}, + 34: {From: 0xa36, To: 0x2c5}, + 35: {From: 0xa3d, To: 0xbf}, + 36: {From: 0xabe, To: 0x3322}, + 37: {From: 0xb38, To: 0x529}, + 38: {From: 0xb75, To: 0x265a}, + 39: {From: 0xb7e, To: 0xbc3}, + 40: {From: 0xb9b, To: 0x44e}, + 41: {From: 0xbbc, To: 0x4229}, + 42: {From: 0xbbf, To: 0x529}, + 43: {From: 0xbfe, To: 0x2da7}, + 44: {From: 0xc2e, To: 0x3181}, + 45: {From: 0xcb9, To: 0xf3}, + 46: {From: 0xd08, To: 0xfa}, + 47: {From: 0xdc8, To: 0x11a}, + 48: {From: 0xdd7, To: 0x32d}, + 49: {From: 0xdf8, To: 0xdfb}, + 50: {From: 0xdfe, To: 0x531}, + 51: {From: 0xe01, To: 0xdf3}, + 52: {From: 0xedf, To: 0x205a}, + 53: {From: 0xee9, To: 0x222e}, + 54: {From: 0xeee, To: 0x2e9a}, + 55: {From: 0xf39, To: 0x367}, + 56: {From: 0x10d0, To: 0x140}, + 57: {From: 0x1104, To: 0x2d0}, + 58: {From: 0x11a0, To: 0x1ec}, + 59: {From: 0x1279, To: 0x21}, + 60: {From: 0x1424, To: 0x15e}, + 61: {From: 0x1470, To: 0x14e}, + 62: {From: 0x151f, To: 0xd9b}, + 63: {From: 0x1523, To: 0x390}, + 64: {From: 0x1532, To: 0x19f}, + 65: {From: 0x1580, To: 0x210}, + 66: {From: 0x1583, To: 0x10d}, + 67: {From: 0x15a3, To: 0x3caf}, + 68: {From: 0x1630, To: 0x222e}, + 69: {From: 0x166a, To: 0x19b}, + 70: {From: 0x16c8, To: 0x136}, + 71: {From: 0x1700, To: 0x29f8}, + 72: {From: 0x1718, To: 0x194}, + 73: {From: 0x1727, To: 0xf3f}, + 74: {From: 0x177a, To: 0x178}, + 75: {From: 0x1809, To: 0x17b6}, + 76: {From: 0x1816, To: 0x18f3}, + 77: {From: 0x188a, To: 0x436}, + 78: {From: 0x1979, To: 0x1d01}, + 79: {From: 0x1a74, To: 0x2bb0}, + 80: {From: 0x1a8a, To: 0x1f8}, + 81: {From: 0x1b5a, To: 0x1fa}, + 82: {From: 0x1b86, To: 0x1515}, + 83: {From: 0x1d64, To: 0x2c9b}, + 84: {From: 0x2038, To: 0x37b1}, + 85: {From: 0x203d, To: 0x20dd}, + 86: {From: 0x2042, To: 0x2e00}, + 87: {From: 0x205a, To: 0x30b}, + 88: {From: 0x20e3, To: 0x274}, + 89: {From: 0x20ee, To: 0x263}, + 90: {From: 0x20f2, To: 0x22d}, + 91: {From: 0x20f9, To: 0x256}, + 92: {From: 0x210f, To: 0x21eb}, + 93: {From: 0x2135, To: 0x27d}, + 94: {From: 0x2160, To: 0x913}, + 95: {From: 0x2199, To: 0x121}, + 96: {From: 0x21ce, To: 0x1561}, + 97: {From: 0x21e6, To: 0x504}, + 98: {From: 0x21f4, To: 0x49f}, + 99: {From: 0x21fb, To: 0x269}, + 100: {From: 0x222d, To: 0x121}, + 101: {From: 0x2237, To: 0x121}, + 102: {From: 0x2248, To: 0x217d}, + 103: {From: 0x2262, To: 0x92a}, + 104: {From: 0x2316, To: 0x3226}, + 105: {From: 0x236a, To: 0x2835}, + 106: {From: 0x2382, To: 0x3365}, + 107: {From: 0x2472, To: 0x2c7}, + 108: {From: 0x24e4, To: 0x2ff}, + 109: {From: 0x24f0, To: 0x2fa}, + 110: {From: 0x24fa, To: 0x31f}, + 111: {From: 0x2550, To: 0xb5b}, + 112: {From: 0x25a9, To: 0xe2}, + 113: {From: 0x263e, To: 0x2d0}, + 114: {From: 0x26c9, To: 0x26b4}, + 115: {From: 0x26f9, To: 0x3c8}, + 116: {From: 0x2727, To: 0x3caf}, + 117: {From: 0x2755, To: 0x6a4}, + 118: {From: 0x2765, To: 0x26b4}, + 119: {From: 0x2789, To: 0x4358}, + 120: {From: 0x27c9, To: 0x2001}, + 121: {From: 0x28ea, To: 0x27b1}, + 122: {From: 0x28ef, To: 0x2837}, + 123: {From: 0x28fe, To: 0xaa5}, + 124: {From: 0x2914, To: 0x351}, + 125: {From: 0x2986, To: 0x2da7}, + 126: {From: 0x29f0, To: 0x96b}, + 127: {From: 0x2b1a, To: 0x38d}, + 128: {From: 0x2bfc, To: 0x395}, + 129: {From: 0x2c3f, To: 0x3caf}, + 130: {From: 0x2ce1, To: 0x2201}, + 131: {From: 0x2cfc, To: 0x3be}, + 132: {From: 0x2d13, To: 0x597}, + 133: {From: 0x2d47, To: 0x148}, + 134: {From: 0x2d48, To: 0x148}, + 135: {From: 0x2dff, To: 0x2f1}, + 136: {From: 0x2e08, To: 0x19cc}, + 137: {From: 0x2e10, To: 0xc45}, + 138: {From: 0x2e1a, To: 0x2d95}, + 139: {From: 0x2e21, To: 0x292}, + 140: {From: 0x2e54, To: 0x7d}, + 141: {From: 0x2e65, To: 0x2282}, + 142: {From: 0x2e97, To: 0x1a4}, + 143: {From: 0x2ea0, To: 0x2e9b}, + 144: {From: 0x2eef, To: 0x2ed7}, + 145: {From: 0x3193, To: 0x3c4}, + 146: {From: 0x3366, To: 0x338e}, + 147: {From: 0x342a, To: 0x3dc}, + 148: {From: 0x34ee, To: 0x18d0}, + 149: {From: 0x35c8, To: 0x2c9b}, + 150: {From: 0x35e6, To: 0x412}, + 151: {From: 0x35f5, To: 0x24b}, + 152: {From: 0x360d, To: 0x1dc}, + 153: {From: 0x3658, To: 0x246}, + 154: {From: 0x3676, To: 0x3f4}, + 155: {From: 0x36fd, To: 0x445}, + 156: {From: 0x3747, To: 0x3b42}, + 157: {From: 0x37c0, To: 0x121}, + 158: {From: 0x3816, To: 0x38f2}, + 159: {From: 0x382a, To: 0x2b48}, + 160: {From: 0x382b, To: 0x2c9b}, + 161: {From: 0x382f, To: 0xa9}, + 162: {From: 0x3832, To: 0x3228}, + 163: {From: 0x386c, To: 0x39a6}, + 164: {From: 0x3892, To: 0x3fc0}, + 165: {From: 0x38a0, To: 0x45f}, + 166: {From: 0x38a5, To: 0x39d7}, + 167: {From: 0x38b4, To: 0x1fa4}, + 168: {From: 0x38b5, To: 0x2e9a}, + 169: {From: 0x38fa, To: 0x38f1}, + 170: {From: 0x395c, To: 0x47e}, + 171: {From: 0x3b4e, To: 0xd91}, + 172: {From: 0x3b78, To: 0x137}, + 173: {From: 0x3c99, To: 0x4bc}, + 174: {From: 0x3fbd, To: 0x100}, + 175: {From: 0x4208, To: 0xa91}, + 176: {From: 0x42be, To: 0x573}, + 177: {From: 0x42f9, To: 0x3f60}, + 178: {From: 0x4378, To: 0x25a}, + 179: {From: 0x43b8, To: 0xe6c}, + 180: {From: 0x43cd, To: 0x10f}, + 181: {From: 0x43d4, To: 0x4848}, + 182: {From: 0x44af, To: 0x3322}, + 183: {From: 0x44e3, To: 0x512}, + 184: {From: 0x45ca, To: 0x2409}, + 185: {From: 0x45dd, To: 0x26dc}, + 186: {From: 0x4610, To: 0x48ae}, + 187: {From: 0x46ae, To: 0x46a0}, + 188: {From: 0x473e, To: 0x4745}, + 189: {From: 0x4817, To: 0x3503}, + 190: {From: 0x483b, To: 0x208b}, + 191: {From: 0x4916, To: 0x31f}, + 192: {From: 0x49a7, To: 0x523}, } -// Size: 179 bytes, 179 elements -var AliasTypes = [179]AliasType{ +// Size: 193 bytes, 193 elements +var AliasTypes = [193]AliasType{ // Entry 0 - 3F - 1, 0, 0, 0, 0, 0, 0, 1, 2, 2, 0, 1, 0, 0, 1, 2, - 1, 1, 2, 0, 0, 1, 0, 1, 2, 1, 1, 0, 0, 0, 0, 2, - 1, 1, 0, 2, 0, 0, 1, 0, 1, 0, 0, 1, 2, 1, 1, 1, - 1, 0, 0, 0, 0, 2, 1, 1, 1, 1, 2, 1, 0, 1, 1, 2, + 1, 0, 0, 0, 0, 0, 0, 1, 2, 2, 0, 1, 0, 0, 0, 0, + 1, 2, 1, 1, 2, 0, 0, 1, 0, 1, 2, 1, 1, 0, 0, 0, + 0, 2, 1, 1, 0, 2, 0, 0, 1, 0, 1, 0, 0, 1, 2, 1, + 1, 1, 1, 0, 0, 0, 0, 2, 1, 1, 1, 1, 2, 1, 0, 1, // Entry 40 - 7F - 2, 0, 0, 1, 2, 0, 1, 0, 1, 1, 1, 1, 0, 0, 2, 1, - 0, 0, 0, 0, 1, 1, 1, 1, 1, 0, 1, 0, 0, 0, 0, 0, - 0, 0, 0, 1, 0, 0, 0, 1, 2, 2, 2, 0, 1, 1, 0, 1, - 0, 0, 0, 0, 0, 0, 0, 1, 0, 0, 1, 1, 0, 0, 1, 0, + 1, 2, 2, 0, 0, 1, 2, 0, 1, 0, 1, 1, 1, 1, 0, 0, + 2, 1, 0, 0, 0, 0, 0, 1, 1, 1, 1, 1, 0, 1, 0, 0, + 0, 0, 0, 0, 0, 0, 0, 1, 0, 0, 0, 1, 2, 2, 2, 0, + 1, 1, 0, 1, 0, 0, 0, 0, 0, 0, 0, 0, 1, 0, 0, 1, // Entry 80 - BF - 2, 1, 1, 0, 0, 1, 0, 0, 0, 0, 1, 1, 2, 0, 0, 2, - 1, 1, 1, 0, 0, 0, 0, 2, 0, 0, 0, 0, 0, 0, 1, 1, - 0, 1, 2, 0, 0, 0, 1, 0, 1, 0, 1, 0, 0, 0, 0, 1, - 0, 1, 1, + 1, 0, 0, 1, 0, 2, 1, 1, 0, 0, 0, 1, 0, 0, 0, 0, + 0, 1, 1, 2, 0, 0, 2, 0, 0, 1, 1, 1, 0, 0, 0, 0, + 0, 2, 0, 0, 0, 0, 0, 0, 0, 0, 1, 1, 0, 1, 2, 0, + 0, 0, 1, 0, 1, 0, 0, 1, 0, 0, 0, 0, 1, 0, 0, 1, + // Entry C0 - FF + 1, } const ( - _Latn = 90 + _Latn = 91 _Hani = 57 _Hans = 59 _Hant = 60 - _Qaaa = 147 - _Qaai = 155 - _Qabx = 196 - _Zinh = 252 - _Zyyy = 257 - _Zzzz = 258 + _Qaaa = 149 + _Qaai = 157 + _Qabx = 198 + _Zinh = 255 + _Zyyy = 260 + _Zzzz = 261 ) // script is an alphabetically sorted list of ISO 15924 codes. The index // of the script in the string, divided by 4, is the internal scriptID. -const script tag.Index = "" + // Size: 1040 bytes +const script tag.Index = "" + // Size: 1052 bytes "----AdlmAfakAghbAhomArabAranArmiArmnAvstBaliBamuBassBatkBengBhksBlisBopo" + "BrahBraiBugiBuhdCakmCansCariChamCherChrsCirtCoptCpmnCprtCyrlCyrsDevaDiak" + "DogrDsrtDuplEgydEgyhEgypElbaElymEthiGeokGeorGlagGongGonmGothGranGrekGujr" + "GuruHanbHangHaniHanoHansHantHatrHebrHiraHluwHmngHmnpHrktHungIndsItalJamo" + - "JavaJpanJurcKaliKanaKharKhmrKhojKitlKitsKndaKoreKpelKthiLanaLaooLatfLatg" + - "LatnLekeLepcLimbLinaLinbLisuLomaLyciLydiMahjMakaMandManiMarcMayaMedfMend" + - "MercMeroMlymModiMongMoonMrooMteiMultMymrNandNarbNbatNewaNkdbNkgbNkooNshu" + - "OgamOlckOrkhOryaOsgeOsmaOugrPalmPaucPcunPelmPermPhagPhliPhlpPhlvPhnxPiqd" + - "PlrdPrtiPsinQaaaQaabQaacQaadQaaeQaafQaagQaahQaaiQaajQaakQaalQaamQaanQaao" + - "QaapQaaqQaarQaasQaatQaauQaavQaawQaaxQaayQaazQabaQabbQabcQabdQabeQabfQabg" + - "QabhQabiQabjQabkQablQabmQabnQaboQabpQabqQabrQabsQabtQabuQabvQabwQabxRanj" + - "RjngRohgRoroRunrSamrSaraSarbSaurSgnwShawShrdShuiSiddSindSinhSogdSogoSora" + - "SoyoSundSyloSyrcSyreSyrjSyrnTagbTakrTaleTaluTamlTangTavtTeluTengTfngTglg" + - "ThaaThaiTibtTirhTnsaTotoUgarVaiiVispVithWaraWchoWoleXpeoXsuxYeziYiiiZanb" + - "ZinhZmthZsyeZsymZxxxZyyyZzzz\xff\xff\xff\xff" + "JavaJpanJurcKaliKanaKawiKharKhmrKhojKitlKitsKndaKoreKpelKthiLanaLaooLatf" + + "LatgLatnLekeLepcLimbLinaLinbLisuLomaLyciLydiMahjMakaMandManiMarcMayaMedf" + + "MendMercMeroMlymModiMongMoonMrooMteiMultMymrNagmNandNarbNbatNewaNkdbNkgb" + + "NkooNshuOgamOlckOrkhOryaOsgeOsmaOugrPalmPaucPcunPelmPermPhagPhliPhlpPhlv" + + "PhnxPiqdPlrdPrtiPsinQaaaQaabQaacQaadQaaeQaafQaagQaahQaaiQaajQaakQaalQaam" + + "QaanQaaoQaapQaaqQaarQaasQaatQaauQaavQaawQaaxQaayQaazQabaQabbQabcQabdQabe" + + "QabfQabgQabhQabiQabjQabkQablQabmQabnQaboQabpQabqQabrQabsQabtQabuQabvQabw" + + "QabxRanjRjngRohgRoroRunrSamrSaraSarbSaurSgnwShawShrdShuiSiddSindSinhSogd" + + "SogoSoraSoyoSundSunuSyloSyrcSyreSyrjSyrnTagbTakrTaleTaluTamlTangTavtTelu" + + "TengTfngTglgThaaThaiTibtTirhTnsaTotoUgarVaiiVispVithWaraWchoWoleXpeoXsux" + + "YeziYiiiZanbZinhZmthZsyeZsymZxxxZyyyZzzz\xff\xff\xff\xff" // suppressScript is an index from langID to the dominant script for that language, // if it exists. If a script is given, it should be suppressed from the language tag. @@ -824,7 +840,7 @@ var suppressScript = [1330]uint8{ // Entry 0 - 3F 0x00, 0x00, 0x00, 0x00, 0x00, 0x20, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x5a, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x5b, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x2c, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, @@ -833,7 +849,7 @@ var suppressScript = [1330]uint8{ // Entry 40 - 7F 0x00, 0x00, 0x00, 0x0e, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x5a, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x5b, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, @@ -846,53 +862,53 @@ var suppressScript = [1330]uint8{ 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x0e, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x5a, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x5b, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, // Entry C0 - FF 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x5a, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x5b, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x5a, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x5b, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x00, 0x5a, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x5b, 0x00, 0x00, 0x00, 0x00, 0x00, // Entry 100 - 13F - 0x5a, 0x5a, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x00, 0x00, 0x00, 0x00, 0x5a, 0x00, 0x00, + 0x5b, 0x5b, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x5b, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x5a, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x5b, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - 0xea, 0x00, 0x00, 0x00, 0x00, 0xec, 0x00, 0x00, + 0xed, 0x00, 0x00, 0x00, 0x00, 0xef, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x34, 0x00, - 0x00, 0x5a, 0x00, 0x00, 0x5a, 0x00, 0x5a, 0x00, + 0x00, 0x5b, 0x00, 0x00, 0x5b, 0x00, 0x5b, 0x00, // Entry 140 - 17F - 0x5a, 0x00, 0x00, 0x00, 0x00, 0x5a, 0x00, 0x00, + 0x5b, 0x00, 0x00, 0x00, 0x00, 0x5b, 0x00, 0x00, 0x05, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x5a, 0x00, 0x00, 0x00, 0x5a, 0x00, 0x00, - 0x5a, 0x00, 0x00, 0x00, 0x00, 0x00, 0x5a, 0x00, - 0x00, 0x5a, 0x5a, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x00, 0x00, 0x00, 0x00, 0x5a, 0x5a, 0x00, + 0x00, 0x5b, 0x00, 0x00, 0x00, 0x5b, 0x00, 0x00, + 0x5b, 0x00, 0x00, 0x00, 0x00, 0x00, 0x5b, 0x00, + 0x00, 0x5b, 0x5b, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x5b, 0x5b, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, // Entry 180 - 1BF 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x5a, 0x00, 0x00, 0x00, 0x5a, 0x00, 0x00, 0x00, + 0x5b, 0x00, 0x00, 0x00, 0x5b, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x00, 0x00, 0x5a, 0x35, 0x00, 0x00, 0x00, - 0x00, 0x00, 0x00, 0x00, 0x5a, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x5b, 0x35, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x5b, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x3e, 0x00, 0x22, 0x00, // Entry 1C0 - 1FF 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x5a, 0x5a, 0x00, 0x5a, 0x5a, 0x00, 0x08, + 0x00, 0x5b, 0x5b, 0x00, 0x5b, 0x5b, 0x00, 0x08, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x5a, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x5b, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x00, 0x00, 0x5a, 0x00, 0x00, 0x00, 0x00, - 0x5a, 0x5a, 0x00, 0x3e, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x5b, 0x00, 0x00, 0x00, 0x00, + 0x5b, 0x5b, 0x00, 0x3e, 0x00, 0x00, 0x00, 0x00, // Entry 200 - 23F 0x49, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, @@ -903,9 +919,9 @@ var suppressScript = [1330]uint8{ 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, // Entry 240 - 27F - 0x00, 0x00, 0x20, 0x00, 0x00, 0x5a, 0x00, 0x00, - 0x00, 0x00, 0x4e, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x52, 0x00, 0x00, 0x53, 0x00, 0x22, 0x00, + 0x00, 0x00, 0x20, 0x00, 0x00, 0x5b, 0x00, 0x00, + 0x00, 0x00, 0x4f, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x53, 0x00, 0x00, 0x54, 0x00, 0x22, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, @@ -913,93 +929,93 @@ var suppressScript = [1330]uint8{ 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, // Entry 280 - 2BF 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x5a, 0x00, - 0x00, 0x00, 0x00, 0x00, 0x00, 0x5a, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x5b, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x5b, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x00, 0x00, 0x00, 0x00, 0x5a, 0x00, 0x00, - 0x57, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x5b, 0x00, 0x00, + 0x58, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, // Entry 2C0 - 2FF - 0x5a, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x5a, + 0x5b, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x5b, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x22, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x5a, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x5a, 0x00, 0x00, 0x00, 0x00, 0x00, 0x5a, + 0x5b, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x5b, 0x00, 0x00, 0x00, 0x00, 0x00, 0x5b, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x20, // Entry 300 - 33F - 0x00, 0x00, 0x00, 0x00, 0x6e, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x6f, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x5a, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x00, 0x00, 0x22, 0x00, 0x00, 0x00, 0x5a, - 0x5a, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x5b, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x22, 0x00, 0x00, 0x00, 0x5b, + 0x5b, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x75, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x5a, 0x00, + 0x00, 0x76, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x5b, 0x00, // Entry 340 - 37F - 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x5a, - 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x5a, 0x00, - 0x5a, 0x22, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x5a, 0x00, 0x00, 0x00, 0x00, 0x00, 0x5a, - 0x00, 0x00, 0x5a, 0x00, 0x00, 0x00, 0x00, 0x5a, - 0x00, 0x00, 0x00, 0x00, 0x00, 0x7c, 0x5a, 0x00, - 0x00, 0x00, 0x5a, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x5b, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x5b, 0x00, + 0x5b, 0x22, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x5b, 0x00, 0x00, 0x00, 0x00, 0x00, 0x5b, + 0x00, 0x00, 0x5b, 0x00, 0x00, 0x00, 0x00, 0x5b, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x7e, 0x5b, 0x00, + 0x00, 0x00, 0x5b, 0x00, 0x00, 0x00, 0x00, 0x00, // Entry 380 - 3BF - 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x5a, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x5b, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x5a, 0x00, 0x00, 0x00, 0x00, 0x81, 0x00, 0x00, + 0x5b, 0x00, 0x00, 0x00, 0x00, 0x83, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x36, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x00, 0x00, 0x5a, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x5b, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x05, 0x00, // Entry 3C0 - 3FF - 0x5a, 0x00, 0x00, 0x00, 0x5a, 0x00, 0x00, 0x00, + 0x5b, 0x00, 0x00, 0x00, 0x5b, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x00, 0x00, 0x00, 0x5a, 0x00, 0x00, 0x00, - 0x00, 0x5a, 0x00, 0x00, 0x5a, 0x00, 0x00, 0x00, - 0x00, 0x00, 0x20, 0x00, 0x00, 0x5a, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x5b, 0x00, 0x00, 0x00, + 0x00, 0x5b, 0x00, 0x00, 0x5b, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x20, 0x00, 0x00, 0x5b, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, // Entry 400 - 43F - 0x00, 0x00, 0x5a, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x00, 0x00, 0x00, 0xd4, 0x00, 0x00, 0x00, - 0x00, 0x00, 0x5a, 0x00, 0x00, 0x00, 0x5a, 0x00, - 0x00, 0x00, 0x00, 0x5a, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x5a, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x5a, 0x00, 0x00, 0x00, 0x00, 0x00, 0x5a, - 0x00, 0x00, 0x00, 0x5a, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x5b, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0xd6, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x5b, 0x00, 0x00, 0x00, 0x5b, 0x00, + 0x00, 0x00, 0x00, 0x5b, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x5b, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x5b, 0x00, 0x00, 0x00, 0x00, 0x00, 0x5b, + 0x00, 0x00, 0x00, 0x5b, 0x00, 0x00, 0x00, 0x00, // Entry 440 - 47F - 0x00, 0x00, 0x00, 0x00, 0x5a, 0x5a, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x5b, 0x5b, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - 0xe3, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0xe6, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x00, 0xe6, 0x00, 0x5a, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x00, 0x00, 0xeb, 0x00, 0x00, 0x00, 0x2c, - 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x5a, - 0x00, 0x00, 0x5a, 0x00, 0x00, 0x00, 0x5a, 0x00, + 0x00, 0xe9, 0x00, 0x5b, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0xee, 0x00, 0x00, 0x00, 0x2c, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x5b, + 0x00, 0x00, 0x5b, 0x00, 0x00, 0x00, 0x5b, 0x00, // Entry 480 - 4BF - 0x5a, 0x00, 0x5a, 0x00, 0x00, 0x00, 0x5a, 0x00, - 0x00, 0x00, 0x5a, 0x00, 0x00, 0x00, 0x5a, 0x00, + 0x5b, 0x00, 0x5b, 0x00, 0x00, 0x00, 0x5b, 0x00, + 0x00, 0x00, 0x5b, 0x00, 0x00, 0x00, 0x5b, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x5a, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x5b, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x20, 0x00, 0x00, 0x00, 0x00, 0x00, 0x05, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, // Entry 4C0 - 4FF - 0x5a, 0x00, 0x00, 0x5a, 0x00, 0x00, 0x00, 0x00, + 0x5b, 0x00, 0x00, 0x5b, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x00, 0x5a, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x5b, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, // Entry 500 - 53F 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, @@ -1007,7 +1023,7 @@ var suppressScript = [1330]uint8{ 0x00, 0x00, 0x3e, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x10, 0x00, 0x00, - 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x5a, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x5b, 0x00, 0x00, } @@ -1016,16 +1032,16 @@ const ( _419 = 31 _BR = 65 _CA = 73 - _ES = 110 - _GB = 123 - _MD = 188 - _PT = 238 - _UK = 306 - _US = 309 - _ZZ = 357 - _XA = 323 - _XC = 325 - _XK = 333 + _ES = 111 + _GB = 124 + _MD = 189 + _PT = 239 + _UK = 307 + _US = 310 + _ZZ = 358 + _XA = 324 + _XC = 326 + _XK = 334 ) // isoRegionOffset needs to be added to the index of regionISO to obtain the regionID @@ -1034,8 +1050,8 @@ const ( const isoRegionOffset = 32 // regionTypes defines the status of a region for various standards. -// Size: 358 bytes, 358 elements -var regionTypes = [358]uint8{ +// Size: 359 bytes, 359 elements +var regionTypes = [359]uint8{ // Entry 0 - 3F 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, @@ -1048,45 +1064,45 @@ var regionTypes = [358]uint8{ // Entry 40 - 7F 0x06, 0x06, 0x06, 0x06, 0x04, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, - 0x06, 0x06, 0x06, 0x06, 0x06, 0x04, 0x06, 0x04, - 0x00, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x04, - 0x06, 0x04, 0x06, 0x06, 0x06, 0x06, 0x00, 0x06, - 0x04, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, - 0x06, 0x04, 0x06, 0x06, 0x06, 0x06, 0x06, 0x00, + 0x06, 0x06, 0x06, 0x06, 0x06, 0x04, 0x04, 0x06, + 0x04, 0x00, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, + 0x04, 0x06, 0x04, 0x06, 0x06, 0x06, 0x06, 0x00, 0x06, 0x04, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, + 0x06, 0x06, 0x04, 0x06, 0x06, 0x06, 0x06, 0x06, + 0x00, 0x06, 0x04, 0x06, 0x06, 0x06, 0x06, 0x06, // Entry 80 - BF 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, - 0x06, 0x06, 0x06, 0x00, 0x04, 0x06, 0x06, 0x06, + 0x06, 0x06, 0x06, 0x06, 0x00, 0x04, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, - 0x06, 0x06, 0x06, 0x00, 0x06, 0x06, 0x06, 0x06, + 0x06, 0x06, 0x06, 0x06, 0x00, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, // Entry C0 - FF - 0x06, 0x00, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, + 0x06, 0x06, 0x00, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, - 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x00, - 0x06, 0x06, 0x06, 0x06, 0x00, 0x06, 0x04, 0x06, - 0x06, 0x06, 0x06, 0x00, 0x06, 0x06, 0x06, 0x06, - 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x00, - 0x06, 0x06, 0x00, 0x06, 0x05, 0x05, 0x05, 0x05, + 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, + 0x00, 0x06, 0x06, 0x06, 0x06, 0x00, 0x06, 0x04, + 0x06, 0x06, 0x06, 0x06, 0x00, 0x06, 0x06, 0x06, + 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, + 0x00, 0x06, 0x06, 0x00, 0x06, 0x05, 0x05, 0x05, 0x05, 0x05, 0x05, 0x05, 0x05, 0x05, 0x05, 0x05, // Entry 100 - 13F - 0x05, 0x05, 0x06, 0x00, 0x06, 0x06, 0x06, 0x06, + 0x05, 0x05, 0x05, 0x06, 0x00, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, - 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x04, 0x06, + 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x04, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, - 0x06, 0x06, 0x02, 0x06, 0x04, 0x06, 0x06, 0x06, - 0x06, 0x06, 0x00, 0x06, 0x06, 0x06, 0x06, 0x06, + 0x06, 0x06, 0x06, 0x02, 0x06, 0x04, 0x06, 0x06, + 0x06, 0x06, 0x06, 0x00, 0x06, 0x06, 0x06, 0x06, // Entry 140 - 17F - 0x06, 0x00, 0x06, 0x05, 0x05, 0x05, 0x05, 0x05, + 0x06, 0x06, 0x00, 0x06, 0x05, 0x05, 0x05, 0x05, 0x05, 0x05, 0x05, 0x05, 0x05, 0x05, 0x05, 0x05, 0x05, 0x05, 0x05, 0x05, 0x05, 0x05, 0x05, 0x05, - 0x05, 0x05, 0x05, 0x05, 0x05, 0x04, 0x06, 0x06, - 0x04, 0x06, 0x06, 0x04, 0x06, 0x05, + 0x05, 0x05, 0x05, 0x05, 0x05, 0x05, 0x04, 0x06, + 0x06, 0x04, 0x06, 0x06, 0x04, 0x06, 0x05, } // regionISO holds a list of alphabetically sorted 2-letter ISO region codes. @@ -1094,27 +1110,27 @@ var regionTypes = [358]uint8{ // - [A-Z}{2}: the first letter of the 2-letter code plus these two // letters form the 3-letter ISO code. // - 0, n: index into altRegionISO3. -const regionISO tag.Index = "" + // Size: 1308 bytes +const regionISO tag.Index = "" + // Size: 1312 bytes "AAAAACSCADNDAEREAFFGAGTGAIIAALLBAMRMANNTAOGOAQTAARRGASSMATUTAUUSAWBWAXLA" + "AZZEBAIHBBRBBDGDBEELBFFABGGRBHHRBIDIBJENBLLMBMMUBNRNBOOLBQESBRRABSHSBTTN" + "BUURBVVTBWWABYLRBZLZCAANCCCKCDODCFAFCGOGCHHECIIVCKOKCLHLCMMRCNHNCOOLCPPT" + - "CRRICS\x00\x00CTTECUUBCVPVCWUWCXXRCYYPCZZEDDDRDEEUDGGADJJIDKNKDMMADOOMDY" + - "HYDZZAEA ECCUEESTEGGYEHSHERRIESSPETTHEU\x00\x03EZ FIINFJJIFKLKFMSMFORO" + - "FQ\x00\x18FRRAFXXXGAABGBBRGDRDGEEOGFUFGGGYGHHAGIIBGLRLGMMBGNINGPLPGQNQGR" + - "RCGS\x00\x06GTTMGUUMGWNBGYUYHKKGHMMDHNNDHRRVHTTIHUUNHVVOIC IDDNIERLILSR" + - "IMMNINNDIOOTIQRQIRRNISSLITTAJEEYJMAMJOORJPPNJTTNKEENKGGZKHHMKIIRKM\x00" + - "\x09KNNAKP\x00\x0cKRORKWWTKY\x00\x0fKZAZLAAOLBBNLCCALIIELKKALRBRLSSOLTTU" + - "LUUXLVVALYBYMAARMCCOMDDAMENEMFAFMGDGMHHLMIIDMKKDMLLIMMMRMNNGMOACMPNPMQTQ" + - "MRRTMSSRMTLTMUUSMVDVMWWIMXEXMYYSMZOZNAAMNCCLNEERNFFKNGGANHHBNIICNLLDNOOR" + - "NPPLNQ\x00\x1eNRRUNTTZNUIUNZZLOMMNPAANPCCIPEERPFYFPGNGPHHLPKAKPLOLPM\x00" + - "\x12PNCNPRRIPSSEPTRTPUUSPWLWPYRYPZCZQAATQMMMQNNNQOOOQPPPQQQQQRRRQSSSQTTT" + - "QU\x00\x03QVVVQWWWQXXXQYYYQZZZREEURHHOROOURS\x00\x15RUUSRWWASAAUSBLBSCYC" + - "SDDNSEWESGGPSHHNSIVNSJJMSKVKSLLESMMRSNENSOOMSRURSSSDSTTPSUUNSVLVSXXMSYYR" + - "SZWZTAAATCCATDCDTF\x00\x18TGGOTHHATJJKTKKLTLLSTMKMTNUNTOONTPMPTRURTTTOTV" + - "UVTWWNTZZAUAKRUGGAUK UMMIUN USSAUYRYUZZBVAATVCCTVDDRVEENVGGBVIIRVNNMVU" + - "UTWFLFWKAKWSSMXAAAXBBBXCCCXDDDXEEEXFFFXGGGXHHHXIIIXJJJXKKKXLLLXMMMXNNNXO" + - "OOXPPPXQQQXRRRXSSSXTTTXUUUXVVVXWWWXXXXXYYYXZZZYDMDYEEMYT\x00\x1bYUUGZAAF" + - "ZMMBZRARZWWEZZZZ\xff\xff\xff\xff" + "CQ CRRICS\x00\x00CTTECUUBCVPVCWUWCXXRCYYPCZZEDDDRDEEUDGGADJJIDKNKDMMADO" + + "OMDYHYDZZAEA ECCUEESTEGGYEHSHERRIESSPETTHEU\x00\x03EZ FIINFJJIFKLKFMSM" + + "FOROFQ\x00\x18FRRAFXXXGAABGBBRGDRDGEEOGFUFGGGYGHHAGIIBGLRLGMMBGNINGPLPGQ" + + "NQGRRCGS\x00\x06GTTMGUUMGWNBGYUYHKKGHMMDHNNDHRRVHTTIHUUNHVVOIC IDDNIERL" + + "ILSRIMMNINNDIOOTIQRQIRRNISSLITTAJEEYJMAMJOORJPPNJTTNKEENKGGZKHHMKIIRKM" + + "\x00\x09KNNAKP\x00\x0cKRORKWWTKY\x00\x0fKZAZLAAOLBBNLCCALIIELKKALRBRLSSO" + + "LTTULUUXLVVALYBYMAARMCCOMDDAMENEMFAFMGDGMHHLMIIDMKKDMLLIMMMRMNNGMOACMPNP" + + "MQTQMRRTMSSRMTLTMUUSMVDVMWWIMXEXMYYSMZOZNAAMNCCLNEERNFFKNGGANHHBNIICNLLD" + + "NOORNPPLNQ\x00\x1eNRRUNTTZNUIUNZZLOMMNPAANPCCIPEERPFYFPGNGPHHLPKAKPLOLPM" + + "\x00\x12PNCNPRRIPSSEPTRTPUUSPWLWPYRYPZCZQAATQMMMQNNNQOOOQPPPQQQQQRRRQSSS" + + "QTTTQU\x00\x03QVVVQWWWQXXXQYYYQZZZREEURHHOROOURS\x00\x15RUUSRWWASAAUSBLB" + + "SCYCSDDNSEWESGGPSHHNSIVNSJJMSKVKSLLESMMRSNENSOOMSRURSSSDSTTPSUUNSVLVSXXM" + + "SYYRSZWZTAAATCCATDCDTF\x00\x18TGGOTHHATJJKTKKLTLLSTMKMTNUNTOONTPMPTRURTT" + + "TOTVUVTWWNTZZAUAKRUGGAUK UMMIUN USSAUYRYUZZBVAATVCCTVDDRVEENVGGBVIIRVN" + + "NMVUUTWFLFWKAKWSSMXAAAXBBBXCCCXDDDXEEEXFFFXGGGXHHHXIIIXJJJXKKKXLLLXMMMXN" + + "NNXOOOXPPPXQQQXRRRXSSSXTTTXUUUXVVVXWWWXXXXXYYYXZZZYDMDYEEMYT\x00\x1bYUUG" + + "ZAAFZMMBZRARZWWEZZZZ\xff\xff\xff\xff" // altRegionISO3 holds a list of 3-letter region codes that cannot be // mapped to 2-letter codes using the default algorithm. This is a short list. @@ -1124,38 +1140,38 @@ const altRegionISO3 string = "SCGQUUSGSCOMPRKCYMSPMSRBATFMYTATN" // of the 3-letter ISO codes in altRegionISO3. // Size: 22 bytes, 11 elements var altRegionIDs = [11]uint16{ - 0x0057, 0x0070, 0x0088, 0x00a8, 0x00aa, 0x00ad, 0x00ea, 0x0105, - 0x0121, 0x015f, 0x00dc, + 0x0058, 0x0071, 0x0089, 0x00a9, 0x00ab, 0x00ae, 0x00eb, 0x0106, + 0x0122, 0x0160, 0x00dd, } // Size: 80 bytes, 20 elements var regionOldMap = [20]FromTo{ - 0: {From: 0x44, To: 0xc4}, - 1: {From: 0x58, To: 0xa7}, - 2: {From: 0x5f, To: 0x60}, - 3: {From: 0x66, To: 0x3b}, - 4: {From: 0x79, To: 0x78}, - 5: {From: 0x93, To: 0x37}, - 6: {From: 0xa3, To: 0x133}, - 7: {From: 0xc1, To: 0x133}, - 8: {From: 0xd7, To: 0x13f}, - 9: {From: 0xdc, To: 0x2b}, - 10: {From: 0xef, To: 0x133}, - 11: {From: 0xf2, To: 0xe2}, - 12: {From: 0xfc, To: 0x70}, - 13: {From: 0x103, To: 0x164}, - 14: {From: 0x12a, To: 0x126}, - 15: {From: 0x132, To: 0x7b}, - 16: {From: 0x13a, To: 0x13e}, - 17: {From: 0x141, To: 0x133}, - 18: {From: 0x15d, To: 0x15e}, - 19: {From: 0x163, To: 0x4b}, + 0: {From: 0x44, To: 0xc5}, + 1: {From: 0x59, To: 0xa8}, + 2: {From: 0x60, To: 0x61}, + 3: {From: 0x67, To: 0x3b}, + 4: {From: 0x7a, To: 0x79}, + 5: {From: 0x94, To: 0x37}, + 6: {From: 0xa4, To: 0x134}, + 7: {From: 0xc2, To: 0x134}, + 8: {From: 0xd8, To: 0x140}, + 9: {From: 0xdd, To: 0x2b}, + 10: {From: 0xf0, To: 0x134}, + 11: {From: 0xf3, To: 0xe3}, + 12: {From: 0xfd, To: 0x71}, + 13: {From: 0x104, To: 0x165}, + 14: {From: 0x12b, To: 0x127}, + 15: {From: 0x133, To: 0x7c}, + 16: {From: 0x13b, To: 0x13f}, + 17: {From: 0x142, To: 0x134}, + 18: {From: 0x15e, To: 0x15f}, + 19: {From: 0x164, To: 0x4b}, } // m49 maps regionIDs to UN.M49 codes. The first isoRegionOffset entries are // codes indicating collections of regions. -// Size: 716 bytes, 358 elements -var m49 = [358]int16{ +// Size: 718 bytes, 359 elements +var m49 = [359]int16{ // Entry 0 - 3F 0, 1, 2, 3, 5, 9, 11, 13, 14, 15, 17, 18, 19, 21, 29, 30, @@ -1168,45 +1184,45 @@ var m49 = [358]int16{ // Entry 40 - 7F 535, 76, 44, 64, 104, 74, 72, 112, 84, 124, 166, 180, 140, 178, 756, 384, - 184, 152, 120, 156, 170, 0, 188, 891, - 296, 192, 132, 531, 162, 196, 203, 278, - 276, 0, 262, 208, 212, 214, 204, 12, - 0, 218, 233, 818, 732, 232, 724, 231, - 967, 0, 246, 242, 238, 583, 234, 0, - 250, 249, 266, 826, 308, 268, 254, 831, + 184, 152, 120, 156, 170, 0, 0, 188, + 891, 296, 192, 132, 531, 162, 196, 203, + 278, 276, 0, 262, 208, 212, 214, 204, + 12, 0, 218, 233, 818, 732, 232, 724, + 231, 967, 0, 246, 242, 238, 583, 234, + 0, 250, 249, 266, 826, 308, 268, 254, // Entry 80 - BF - 288, 292, 304, 270, 324, 312, 226, 300, - 239, 320, 316, 624, 328, 344, 334, 340, - 191, 332, 348, 854, 0, 360, 372, 376, - 833, 356, 86, 368, 364, 352, 380, 832, - 388, 400, 392, 581, 404, 417, 116, 296, - 174, 659, 408, 410, 414, 136, 398, 418, - 422, 662, 438, 144, 430, 426, 440, 442, - 428, 434, 504, 492, 498, 499, 663, 450, + 831, 288, 292, 304, 270, 324, 312, 226, + 300, 239, 320, 316, 624, 328, 344, 334, + 340, 191, 332, 348, 854, 0, 360, 372, + 376, 833, 356, 86, 368, 364, 352, 380, + 832, 388, 400, 392, 581, 404, 417, 116, + 296, 174, 659, 408, 410, 414, 136, 398, + 418, 422, 662, 438, 144, 430, 426, 440, + 442, 428, 434, 504, 492, 498, 499, 663, // Entry C0 - FF - 584, 581, 807, 466, 104, 496, 446, 580, - 474, 478, 500, 470, 480, 462, 454, 484, - 458, 508, 516, 540, 562, 574, 566, 548, - 558, 528, 578, 524, 10, 520, 536, 570, - 554, 512, 591, 0, 604, 258, 598, 608, - 586, 616, 666, 612, 630, 275, 620, 581, - 585, 600, 591, 634, 959, 960, 961, 962, - 963, 964, 965, 966, 967, 968, 969, 970, + 450, 584, 581, 807, 466, 104, 496, 446, + 580, 474, 478, 500, 470, 480, 462, 454, + 484, 458, 508, 516, 540, 562, 574, 566, + 548, 558, 528, 578, 524, 10, 520, 536, + 570, 554, 512, 591, 0, 604, 258, 598, + 608, 586, 616, 666, 612, 630, 275, 620, + 581, 585, 600, 591, 634, 959, 960, 961, + 962, 963, 964, 965, 966, 967, 968, 969, // Entry 100 - 13F - 971, 972, 638, 716, 642, 688, 643, 646, - 682, 90, 690, 729, 752, 702, 654, 705, - 744, 703, 694, 674, 686, 706, 740, 728, - 678, 810, 222, 534, 760, 748, 0, 796, - 148, 260, 768, 764, 762, 772, 626, 795, - 788, 776, 626, 792, 780, 798, 158, 834, - 804, 800, 826, 581, 0, 840, 858, 860, - 336, 670, 704, 862, 92, 850, 704, 548, + 970, 971, 972, 638, 716, 642, 688, 643, + 646, 682, 90, 690, 729, 752, 702, 654, + 705, 744, 703, 694, 674, 686, 706, 740, + 728, 678, 810, 222, 534, 760, 748, 0, + 796, 148, 260, 768, 764, 762, 772, 626, + 795, 788, 776, 626, 792, 780, 798, 158, + 834, 804, 800, 826, 581, 0, 840, 858, + 860, 336, 670, 704, 862, 92, 850, 704, // Entry 140 - 17F - 876, 581, 882, 973, 974, 975, 976, 977, - 978, 979, 980, 981, 982, 983, 984, 985, - 986, 987, 988, 989, 990, 991, 992, 993, - 994, 995, 996, 997, 998, 720, 887, 175, - 891, 710, 894, 180, 716, 999, + 548, 876, 581, 882, 973, 974, 975, 976, + 977, 978, 979, 980, 981, 982, 983, 984, + 985, 986, 987, 988, 989, 990, 991, 992, + 993, 994, 995, 996, 997, 998, 720, 887, + 175, 891, 710, 894, 180, 716, 999, } // m49Index gives indexes into fromM49 based on the three most significant bits @@ -1227,65 +1243,65 @@ var m49Index = [9]int16{ var fromM49 = [333]uint16{ // Entry 0 - 3F 0x0201, 0x0402, 0x0603, 0x0824, 0x0a04, 0x1027, 0x1205, 0x142b, - 0x1606, 0x1867, 0x1a07, 0x1c08, 0x1e09, 0x202d, 0x220a, 0x240b, + 0x1606, 0x1868, 0x1a07, 0x1c08, 0x1e09, 0x202d, 0x220a, 0x240b, 0x260c, 0x2822, 0x2a0d, 0x302a, 0x3825, 0x3a0e, 0x3c0f, 0x3e32, 0x402c, 0x4410, 0x4611, 0x482f, 0x4e12, 0x502e, 0x5842, 0x6039, 0x6435, 0x6628, 0x6834, 0x6a13, 0x6c14, 0x7036, 0x7215, 0x783d, 0x7a16, 0x8043, 0x883f, 0x8c33, 0x9046, 0x9445, 0x9841, 0xa848, - 0xac9a, 0xb509, 0xb93c, 0xc03e, 0xc838, 0xd0c4, 0xd83a, 0xe047, - 0xe8a6, 0xf052, 0xf849, 0x085a, 0x10ad, 0x184c, 0x1c17, 0x1e18, + 0xac9b, 0xb50a, 0xb93d, 0xc03e, 0xc838, 0xd0c5, 0xd83a, 0xe047, + 0xe8a7, 0xf052, 0xf849, 0x085b, 0x10ae, 0x184c, 0x1c17, 0x1e18, // Entry 40 - 7F - 0x20b3, 0x2219, 0x2920, 0x2c1a, 0x2e1b, 0x3051, 0x341c, 0x361d, - 0x3853, 0x3d2e, 0x445c, 0x4c4a, 0x5454, 0x5ca8, 0x5f5f, 0x644d, - 0x684b, 0x7050, 0x7856, 0x7e90, 0x8059, 0x885d, 0x941e, 0x965e, - 0x983b, 0xa063, 0xa864, 0xac65, 0xb469, 0xbd1a, 0xc486, 0xcc6f, - 0xce6f, 0xd06d, 0xd26a, 0xd476, 0xdc74, 0xde88, 0xe473, 0xec72, - 0xf031, 0xf279, 0xf478, 0xfc7e, 0x04e5, 0x0921, 0x0c62, 0x147a, - 0x187d, 0x1c83, 0x26ed, 0x2860, 0x2c5f, 0x3060, 0x4080, 0x4881, - 0x50a7, 0x5887, 0x6082, 0x687c, 0x7085, 0x788a, 0x8089, 0x8884, + 0x20b4, 0x2219, 0x2921, 0x2c1a, 0x2e1b, 0x3051, 0x341c, 0x361d, + 0x3853, 0x3d2f, 0x445d, 0x4c4a, 0x5454, 0x5ca9, 0x5f60, 0x644d, + 0x684b, 0x7050, 0x7857, 0x7e91, 0x805a, 0x885e, 0x941e, 0x965f, + 0x983b, 0xa064, 0xa865, 0xac66, 0xb46a, 0xbd1b, 0xc487, 0xcc70, + 0xce70, 0xd06e, 0xd26b, 0xd477, 0xdc75, 0xde89, 0xe474, 0xec73, + 0xf031, 0xf27a, 0xf479, 0xfc7f, 0x04e6, 0x0922, 0x0c63, 0x147b, + 0x187e, 0x1c84, 0x26ee, 0x2861, 0x2c60, 0x3061, 0x4081, 0x4882, + 0x50a8, 0x5888, 0x6083, 0x687d, 0x7086, 0x788b, 0x808a, 0x8885, // Entry 80 - BF - 0x908c, 0x9891, 0x9c8e, 0xa138, 0xa88f, 0xb08d, 0xb892, 0xc09d, - 0xc899, 0xd095, 0xd89c, 0xe09b, 0xe896, 0xf097, 0xf89e, 0x004f, - 0x08a0, 0x10a2, 0x1cae, 0x20a1, 0x28a4, 0x30aa, 0x34ab, 0x3cac, - 0x42a5, 0x44af, 0x461f, 0x4cb0, 0x54b5, 0x58b8, 0x5cb4, 0x64b9, - 0x6cb2, 0x70b6, 0x74b7, 0x7cc6, 0x84bf, 0x8cce, 0x94d0, 0x9ccd, - 0xa4c3, 0xaccb, 0xb4c8, 0xbcc9, 0xc0cc, 0xc8cf, 0xd8bb, 0xe0c5, - 0xe4bc, 0xe6bd, 0xe8ca, 0xf0ba, 0xf8d1, 0x00e1, 0x08d2, 0x10dd, - 0x18db, 0x20d9, 0x2429, 0x265b, 0x2a30, 0x2d1b, 0x2e40, 0x30de, + 0x908d, 0x9892, 0x9c8f, 0xa139, 0xa890, 0xb08e, 0xb893, 0xc09e, + 0xc89a, 0xd096, 0xd89d, 0xe09c, 0xe897, 0xf098, 0xf89f, 0x004f, + 0x08a1, 0x10a3, 0x1caf, 0x20a2, 0x28a5, 0x30ab, 0x34ac, 0x3cad, + 0x42a6, 0x44b0, 0x461f, 0x4cb1, 0x54b6, 0x58b9, 0x5cb5, 0x64ba, + 0x6cb3, 0x70b7, 0x74b8, 0x7cc7, 0x84c0, 0x8ccf, 0x94d1, 0x9cce, + 0xa4c4, 0xaccc, 0xb4c9, 0xbcca, 0xc0cd, 0xc8d0, 0xd8bc, 0xe0c6, + 0xe4bd, 0xe6be, 0xe8cb, 0xf0bb, 0xf8d2, 0x00e2, 0x08d3, 0x10de, + 0x18dc, 0x20da, 0x2429, 0x265c, 0x2a30, 0x2d1c, 0x2e40, 0x30df, // Entry C0 - FF - 0x38d3, 0x493f, 0x54e0, 0x5cd8, 0x64d4, 0x6cd6, 0x74df, 0x7cd5, - 0x84da, 0x88c7, 0x8b33, 0x8e75, 0x90c0, 0x92f0, 0x94e8, 0x9ee2, - 0xace6, 0xb0f1, 0xb8e4, 0xc0e7, 0xc8eb, 0xd0e9, 0xd8ee, 0xe08b, - 0xe526, 0xecec, 0xf4f3, 0xfd02, 0x0504, 0x0706, 0x0d07, 0x183c, - 0x1d0e, 0x26a9, 0x2826, 0x2cb1, 0x2ebe, 0x34ea, 0x3d39, 0x4513, - 0x4d18, 0x5508, 0x5d14, 0x6105, 0x650a, 0x6d12, 0x7d0d, 0x7f11, - 0x813e, 0x830f, 0x8515, 0x8d61, 0x9964, 0xa15d, 0xa86e, 0xb117, - 0xb30b, 0xb86c, 0xc10b, 0xc916, 0xd110, 0xd91d, 0xe10c, 0xe84e, + 0x38d4, 0x4940, 0x54e1, 0x5cd9, 0x64d5, 0x6cd7, 0x74e0, 0x7cd6, + 0x84db, 0x88c8, 0x8b34, 0x8e76, 0x90c1, 0x92f1, 0x94e9, 0x9ee3, + 0xace7, 0xb0f2, 0xb8e5, 0xc0e8, 0xc8ec, 0xd0ea, 0xd8ef, 0xe08c, + 0xe527, 0xeced, 0xf4f4, 0xfd03, 0x0505, 0x0707, 0x0d08, 0x183c, + 0x1d0f, 0x26aa, 0x2826, 0x2cb2, 0x2ebf, 0x34eb, 0x3d3a, 0x4514, + 0x4d19, 0x5509, 0x5d15, 0x6106, 0x650b, 0x6d13, 0x7d0e, 0x7f12, + 0x813f, 0x8310, 0x8516, 0x8d62, 0x9965, 0xa15e, 0xa86f, 0xb118, + 0xb30c, 0xb86d, 0xc10c, 0xc917, 0xd111, 0xd91e, 0xe10d, 0xe84e, // Entry 100 - 13F - 0xf11c, 0xf524, 0xf923, 0x0122, 0x0925, 0x1129, 0x192c, 0x2023, - 0x2928, 0x312b, 0x3727, 0x391f, 0x3d2d, 0x4131, 0x4930, 0x4ec2, - 0x5519, 0x646b, 0x747b, 0x7e7f, 0x809f, 0x8298, 0x852f, 0x9135, - 0xa53d, 0xac37, 0xb536, 0xb937, 0xbd3b, 0xd940, 0xe542, 0xed5e, - 0xef5e, 0xf657, 0xfd62, 0x7c20, 0x7ef4, 0x80f5, 0x82f6, 0x84f7, - 0x86f8, 0x88f9, 0x8afa, 0x8cfb, 0x8e70, 0x90fd, 0x92fe, 0x94ff, - 0x9700, 0x9901, 0x9b43, 0x9d44, 0x9f45, 0xa146, 0xa347, 0xa548, - 0xa749, 0xa94a, 0xab4b, 0xad4c, 0xaf4d, 0xb14e, 0xb34f, 0xb550, + 0xf11d, 0xf525, 0xf924, 0x0123, 0x0926, 0x112a, 0x192d, 0x2023, + 0x2929, 0x312c, 0x3728, 0x3920, 0x3d2e, 0x4132, 0x4931, 0x4ec3, + 0x551a, 0x646c, 0x747c, 0x7e80, 0x80a0, 0x8299, 0x8530, 0x9136, + 0xa53e, 0xac37, 0xb537, 0xb938, 0xbd3c, 0xd941, 0xe543, 0xed5f, + 0xef5f, 0xf658, 0xfd63, 0x7c20, 0x7ef5, 0x80f6, 0x82f7, 0x84f8, + 0x86f9, 0x88fa, 0x8afb, 0x8cfc, 0x8e71, 0x90fe, 0x92ff, 0x9500, + 0x9701, 0x9902, 0x9b44, 0x9d45, 0x9f46, 0xa147, 0xa348, 0xa549, + 0xa74a, 0xa94b, 0xab4c, 0xad4d, 0xaf4e, 0xb14f, 0xb350, 0xb551, // Entry 140 - 17F - 0xb751, 0xb952, 0xbb53, 0xbd54, 0xbf55, 0xc156, 0xc357, 0xc558, - 0xc759, 0xc95a, 0xcb5b, 0xcd5c, 0xcf65, + 0xb752, 0xb953, 0xbb54, 0xbd55, 0xbf56, 0xc157, 0xc358, 0xc559, + 0xc75a, 0xc95b, 0xcb5c, 0xcd5d, 0xcf66, } -// Size: 2014 bytes +// Size: 2128 bytes var variantIndex = map[string]uint8{ "1606nict": 0x0, "1694acad": 0x1, "1901": 0x2, "1959acad": 0x3, - "1994": 0x61, + "1994": 0x67, "1996": 0x4, "abl1943": 0x5, "akuapem": 0x6, - "alalc97": 0x63, + "alalc97": 0x69, "aluku": 0x7, "ao1990": 0x8, "aranes": 0x9, @@ -1299,94 +1315,100 @@ var variantIndex = map[string]uint8{ "barla": 0x11, "basiceng": 0x12, "bauddha": 0x13, - "biscayan": 0x14, - "biske": 0x5c, - "bohoric": 0x15, - "boont": 0x16, - "bornholm": 0x17, - "cisaup": 0x18, - "colb1945": 0x19, - "cornu": 0x1a, - "creiss": 0x1b, - "dajnko": 0x1c, - "ekavsk": 0x1d, - "emodeng": 0x1e, - "fonipa": 0x64, - "fonkirsh": 0x65, - "fonnapa": 0x66, - "fonupa": 0x67, - "fonxsamp": 0x68, - "gascon": 0x1f, - "grclass": 0x20, - "grital": 0x21, - "grmistr": 0x22, - "hepburn": 0x23, - "heploc": 0x62, - "hognorsk": 0x24, - "hsistemo": 0x25, - "ijekavsk": 0x26, - "itihasa": 0x27, - "ivanchov": 0x28, - "jauer": 0x29, - "jyutping": 0x2a, - "kkcor": 0x2b, - "kociewie": 0x2c, - "kscor": 0x2d, - "laukika": 0x2e, - "lemosin": 0x2f, - "lengadoc": 0x30, - "lipaw": 0x5d, - "luna1918": 0x31, - "metelko": 0x32, - "monoton": 0x33, - "ndyuka": 0x34, - "nedis": 0x35, - "newfound": 0x36, - "nicard": 0x37, - "njiva": 0x5e, - "nulik": 0x38, - "osojs": 0x5f, - "oxendict": 0x39, - "pahawh2": 0x3a, - "pahawh3": 0x3b, - "pahawh4": 0x3c, - "pamaka": 0x3d, - "peano": 0x3e, - "petr1708": 0x3f, - "pinyin": 0x40, - "polyton": 0x41, - "provenc": 0x42, - "puter": 0x43, - "rigik": 0x44, - "rozaj": 0x45, - "rumgr": 0x46, - "scotland": 0x47, - "scouse": 0x48, - "simple": 0x69, - "solba": 0x60, - "sotav": 0x49, - "spanglis": 0x4a, - "surmiran": 0x4b, - "sursilv": 0x4c, - "sutsilv": 0x4d, - "tarask": 0x4e, - "tongyong": 0x4f, - "tunumiit": 0x50, - "uccor": 0x51, - "ucrcor": 0x52, - "ulster": 0x53, - "unifon": 0x54, - "vaidika": 0x55, - "valencia": 0x56, - "vallader": 0x57, - "vecdruka": 0x58, - "vivaraup": 0x59, - "wadegile": 0x5a, - "xsistemo": 0x5b, + "bciav": 0x14, + "bcizbl": 0x15, + "biscayan": 0x16, + "biske": 0x62, + "bohoric": 0x17, + "boont": 0x18, + "bornholm": 0x19, + "cisaup": 0x1a, + "colb1945": 0x1b, + "cornu": 0x1c, + "creiss": 0x1d, + "dajnko": 0x1e, + "ekavsk": 0x1f, + "emodeng": 0x20, + "fonipa": 0x6a, + "fonkirsh": 0x6b, + "fonnapa": 0x6c, + "fonupa": 0x6d, + "fonxsamp": 0x6e, + "gallo": 0x21, + "gascon": 0x22, + "grclass": 0x23, + "grital": 0x24, + "grmistr": 0x25, + "hepburn": 0x26, + "heploc": 0x68, + "hognorsk": 0x27, + "hsistemo": 0x28, + "ijekavsk": 0x29, + "itihasa": 0x2a, + "ivanchov": 0x2b, + "jauer": 0x2c, + "jyutping": 0x2d, + "kkcor": 0x2e, + "kociewie": 0x2f, + "kscor": 0x30, + "laukika": 0x31, + "lemosin": 0x32, + "lengadoc": 0x33, + "lipaw": 0x63, + "ltg1929": 0x34, + "ltg2007": 0x35, + "luna1918": 0x36, + "metelko": 0x37, + "monoton": 0x38, + "ndyuka": 0x39, + "nedis": 0x3a, + "newfound": 0x3b, + "nicard": 0x3c, + "njiva": 0x64, + "nulik": 0x3d, + "osojs": 0x65, + "oxendict": 0x3e, + "pahawh2": 0x3f, + "pahawh3": 0x40, + "pahawh4": 0x41, + "pamaka": 0x42, + "peano": 0x43, + "petr1708": 0x44, + "pinyin": 0x45, + "polyton": 0x46, + "provenc": 0x47, + "puter": 0x48, + "rigik": 0x49, + "rozaj": 0x4a, + "rumgr": 0x4b, + "scotland": 0x4c, + "scouse": 0x4d, + "simple": 0x6f, + "solba": 0x66, + "sotav": 0x4e, + "spanglis": 0x4f, + "surmiran": 0x50, + "sursilv": 0x51, + "sutsilv": 0x52, + "synnejyl": 0x53, + "tarask": 0x54, + "tongyong": 0x55, + "tunumiit": 0x56, + "uccor": 0x57, + "ucrcor": 0x58, + "ulster": 0x59, + "unifon": 0x5a, + "vaidika": 0x5b, + "valencia": 0x5c, + "vallader": 0x5d, + "vecdruka": 0x5e, + "vivaraup": 0x5f, + "wadegile": 0x60, + "xsistemo": 0x61, } // variantNumSpecialized is the number of specialized variants in variants. -const variantNumSpecialized = 99 +const variantNumSpecialized = 105 // nRegionGroups is the number of region groups. const nRegionGroups = 33 @@ -1398,151 +1420,151 @@ type likelyLangRegion struct { // likelyScript is a lookup table, indexed by scriptID, for the most likely // languages and regions given a script. -// Size: 1040 bytes, 260 elements -var likelyScript = [260]likelyLangRegion{ - 1: {lang: 0x14e, region: 0x84}, - 3: {lang: 0x2a2, region: 0x106}, - 4: {lang: 0x1f, region: 0x99}, - 5: {lang: 0x3a, region: 0x6b}, - 7: {lang: 0x3b, region: 0x9c}, +// Size: 1052 bytes, 263 elements +var likelyScript = [263]likelyLangRegion{ + 1: {lang: 0x14e, region: 0x85}, + 3: {lang: 0x2a2, region: 0x107}, + 4: {lang: 0x1f, region: 0x9a}, + 5: {lang: 0x3a, region: 0x6c}, + 7: {lang: 0x3b, region: 0x9d}, 8: {lang: 0x1d7, region: 0x28}, - 9: {lang: 0x13, region: 0x9c}, - 10: {lang: 0x5b, region: 0x95}, + 9: {lang: 0x13, region: 0x9d}, + 10: {lang: 0x5b, region: 0x96}, 11: {lang: 0x60, region: 0x52}, - 12: {lang: 0xb9, region: 0xb4}, - 13: {lang: 0x63, region: 0x95}, + 12: {lang: 0xb9, region: 0xb5}, + 13: {lang: 0x63, region: 0x96}, 14: {lang: 0xa5, region: 0x35}, - 15: {lang: 0x3e9, region: 0x99}, - 17: {lang: 0x529, region: 0x12e}, - 18: {lang: 0x3b1, region: 0x99}, - 19: {lang: 0x15e, region: 0x78}, - 20: {lang: 0xc2, region: 0x95}, - 21: {lang: 0x9d, region: 0xe7}, + 15: {lang: 0x3e9, region: 0x9a}, + 17: {lang: 0x529, region: 0x12f}, + 18: {lang: 0x3b1, region: 0x9a}, + 19: {lang: 0x15e, region: 0x79}, + 20: {lang: 0xc2, region: 0x96}, + 21: {lang: 0x9d, region: 0xe8}, 22: {lang: 0xdb, region: 0x35}, 23: {lang: 0xf3, region: 0x49}, - 24: {lang: 0x4f0, region: 0x12b}, - 25: {lang: 0xe7, region: 0x13e}, - 26: {lang: 0xe5, region: 0x135}, - 29: {lang: 0xf1, region: 0x6b}, - 31: {lang: 0x1a0, region: 0x5d}, - 32: {lang: 0x3e2, region: 0x106}, - 34: {lang: 0x1be, region: 0x99}, - 38: {lang: 0x15e, region: 0x78}, - 41: {lang: 0x133, region: 0x6b}, + 24: {lang: 0x4f0, region: 0x12c}, + 25: {lang: 0xe7, region: 0x13f}, + 26: {lang: 0xe5, region: 0x136}, + 29: {lang: 0xf1, region: 0x6c}, + 31: {lang: 0x1a0, region: 0x5e}, + 32: {lang: 0x3e2, region: 0x107}, + 34: {lang: 0x1be, region: 0x9a}, + 38: {lang: 0x15e, region: 0x79}, + 41: {lang: 0x133, region: 0x6c}, 42: {lang: 0x431, region: 0x27}, - 44: {lang: 0x27, region: 0x6f}, - 46: {lang: 0x210, region: 0x7d}, + 44: {lang: 0x27, region: 0x70}, + 46: {lang: 0x210, region: 0x7e}, 47: {lang: 0xfe, region: 0x38}, - 49: {lang: 0x19b, region: 0x99}, - 50: {lang: 0x19e, region: 0x130}, - 51: {lang: 0x3e9, region: 0x99}, - 52: {lang: 0x136, region: 0x87}, - 53: {lang: 0x1a4, region: 0x99}, - 54: {lang: 0x39d, region: 0x99}, - 55: {lang: 0x529, region: 0x12e}, - 56: {lang: 0x254, region: 0xab}, + 49: {lang: 0x19b, region: 0x9a}, + 50: {lang: 0x19e, region: 0x131}, + 51: {lang: 0x3e9, region: 0x9a}, + 52: {lang: 0x136, region: 0x88}, + 53: {lang: 0x1a4, region: 0x9a}, + 54: {lang: 0x39d, region: 0x9a}, + 55: {lang: 0x529, region: 0x12f}, + 56: {lang: 0x254, region: 0xac}, 57: {lang: 0x529, region: 0x53}, - 58: {lang: 0x1cb, region: 0xe7}, + 58: {lang: 0x1cb, region: 0xe8}, 59: {lang: 0x529, region: 0x53}, - 60: {lang: 0x529, region: 0x12e}, - 61: {lang: 0x2fd, region: 0x9b}, - 62: {lang: 0x1bc, region: 0x97}, - 63: {lang: 0x200, region: 0xa2}, - 64: {lang: 0x1c5, region: 0x12b}, - 65: {lang: 0x1ca, region: 0xaf}, - 68: {lang: 0x1d5, region: 0x92}, - 70: {lang: 0x142, region: 0x9e}, - 71: {lang: 0x254, region: 0xab}, - 72: {lang: 0x20e, region: 0x95}, - 73: {lang: 0x200, region: 0xa2}, - 75: {lang: 0x135, region: 0xc4}, - 76: {lang: 0x200, region: 0xa2}, - 77: {lang: 0x3bb, region: 0xe8}, - 78: {lang: 0x24a, region: 0xa6}, - 79: {lang: 0x3fa, region: 0x99}, - 82: {lang: 0x251, region: 0x99}, - 83: {lang: 0x254, region: 0xab}, - 85: {lang: 0x88, region: 0x99}, - 86: {lang: 0x370, region: 0x123}, - 87: {lang: 0x2b8, region: 0xaf}, - 92: {lang: 0x29f, region: 0x99}, - 93: {lang: 0x2a8, region: 0x99}, - 94: {lang: 0x28f, region: 0x87}, - 95: {lang: 0x1a0, region: 0x87}, - 96: {lang: 0x2ac, region: 0x53}, - 98: {lang: 0x4f4, region: 0x12b}, - 99: {lang: 0x4f5, region: 0x12b}, - 100: {lang: 0x1be, region: 0x99}, - 102: {lang: 0x337, region: 0x9c}, - 103: {lang: 0x4f7, region: 0x53}, - 104: {lang: 0xa9, region: 0x53}, - 107: {lang: 0x2e8, region: 0x112}, - 108: {lang: 0x4f8, region: 0x10b}, - 109: {lang: 0x4f8, region: 0x10b}, - 110: {lang: 0x304, region: 0x99}, - 111: {lang: 0x31b, region: 0x99}, - 112: {lang: 0x30b, region: 0x53}, - 114: {lang: 0x31e, region: 0x35}, - 115: {lang: 0x30e, region: 0x99}, - 116: {lang: 0x414, region: 0xe8}, - 117: {lang: 0x331, region: 0xc4}, - 119: {lang: 0x4f9, region: 0x108}, - 120: {lang: 0x3b, region: 0xa1}, - 121: {lang: 0x353, region: 0xdb}, - 124: {lang: 0x2d0, region: 0x84}, - 125: {lang: 0x52a, region: 0x53}, - 126: {lang: 0x403, region: 0x96}, - 127: {lang: 0x3ee, region: 0x99}, - 128: {lang: 0x39b, region: 0xc5}, - 129: {lang: 0x395, region: 0x99}, - 130: {lang: 0x399, region: 0x135}, - 131: {lang: 0x429, region: 0x115}, - 133: {lang: 0x3b, region: 0x11c}, - 134: {lang: 0xfd, region: 0xc4}, - 137: {lang: 0x27d, region: 0x106}, - 138: {lang: 0x2c9, region: 0x53}, - 139: {lang: 0x39f, region: 0x9c}, - 140: {lang: 0x39f, region: 0x53}, - 142: {lang: 0x3ad, region: 0xb0}, - 144: {lang: 0x1c6, region: 0x53}, - 145: {lang: 0x4fd, region: 0x9c}, - 198: {lang: 0x3cb, region: 0x95}, - 201: {lang: 0x372, region: 0x10c}, - 202: {lang: 0x420, region: 0x97}, - 204: {lang: 0x4ff, region: 0x15e}, - 205: {lang: 0x3f0, region: 0x99}, - 206: {lang: 0x45, region: 0x135}, - 207: {lang: 0x139, region: 0x7b}, - 208: {lang: 0x3e9, region: 0x99}, - 210: {lang: 0x3e9, region: 0x99}, - 211: {lang: 0x3fa, region: 0x99}, - 212: {lang: 0x40c, region: 0xb3}, - 215: {lang: 0x433, region: 0x99}, - 216: {lang: 0xef, region: 0xc5}, - 217: {lang: 0x43e, region: 0x95}, - 218: {lang: 0x44d, region: 0x35}, - 219: {lang: 0x44e, region: 0x9b}, - 223: {lang: 0x45a, region: 0xe7}, - 224: {lang: 0x11a, region: 0x99}, - 225: {lang: 0x45e, region: 0x53}, - 226: {lang: 0x232, region: 0x53}, - 227: {lang: 0x450, region: 0x99}, - 228: {lang: 0x4a5, region: 0x53}, - 229: {lang: 0x9f, region: 0x13e}, - 230: {lang: 0x461, region: 0x99}, - 232: {lang: 0x528, region: 0xba}, - 233: {lang: 0x153, region: 0xe7}, - 234: {lang: 0x128, region: 0xcd}, - 235: {lang: 0x46b, region: 0x123}, - 236: {lang: 0xa9, region: 0x53}, - 237: {lang: 0x2ce, region: 0x99}, - 240: {lang: 0x4ad, region: 0x11c}, - 241: {lang: 0x4be, region: 0xb4}, - 244: {lang: 0x1ce, region: 0x99}, - 247: {lang: 0x3a9, region: 0x9c}, - 248: {lang: 0x22, region: 0x9b}, - 250: {lang: 0x1ea, region: 0x53}, - 251: {lang: 0xef, region: 0xc5}, + 60: {lang: 0x529, region: 0x12f}, + 61: {lang: 0x2fd, region: 0x9c}, + 62: {lang: 0x1bc, region: 0x98}, + 63: {lang: 0x200, region: 0xa3}, + 64: {lang: 0x1c5, region: 0x12c}, + 65: {lang: 0x1ca, region: 0xb0}, + 68: {lang: 0x1d5, region: 0x93}, + 70: {lang: 0x142, region: 0x9f}, + 71: {lang: 0x254, region: 0xac}, + 72: {lang: 0x20e, region: 0x96}, + 73: {lang: 0x200, region: 0xa3}, + 75: {lang: 0x135, region: 0xc5}, + 76: {lang: 0x200, region: 0xa3}, + 78: {lang: 0x3bb, region: 0xe9}, + 79: {lang: 0x24a, region: 0xa7}, + 80: {lang: 0x3fa, region: 0x9a}, + 83: {lang: 0x251, region: 0x9a}, + 84: {lang: 0x254, region: 0xac}, + 86: {lang: 0x88, region: 0x9a}, + 87: {lang: 0x370, region: 0x124}, + 88: {lang: 0x2b8, region: 0xb0}, + 93: {lang: 0x29f, region: 0x9a}, + 94: {lang: 0x2a8, region: 0x9a}, + 95: {lang: 0x28f, region: 0x88}, + 96: {lang: 0x1a0, region: 0x88}, + 97: {lang: 0x2ac, region: 0x53}, + 99: {lang: 0x4f4, region: 0x12c}, + 100: {lang: 0x4f5, region: 0x12c}, + 101: {lang: 0x1be, region: 0x9a}, + 103: {lang: 0x337, region: 0x9d}, + 104: {lang: 0x4f7, region: 0x53}, + 105: {lang: 0xa9, region: 0x53}, + 108: {lang: 0x2e8, region: 0x113}, + 109: {lang: 0x4f8, region: 0x10c}, + 110: {lang: 0x4f8, region: 0x10c}, + 111: {lang: 0x304, region: 0x9a}, + 112: {lang: 0x31b, region: 0x9a}, + 113: {lang: 0x30b, region: 0x53}, + 115: {lang: 0x31e, region: 0x35}, + 116: {lang: 0x30e, region: 0x9a}, + 117: {lang: 0x414, region: 0xe9}, + 118: {lang: 0x331, region: 0xc5}, + 121: {lang: 0x4f9, region: 0x109}, + 122: {lang: 0x3b, region: 0xa2}, + 123: {lang: 0x353, region: 0xdc}, + 126: {lang: 0x2d0, region: 0x85}, + 127: {lang: 0x52a, region: 0x53}, + 128: {lang: 0x403, region: 0x97}, + 129: {lang: 0x3ee, region: 0x9a}, + 130: {lang: 0x39b, region: 0xc6}, + 131: {lang: 0x395, region: 0x9a}, + 132: {lang: 0x399, region: 0x136}, + 133: {lang: 0x429, region: 0x116}, + 135: {lang: 0x3b, region: 0x11d}, + 136: {lang: 0xfd, region: 0xc5}, + 139: {lang: 0x27d, region: 0x107}, + 140: {lang: 0x2c9, region: 0x53}, + 141: {lang: 0x39f, region: 0x9d}, + 142: {lang: 0x39f, region: 0x53}, + 144: {lang: 0x3ad, region: 0xb1}, + 146: {lang: 0x1c6, region: 0x53}, + 147: {lang: 0x4fd, region: 0x9d}, + 200: {lang: 0x3cb, region: 0x96}, + 203: {lang: 0x372, region: 0x10d}, + 204: {lang: 0x420, region: 0x98}, + 206: {lang: 0x4ff, region: 0x15f}, + 207: {lang: 0x3f0, region: 0x9a}, + 208: {lang: 0x45, region: 0x136}, + 209: {lang: 0x139, region: 0x7c}, + 210: {lang: 0x3e9, region: 0x9a}, + 212: {lang: 0x3e9, region: 0x9a}, + 213: {lang: 0x3fa, region: 0x9a}, + 214: {lang: 0x40c, region: 0xb4}, + 217: {lang: 0x433, region: 0x9a}, + 218: {lang: 0xef, region: 0xc6}, + 219: {lang: 0x43e, region: 0x96}, + 221: {lang: 0x44d, region: 0x35}, + 222: {lang: 0x44e, region: 0x9c}, + 226: {lang: 0x45a, region: 0xe8}, + 227: {lang: 0x11a, region: 0x9a}, + 228: {lang: 0x45e, region: 0x53}, + 229: {lang: 0x232, region: 0x53}, + 230: {lang: 0x450, region: 0x9a}, + 231: {lang: 0x4a5, region: 0x53}, + 232: {lang: 0x9f, region: 0x13f}, + 233: {lang: 0x461, region: 0x9a}, + 235: {lang: 0x528, region: 0xbb}, + 236: {lang: 0x153, region: 0xe8}, + 237: {lang: 0x128, region: 0xce}, + 238: {lang: 0x46b, region: 0x124}, + 239: {lang: 0xa9, region: 0x53}, + 240: {lang: 0x2ce, region: 0x9a}, + 243: {lang: 0x4ad, region: 0x11d}, + 244: {lang: 0x4be, region: 0xb5}, + 247: {lang: 0x1ce, region: 0x9a}, + 250: {lang: 0x3a9, region: 0x9d}, + 251: {lang: 0x22, region: 0x9c}, + 253: {lang: 0x1ea, region: 0x53}, + 254: {lang: 0xef, region: 0xc6}, } type likelyScriptRegion struct { @@ -1557,1423 +1579,1423 @@ type likelyScriptRegion struct { // of the list in likelyLangList. // Size: 7980 bytes, 1330 elements var likelyLang = [1330]likelyScriptRegion{ - 0: {region: 0x135, script: 0x5a, flags: 0x0}, - 1: {region: 0x6f, script: 0x5a, flags: 0x0}, - 2: {region: 0x165, script: 0x5a, flags: 0x0}, - 3: {region: 0x165, script: 0x5a, flags: 0x0}, - 4: {region: 0x165, script: 0x5a, flags: 0x0}, - 5: {region: 0x7d, script: 0x20, flags: 0x0}, - 6: {region: 0x165, script: 0x5a, flags: 0x0}, - 7: {region: 0x165, script: 0x20, flags: 0x0}, - 8: {region: 0x80, script: 0x5a, flags: 0x0}, - 9: {region: 0x165, script: 0x5a, flags: 0x0}, - 10: {region: 0x165, script: 0x5a, flags: 0x0}, - 11: {region: 0x165, script: 0x5a, flags: 0x0}, - 12: {region: 0x95, script: 0x5a, flags: 0x0}, - 13: {region: 0x131, script: 0x5a, flags: 0x0}, - 14: {region: 0x80, script: 0x5a, flags: 0x0}, - 15: {region: 0x165, script: 0x5a, flags: 0x0}, - 16: {region: 0x165, script: 0x5a, flags: 0x0}, - 17: {region: 0x106, script: 0x20, flags: 0x0}, - 18: {region: 0x165, script: 0x5a, flags: 0x0}, - 19: {region: 0x9c, script: 0x9, flags: 0x0}, - 20: {region: 0x128, script: 0x5, flags: 0x0}, - 21: {region: 0x165, script: 0x5a, flags: 0x0}, - 22: {region: 0x161, script: 0x5a, flags: 0x0}, - 23: {region: 0x165, script: 0x5a, flags: 0x0}, - 24: {region: 0x165, script: 0x5a, flags: 0x0}, - 25: {region: 0x165, script: 0x5a, flags: 0x0}, - 26: {region: 0x165, script: 0x5a, flags: 0x0}, - 27: {region: 0x165, script: 0x5a, flags: 0x0}, - 28: {region: 0x52, script: 0x5a, flags: 0x0}, - 29: {region: 0x165, script: 0x5a, flags: 0x0}, - 30: {region: 0x165, script: 0x5a, flags: 0x0}, - 31: {region: 0x99, script: 0x4, flags: 0x0}, - 32: {region: 0x165, script: 0x5a, flags: 0x0}, - 33: {region: 0x80, script: 0x5a, flags: 0x0}, - 34: {region: 0x9b, script: 0xf8, flags: 0x0}, - 35: {region: 0x165, script: 0x5a, flags: 0x0}, - 36: {region: 0x165, script: 0x5a, flags: 0x0}, - 37: {region: 0x14d, script: 0x5a, flags: 0x0}, - 38: {region: 0x106, script: 0x20, flags: 0x0}, - 39: {region: 0x6f, script: 0x2c, flags: 0x0}, - 40: {region: 0x165, script: 0x5a, flags: 0x0}, - 41: {region: 0x165, script: 0x5a, flags: 0x0}, - 42: {region: 0xd6, script: 0x5a, flags: 0x0}, - 43: {region: 0x165, script: 0x5a, flags: 0x0}, - 45: {region: 0x165, script: 0x5a, flags: 0x0}, - 46: {region: 0x165, script: 0x5a, flags: 0x0}, - 47: {region: 0x165, script: 0x5a, flags: 0x0}, - 48: {region: 0x165, script: 0x5a, flags: 0x0}, - 49: {region: 0x165, script: 0x5a, flags: 0x0}, - 50: {region: 0x165, script: 0x5a, flags: 0x0}, - 51: {region: 0x95, script: 0x5a, flags: 0x0}, - 52: {region: 0x165, script: 0x5, flags: 0x0}, - 53: {region: 0x122, script: 0x5, flags: 0x0}, - 54: {region: 0x165, script: 0x5a, flags: 0x0}, - 55: {region: 0x165, script: 0x5a, flags: 0x0}, - 56: {region: 0x165, script: 0x5a, flags: 0x0}, - 57: {region: 0x165, script: 0x5a, flags: 0x0}, - 58: {region: 0x6b, script: 0x5, flags: 0x0}, + 0: {region: 0x136, script: 0x5b, flags: 0x0}, + 1: {region: 0x70, script: 0x5b, flags: 0x0}, + 2: {region: 0x166, script: 0x5b, flags: 0x0}, + 3: {region: 0x166, script: 0x5b, flags: 0x0}, + 4: {region: 0x166, script: 0x5b, flags: 0x0}, + 5: {region: 0x7e, script: 0x20, flags: 0x0}, + 6: {region: 0x166, script: 0x5b, flags: 0x0}, + 7: {region: 0x166, script: 0x20, flags: 0x0}, + 8: {region: 0x81, script: 0x5b, flags: 0x0}, + 9: {region: 0x166, script: 0x5b, flags: 0x0}, + 10: {region: 0x166, script: 0x5b, flags: 0x0}, + 11: {region: 0x166, script: 0x5b, flags: 0x0}, + 12: {region: 0x96, script: 0x5b, flags: 0x0}, + 13: {region: 0x132, script: 0x5b, flags: 0x0}, + 14: {region: 0x81, script: 0x5b, flags: 0x0}, + 15: {region: 0x166, script: 0x5b, flags: 0x0}, + 16: {region: 0x166, script: 0x5b, flags: 0x0}, + 17: {region: 0x107, script: 0x20, flags: 0x0}, + 18: {region: 0x166, script: 0x5b, flags: 0x0}, + 19: {region: 0x9d, script: 0x9, flags: 0x0}, + 20: {region: 0x129, script: 0x5, flags: 0x0}, + 21: {region: 0x166, script: 0x5b, flags: 0x0}, + 22: {region: 0x162, script: 0x5b, flags: 0x0}, + 23: {region: 0x166, script: 0x5b, flags: 0x0}, + 24: {region: 0x166, script: 0x5b, flags: 0x0}, + 25: {region: 0x166, script: 0x5b, flags: 0x0}, + 26: {region: 0x166, script: 0x5b, flags: 0x0}, + 27: {region: 0x166, script: 0x5b, flags: 0x0}, + 28: {region: 0x52, script: 0x5b, flags: 0x0}, + 29: {region: 0x166, script: 0x5b, flags: 0x0}, + 30: {region: 0x166, script: 0x5b, flags: 0x0}, + 31: {region: 0x9a, script: 0x4, flags: 0x0}, + 32: {region: 0x166, script: 0x5b, flags: 0x0}, + 33: {region: 0x81, script: 0x5b, flags: 0x0}, + 34: {region: 0x9c, script: 0xfb, flags: 0x0}, + 35: {region: 0x166, script: 0x5b, flags: 0x0}, + 36: {region: 0x166, script: 0x5b, flags: 0x0}, + 37: {region: 0x14e, script: 0x5b, flags: 0x0}, + 38: {region: 0x107, script: 0x20, flags: 0x0}, + 39: {region: 0x70, script: 0x2c, flags: 0x0}, + 40: {region: 0x166, script: 0x5b, flags: 0x0}, + 41: {region: 0x166, script: 0x5b, flags: 0x0}, + 42: {region: 0xd7, script: 0x5b, flags: 0x0}, + 43: {region: 0x166, script: 0x5b, flags: 0x0}, + 45: {region: 0x166, script: 0x5b, flags: 0x0}, + 46: {region: 0x166, script: 0x5b, flags: 0x0}, + 47: {region: 0x166, script: 0x5b, flags: 0x0}, + 48: {region: 0x166, script: 0x5b, flags: 0x0}, + 49: {region: 0x166, script: 0x5b, flags: 0x0}, + 50: {region: 0x166, script: 0x5b, flags: 0x0}, + 51: {region: 0x96, script: 0x5b, flags: 0x0}, + 52: {region: 0x166, script: 0x5, flags: 0x0}, + 53: {region: 0x123, script: 0x5, flags: 0x0}, + 54: {region: 0x166, script: 0x5b, flags: 0x0}, + 55: {region: 0x166, script: 0x5b, flags: 0x0}, + 56: {region: 0x166, script: 0x5b, flags: 0x0}, + 57: {region: 0x166, script: 0x5b, flags: 0x0}, + 58: {region: 0x6c, script: 0x5, flags: 0x0}, 59: {region: 0x0, script: 0x3, flags: 0x1}, - 60: {region: 0x165, script: 0x5a, flags: 0x0}, - 61: {region: 0x51, script: 0x5a, flags: 0x0}, - 62: {region: 0x3f, script: 0x5a, flags: 0x0}, - 63: {region: 0x67, script: 0x5, flags: 0x0}, - 65: {region: 0xba, script: 0x5, flags: 0x0}, - 66: {region: 0x6b, script: 0x5, flags: 0x0}, - 67: {region: 0x99, script: 0xe, flags: 0x0}, - 68: {region: 0x12f, script: 0x5a, flags: 0x0}, - 69: {region: 0x135, script: 0xce, flags: 0x0}, - 70: {region: 0x165, script: 0x5a, flags: 0x0}, - 71: {region: 0x165, script: 0x5a, flags: 0x0}, - 72: {region: 0x6e, script: 0x5a, flags: 0x0}, - 73: {region: 0x165, script: 0x5a, flags: 0x0}, - 74: {region: 0x165, script: 0x5a, flags: 0x0}, - 75: {region: 0x49, script: 0x5a, flags: 0x0}, - 76: {region: 0x165, script: 0x5a, flags: 0x0}, - 77: {region: 0x106, script: 0x20, flags: 0x0}, - 78: {region: 0x165, script: 0x5, flags: 0x0}, - 79: {region: 0x165, script: 0x5a, flags: 0x0}, - 80: {region: 0x165, script: 0x5a, flags: 0x0}, - 81: {region: 0x165, script: 0x5a, flags: 0x0}, - 82: {region: 0x99, script: 0x22, flags: 0x0}, - 83: {region: 0x165, script: 0x5a, flags: 0x0}, - 84: {region: 0x165, script: 0x5a, flags: 0x0}, - 85: {region: 0x165, script: 0x5a, flags: 0x0}, - 86: {region: 0x3f, script: 0x5a, flags: 0x0}, - 87: {region: 0x165, script: 0x5a, flags: 0x0}, + 60: {region: 0x166, script: 0x5b, flags: 0x0}, + 61: {region: 0x51, script: 0x5b, flags: 0x0}, + 62: {region: 0x3f, script: 0x5b, flags: 0x0}, + 63: {region: 0x68, script: 0x5, flags: 0x0}, + 65: {region: 0xbb, script: 0x5, flags: 0x0}, + 66: {region: 0x6c, script: 0x5, flags: 0x0}, + 67: {region: 0x9a, script: 0xe, flags: 0x0}, + 68: {region: 0x130, script: 0x5b, flags: 0x0}, + 69: {region: 0x136, script: 0xd0, flags: 0x0}, + 70: {region: 0x166, script: 0x5b, flags: 0x0}, + 71: {region: 0x166, script: 0x5b, flags: 0x0}, + 72: {region: 0x6f, script: 0x5b, flags: 0x0}, + 73: {region: 0x166, script: 0x5b, flags: 0x0}, + 74: {region: 0x166, script: 0x5b, flags: 0x0}, + 75: {region: 0x49, script: 0x5b, flags: 0x0}, + 76: {region: 0x166, script: 0x5b, flags: 0x0}, + 77: {region: 0x107, script: 0x20, flags: 0x0}, + 78: {region: 0x166, script: 0x5, flags: 0x0}, + 79: {region: 0x166, script: 0x5b, flags: 0x0}, + 80: {region: 0x166, script: 0x5b, flags: 0x0}, + 81: {region: 0x166, script: 0x5b, flags: 0x0}, + 82: {region: 0x9a, script: 0x22, flags: 0x0}, + 83: {region: 0x166, script: 0x5b, flags: 0x0}, + 84: {region: 0x166, script: 0x5b, flags: 0x0}, + 85: {region: 0x166, script: 0x5b, flags: 0x0}, + 86: {region: 0x3f, script: 0x5b, flags: 0x0}, + 87: {region: 0x166, script: 0x5b, flags: 0x0}, 88: {region: 0x3, script: 0x5, flags: 0x1}, - 89: {region: 0x106, script: 0x20, flags: 0x0}, - 90: {region: 0xe8, script: 0x5, flags: 0x0}, - 91: {region: 0x95, script: 0x5a, flags: 0x0}, - 92: {region: 0xdb, script: 0x22, flags: 0x0}, - 93: {region: 0x2e, script: 0x5a, flags: 0x0}, - 94: {region: 0x52, script: 0x5a, flags: 0x0}, - 95: {region: 0x165, script: 0x5a, flags: 0x0}, + 89: {region: 0x107, script: 0x20, flags: 0x0}, + 90: {region: 0xe9, script: 0x5, flags: 0x0}, + 91: {region: 0x96, script: 0x5b, flags: 0x0}, + 92: {region: 0xdc, script: 0x22, flags: 0x0}, + 93: {region: 0x2e, script: 0x5b, flags: 0x0}, + 94: {region: 0x52, script: 0x5b, flags: 0x0}, + 95: {region: 0x166, script: 0x5b, flags: 0x0}, 96: {region: 0x52, script: 0xb, flags: 0x0}, - 97: {region: 0x165, script: 0x5a, flags: 0x0}, - 98: {region: 0x165, script: 0x5a, flags: 0x0}, - 99: {region: 0x95, script: 0x5a, flags: 0x0}, - 100: {region: 0x165, script: 0x5a, flags: 0x0}, - 101: {region: 0x52, script: 0x5a, flags: 0x0}, - 102: {region: 0x165, script: 0x5a, flags: 0x0}, - 103: {region: 0x165, script: 0x5a, flags: 0x0}, - 104: {region: 0x165, script: 0x5a, flags: 0x0}, - 105: {region: 0x165, script: 0x5a, flags: 0x0}, - 106: {region: 0x4f, script: 0x5a, flags: 0x0}, - 107: {region: 0x165, script: 0x5a, flags: 0x0}, - 108: {region: 0x165, script: 0x5a, flags: 0x0}, - 109: {region: 0x165, script: 0x5a, flags: 0x0}, - 110: {region: 0x165, script: 0x2c, flags: 0x0}, - 111: {region: 0x165, script: 0x5a, flags: 0x0}, - 112: {region: 0x165, script: 0x5a, flags: 0x0}, + 97: {region: 0x166, script: 0x5b, flags: 0x0}, + 98: {region: 0x166, script: 0x5b, flags: 0x0}, + 99: {region: 0x96, script: 0x5b, flags: 0x0}, + 100: {region: 0x166, script: 0x5b, flags: 0x0}, + 101: {region: 0x52, script: 0x5b, flags: 0x0}, + 102: {region: 0x166, script: 0x5b, flags: 0x0}, + 103: {region: 0x166, script: 0x5b, flags: 0x0}, + 104: {region: 0x166, script: 0x5b, flags: 0x0}, + 105: {region: 0x166, script: 0x5b, flags: 0x0}, + 106: {region: 0x4f, script: 0x5b, flags: 0x0}, + 107: {region: 0x166, script: 0x5b, flags: 0x0}, + 108: {region: 0x166, script: 0x5b, flags: 0x0}, + 109: {region: 0x166, script: 0x5b, flags: 0x0}, + 110: {region: 0x166, script: 0x2c, flags: 0x0}, + 111: {region: 0x166, script: 0x5b, flags: 0x0}, + 112: {region: 0x166, script: 0x5b, flags: 0x0}, 113: {region: 0x47, script: 0x20, flags: 0x0}, - 114: {region: 0x165, script: 0x5a, flags: 0x0}, - 115: {region: 0x165, script: 0x5a, flags: 0x0}, - 116: {region: 0x10b, script: 0x5, flags: 0x0}, - 117: {region: 0x162, script: 0x5a, flags: 0x0}, - 118: {region: 0x165, script: 0x5a, flags: 0x0}, - 119: {region: 0x95, script: 0x5a, flags: 0x0}, - 120: {region: 0x165, script: 0x5a, flags: 0x0}, - 121: {region: 0x12f, script: 0x5a, flags: 0x0}, - 122: {region: 0x52, script: 0x5a, flags: 0x0}, - 123: {region: 0x99, script: 0xe3, flags: 0x0}, - 124: {region: 0xe8, script: 0x5, flags: 0x0}, - 125: {region: 0x99, script: 0x22, flags: 0x0}, + 114: {region: 0x166, script: 0x5b, flags: 0x0}, + 115: {region: 0x166, script: 0x5b, flags: 0x0}, + 116: {region: 0x10c, script: 0x5, flags: 0x0}, + 117: {region: 0x163, script: 0x5b, flags: 0x0}, + 118: {region: 0x166, script: 0x5b, flags: 0x0}, + 119: {region: 0x96, script: 0x5b, flags: 0x0}, + 120: {region: 0x166, script: 0x5b, flags: 0x0}, + 121: {region: 0x130, script: 0x5b, flags: 0x0}, + 122: {region: 0x52, script: 0x5b, flags: 0x0}, + 123: {region: 0x9a, script: 0xe6, flags: 0x0}, + 124: {region: 0xe9, script: 0x5, flags: 0x0}, + 125: {region: 0x9a, script: 0x22, flags: 0x0}, 126: {region: 0x38, script: 0x20, flags: 0x0}, - 127: {region: 0x99, script: 0x22, flags: 0x0}, - 128: {region: 0xe8, script: 0x5, flags: 0x0}, - 129: {region: 0x12b, script: 0x34, flags: 0x0}, - 131: {region: 0x99, script: 0x22, flags: 0x0}, - 132: {region: 0x165, script: 0x5a, flags: 0x0}, - 133: {region: 0x99, script: 0x22, flags: 0x0}, - 134: {region: 0xe7, script: 0x5a, flags: 0x0}, - 135: {region: 0x165, script: 0x5a, flags: 0x0}, - 136: {region: 0x99, script: 0x22, flags: 0x0}, - 137: {region: 0x165, script: 0x5a, flags: 0x0}, - 138: {region: 0x13f, script: 0x5a, flags: 0x0}, - 139: {region: 0x165, script: 0x5a, flags: 0x0}, - 140: {region: 0x165, script: 0x5a, flags: 0x0}, - 141: {region: 0xe7, script: 0x5a, flags: 0x0}, - 142: {region: 0x165, script: 0x5a, flags: 0x0}, - 143: {region: 0xd6, script: 0x5a, flags: 0x0}, - 144: {region: 0x165, script: 0x5a, flags: 0x0}, - 145: {region: 0x165, script: 0x5a, flags: 0x0}, - 146: {region: 0x165, script: 0x5a, flags: 0x0}, - 147: {region: 0x165, script: 0x2c, flags: 0x0}, - 148: {region: 0x99, script: 0x22, flags: 0x0}, - 149: {region: 0x95, script: 0x5a, flags: 0x0}, - 150: {region: 0x165, script: 0x5a, flags: 0x0}, - 151: {region: 0x165, script: 0x5a, flags: 0x0}, - 152: {region: 0x114, script: 0x5a, flags: 0x0}, - 153: {region: 0x165, script: 0x5a, flags: 0x0}, - 154: {region: 0x165, script: 0x5a, flags: 0x0}, - 155: {region: 0x52, script: 0x5a, flags: 0x0}, - 156: {region: 0x165, script: 0x5a, flags: 0x0}, - 157: {region: 0xe7, script: 0x5a, flags: 0x0}, - 158: {region: 0x165, script: 0x5a, flags: 0x0}, - 159: {region: 0x13e, script: 0xe5, flags: 0x0}, - 160: {region: 0xc3, script: 0x5a, flags: 0x0}, - 161: {region: 0x165, script: 0x5a, flags: 0x0}, - 162: {region: 0x165, script: 0x5a, flags: 0x0}, - 163: {region: 0xc3, script: 0x5a, flags: 0x0}, - 164: {region: 0x165, script: 0x5a, flags: 0x0}, + 127: {region: 0x9a, script: 0x22, flags: 0x0}, + 128: {region: 0xe9, script: 0x5, flags: 0x0}, + 129: {region: 0x12c, script: 0x34, flags: 0x0}, + 131: {region: 0x9a, script: 0x22, flags: 0x0}, + 132: {region: 0x166, script: 0x5b, flags: 0x0}, + 133: {region: 0x9a, script: 0x22, flags: 0x0}, + 134: {region: 0xe8, script: 0x5b, flags: 0x0}, + 135: {region: 0x166, script: 0x5b, flags: 0x0}, + 136: {region: 0x9a, script: 0x22, flags: 0x0}, + 137: {region: 0x166, script: 0x5b, flags: 0x0}, + 138: {region: 0x140, script: 0x5b, flags: 0x0}, + 139: {region: 0x166, script: 0x5b, flags: 0x0}, + 140: {region: 0x166, script: 0x5b, flags: 0x0}, + 141: {region: 0xe8, script: 0x5b, flags: 0x0}, + 142: {region: 0x166, script: 0x5b, flags: 0x0}, + 143: {region: 0xd7, script: 0x5b, flags: 0x0}, + 144: {region: 0x166, script: 0x5b, flags: 0x0}, + 145: {region: 0x166, script: 0x5b, flags: 0x0}, + 146: {region: 0x166, script: 0x5b, flags: 0x0}, + 147: {region: 0x166, script: 0x2c, flags: 0x0}, + 148: {region: 0x9a, script: 0x22, flags: 0x0}, + 149: {region: 0x96, script: 0x5b, flags: 0x0}, + 150: {region: 0x166, script: 0x5b, flags: 0x0}, + 151: {region: 0x166, script: 0x5b, flags: 0x0}, + 152: {region: 0x115, script: 0x5b, flags: 0x0}, + 153: {region: 0x166, script: 0x5b, flags: 0x0}, + 154: {region: 0x166, script: 0x5b, flags: 0x0}, + 155: {region: 0x52, script: 0x5b, flags: 0x0}, + 156: {region: 0x166, script: 0x5b, flags: 0x0}, + 157: {region: 0xe8, script: 0x5b, flags: 0x0}, + 158: {region: 0x166, script: 0x5b, flags: 0x0}, + 159: {region: 0x13f, script: 0xe8, flags: 0x0}, + 160: {region: 0xc4, script: 0x5b, flags: 0x0}, + 161: {region: 0x166, script: 0x5b, flags: 0x0}, + 162: {region: 0x166, script: 0x5b, flags: 0x0}, + 163: {region: 0xc4, script: 0x5b, flags: 0x0}, + 164: {region: 0x166, script: 0x5b, flags: 0x0}, 165: {region: 0x35, script: 0xe, flags: 0x0}, - 166: {region: 0x165, script: 0x5a, flags: 0x0}, - 167: {region: 0x165, script: 0x5a, flags: 0x0}, - 168: {region: 0x165, script: 0x5a, flags: 0x0}, - 169: {region: 0x53, script: 0xec, flags: 0x0}, - 170: {region: 0x165, script: 0x5a, flags: 0x0}, - 171: {region: 0x165, script: 0x5a, flags: 0x0}, - 172: {region: 0x165, script: 0x5a, flags: 0x0}, - 173: {region: 0x99, script: 0xe, flags: 0x0}, - 174: {region: 0x165, script: 0x5a, flags: 0x0}, - 175: {region: 0x9c, script: 0x5, flags: 0x0}, - 176: {region: 0x165, script: 0x5a, flags: 0x0}, - 177: {region: 0x4f, script: 0x5a, flags: 0x0}, - 178: {region: 0x78, script: 0x5a, flags: 0x0}, - 179: {region: 0x99, script: 0x22, flags: 0x0}, - 180: {region: 0xe8, script: 0x5, flags: 0x0}, - 181: {region: 0x99, script: 0x22, flags: 0x0}, - 182: {region: 0x165, script: 0x5a, flags: 0x0}, - 183: {region: 0x33, script: 0x5a, flags: 0x0}, - 184: {region: 0x165, script: 0x5a, flags: 0x0}, - 185: {region: 0xb4, script: 0xc, flags: 0x0}, - 186: {region: 0x52, script: 0x5a, flags: 0x0}, - 187: {region: 0x165, script: 0x2c, flags: 0x0}, - 188: {region: 0xe7, script: 0x5a, flags: 0x0}, - 189: {region: 0x165, script: 0x5a, flags: 0x0}, - 190: {region: 0xe8, script: 0x22, flags: 0x0}, - 191: {region: 0x106, script: 0x20, flags: 0x0}, - 192: {region: 0x15f, script: 0x5a, flags: 0x0}, - 193: {region: 0x165, script: 0x5a, flags: 0x0}, - 194: {region: 0x95, script: 0x5a, flags: 0x0}, - 195: {region: 0x165, script: 0x5a, flags: 0x0}, - 196: {region: 0x52, script: 0x5a, flags: 0x0}, - 197: {region: 0x165, script: 0x5a, flags: 0x0}, - 198: {region: 0x165, script: 0x5a, flags: 0x0}, - 199: {region: 0x165, script: 0x5a, flags: 0x0}, - 200: {region: 0x86, script: 0x5a, flags: 0x0}, - 201: {region: 0x165, script: 0x5a, flags: 0x0}, - 202: {region: 0x165, script: 0x5a, flags: 0x0}, - 203: {region: 0x165, script: 0x5a, flags: 0x0}, - 204: {region: 0x165, script: 0x5a, flags: 0x0}, - 205: {region: 0x6d, script: 0x2c, flags: 0x0}, - 206: {region: 0x165, script: 0x5a, flags: 0x0}, - 207: {region: 0x165, script: 0x5a, flags: 0x0}, - 208: {region: 0x52, script: 0x5a, flags: 0x0}, - 209: {region: 0x165, script: 0x5a, flags: 0x0}, - 210: {region: 0x165, script: 0x5a, flags: 0x0}, - 211: {region: 0xc3, script: 0x5a, flags: 0x0}, - 212: {region: 0x165, script: 0x5a, flags: 0x0}, - 213: {region: 0x165, script: 0x5a, flags: 0x0}, - 214: {region: 0x165, script: 0x5a, flags: 0x0}, - 215: {region: 0x6e, script: 0x5a, flags: 0x0}, - 216: {region: 0x165, script: 0x5a, flags: 0x0}, - 217: {region: 0x165, script: 0x5a, flags: 0x0}, - 218: {region: 0xd6, script: 0x5a, flags: 0x0}, + 166: {region: 0x166, script: 0x5b, flags: 0x0}, + 167: {region: 0x166, script: 0x5b, flags: 0x0}, + 168: {region: 0x166, script: 0x5b, flags: 0x0}, + 169: {region: 0x53, script: 0xef, flags: 0x0}, + 170: {region: 0x166, script: 0x5b, flags: 0x0}, + 171: {region: 0x166, script: 0x5b, flags: 0x0}, + 172: {region: 0x166, script: 0x5b, flags: 0x0}, + 173: {region: 0x9a, script: 0xe, flags: 0x0}, + 174: {region: 0x166, script: 0x5b, flags: 0x0}, + 175: {region: 0x9d, script: 0x5, flags: 0x0}, + 176: {region: 0x166, script: 0x5b, flags: 0x0}, + 177: {region: 0x4f, script: 0x5b, flags: 0x0}, + 178: {region: 0x79, script: 0x5b, flags: 0x0}, + 179: {region: 0x9a, script: 0x22, flags: 0x0}, + 180: {region: 0xe9, script: 0x5, flags: 0x0}, + 181: {region: 0x9a, script: 0x22, flags: 0x0}, + 182: {region: 0x166, script: 0x5b, flags: 0x0}, + 183: {region: 0x33, script: 0x5b, flags: 0x0}, + 184: {region: 0x166, script: 0x5b, flags: 0x0}, + 185: {region: 0xb5, script: 0xc, flags: 0x0}, + 186: {region: 0x52, script: 0x5b, flags: 0x0}, + 187: {region: 0x166, script: 0x2c, flags: 0x0}, + 188: {region: 0xe8, script: 0x5b, flags: 0x0}, + 189: {region: 0x166, script: 0x5b, flags: 0x0}, + 190: {region: 0xe9, script: 0x22, flags: 0x0}, + 191: {region: 0x107, script: 0x20, flags: 0x0}, + 192: {region: 0x160, script: 0x5b, flags: 0x0}, + 193: {region: 0x166, script: 0x5b, flags: 0x0}, + 194: {region: 0x96, script: 0x5b, flags: 0x0}, + 195: {region: 0x166, script: 0x5b, flags: 0x0}, + 196: {region: 0x52, script: 0x5b, flags: 0x0}, + 197: {region: 0x166, script: 0x5b, flags: 0x0}, + 198: {region: 0x166, script: 0x5b, flags: 0x0}, + 199: {region: 0x166, script: 0x5b, flags: 0x0}, + 200: {region: 0x87, script: 0x5b, flags: 0x0}, + 201: {region: 0x166, script: 0x5b, flags: 0x0}, + 202: {region: 0x166, script: 0x5b, flags: 0x0}, + 203: {region: 0x166, script: 0x5b, flags: 0x0}, + 204: {region: 0x166, script: 0x5b, flags: 0x0}, + 205: {region: 0x6e, script: 0x2c, flags: 0x0}, + 206: {region: 0x166, script: 0x5b, flags: 0x0}, + 207: {region: 0x166, script: 0x5b, flags: 0x0}, + 208: {region: 0x52, script: 0x5b, flags: 0x0}, + 209: {region: 0x166, script: 0x5b, flags: 0x0}, + 210: {region: 0x166, script: 0x5b, flags: 0x0}, + 211: {region: 0xc4, script: 0x5b, flags: 0x0}, + 212: {region: 0x166, script: 0x5b, flags: 0x0}, + 213: {region: 0x166, script: 0x5b, flags: 0x0}, + 214: {region: 0x166, script: 0x5b, flags: 0x0}, + 215: {region: 0x6f, script: 0x5b, flags: 0x0}, + 216: {region: 0x166, script: 0x5b, flags: 0x0}, + 217: {region: 0x166, script: 0x5b, flags: 0x0}, + 218: {region: 0xd7, script: 0x5b, flags: 0x0}, 219: {region: 0x35, script: 0x16, flags: 0x0}, - 220: {region: 0x106, script: 0x20, flags: 0x0}, - 221: {region: 0xe7, script: 0x5a, flags: 0x0}, - 222: {region: 0x165, script: 0x5a, flags: 0x0}, - 223: {region: 0x131, script: 0x5a, flags: 0x0}, - 224: {region: 0x8a, script: 0x5a, flags: 0x0}, - 225: {region: 0x75, script: 0x5a, flags: 0x0}, - 226: {region: 0x106, script: 0x20, flags: 0x0}, - 227: {region: 0x135, script: 0x5a, flags: 0x0}, - 228: {region: 0x49, script: 0x5a, flags: 0x0}, - 229: {region: 0x135, script: 0x1a, flags: 0x0}, - 230: {region: 0xa6, script: 0x5, flags: 0x0}, - 231: {region: 0x13e, script: 0x19, flags: 0x0}, - 232: {region: 0x165, script: 0x5a, flags: 0x0}, - 233: {region: 0x9b, script: 0x5, flags: 0x0}, - 234: {region: 0x165, script: 0x5a, flags: 0x0}, - 235: {region: 0x165, script: 0x5a, flags: 0x0}, - 236: {region: 0x165, script: 0x5a, flags: 0x0}, - 237: {region: 0x165, script: 0x5a, flags: 0x0}, - 238: {region: 0x165, script: 0x5a, flags: 0x0}, - 239: {region: 0xc5, script: 0xd8, flags: 0x0}, - 240: {region: 0x78, script: 0x5a, flags: 0x0}, - 241: {region: 0x6b, script: 0x1d, flags: 0x0}, - 242: {region: 0xe7, script: 0x5a, flags: 0x0}, + 220: {region: 0x107, script: 0x20, flags: 0x0}, + 221: {region: 0xe8, script: 0x5b, flags: 0x0}, + 222: {region: 0x166, script: 0x5b, flags: 0x0}, + 223: {region: 0x132, script: 0x5b, flags: 0x0}, + 224: {region: 0x8b, script: 0x5b, flags: 0x0}, + 225: {region: 0x76, script: 0x5b, flags: 0x0}, + 226: {region: 0x107, script: 0x20, flags: 0x0}, + 227: {region: 0x136, script: 0x5b, flags: 0x0}, + 228: {region: 0x49, script: 0x5b, flags: 0x0}, + 229: {region: 0x136, script: 0x1a, flags: 0x0}, + 230: {region: 0xa7, script: 0x5, flags: 0x0}, + 231: {region: 0x13f, script: 0x19, flags: 0x0}, + 232: {region: 0x166, script: 0x5b, flags: 0x0}, + 233: {region: 0x9c, script: 0x5, flags: 0x0}, + 234: {region: 0x166, script: 0x5b, flags: 0x0}, + 235: {region: 0x166, script: 0x5b, flags: 0x0}, + 236: {region: 0x166, script: 0x5b, flags: 0x0}, + 237: {region: 0x166, script: 0x5b, flags: 0x0}, + 238: {region: 0x166, script: 0x5b, flags: 0x0}, + 239: {region: 0xc6, script: 0xda, flags: 0x0}, + 240: {region: 0x79, script: 0x5b, flags: 0x0}, + 241: {region: 0x6c, script: 0x1d, flags: 0x0}, + 242: {region: 0xe8, script: 0x5b, flags: 0x0}, 243: {region: 0x49, script: 0x17, flags: 0x0}, - 244: {region: 0x130, script: 0x20, flags: 0x0}, + 244: {region: 0x131, script: 0x20, flags: 0x0}, 245: {region: 0x49, script: 0x17, flags: 0x0}, 246: {region: 0x49, script: 0x17, flags: 0x0}, 247: {region: 0x49, script: 0x17, flags: 0x0}, 248: {region: 0x49, script: 0x17, flags: 0x0}, - 249: {region: 0x10a, script: 0x5a, flags: 0x0}, - 250: {region: 0x5e, script: 0x5a, flags: 0x0}, - 251: {region: 0xe9, script: 0x5a, flags: 0x0}, + 249: {region: 0x10b, script: 0x5b, flags: 0x0}, + 250: {region: 0x5f, script: 0x5b, flags: 0x0}, + 251: {region: 0xea, script: 0x5b, flags: 0x0}, 252: {region: 0x49, script: 0x17, flags: 0x0}, - 253: {region: 0xc4, script: 0x86, flags: 0x0}, + 253: {region: 0xc5, script: 0x88, flags: 0x0}, 254: {region: 0x8, script: 0x2, flags: 0x1}, - 255: {region: 0x106, script: 0x20, flags: 0x0}, - 256: {region: 0x7b, script: 0x5a, flags: 0x0}, - 257: {region: 0x63, script: 0x5a, flags: 0x0}, - 258: {region: 0x165, script: 0x5a, flags: 0x0}, - 259: {region: 0x165, script: 0x5a, flags: 0x0}, - 260: {region: 0x165, script: 0x5a, flags: 0x0}, - 261: {region: 0x165, script: 0x5a, flags: 0x0}, - 262: {region: 0x135, script: 0x5a, flags: 0x0}, - 263: {region: 0x106, script: 0x20, flags: 0x0}, - 264: {region: 0xa4, script: 0x5a, flags: 0x0}, - 265: {region: 0x165, script: 0x5a, flags: 0x0}, - 266: {region: 0x165, script: 0x5a, flags: 0x0}, - 267: {region: 0x99, script: 0x5, flags: 0x0}, - 268: {region: 0x165, script: 0x5a, flags: 0x0}, - 269: {region: 0x60, script: 0x5a, flags: 0x0}, - 270: {region: 0x165, script: 0x5a, flags: 0x0}, - 271: {region: 0x49, script: 0x5a, flags: 0x0}, - 272: {region: 0x165, script: 0x5a, flags: 0x0}, - 273: {region: 0x165, script: 0x5a, flags: 0x0}, - 274: {region: 0x165, script: 0x5a, flags: 0x0}, - 275: {region: 0x165, script: 0x5, flags: 0x0}, - 276: {region: 0x49, script: 0x5a, flags: 0x0}, - 277: {region: 0x165, script: 0x5a, flags: 0x0}, - 278: {region: 0x165, script: 0x5a, flags: 0x0}, - 279: {region: 0xd4, script: 0x5a, flags: 0x0}, - 280: {region: 0x4f, script: 0x5a, flags: 0x0}, - 281: {region: 0x165, script: 0x5a, flags: 0x0}, - 282: {region: 0x99, script: 0x5, flags: 0x0}, - 283: {region: 0x165, script: 0x5a, flags: 0x0}, - 284: {region: 0x165, script: 0x5a, flags: 0x0}, - 285: {region: 0x165, script: 0x5a, flags: 0x0}, - 286: {region: 0x165, script: 0x2c, flags: 0x0}, - 287: {region: 0x60, script: 0x5a, flags: 0x0}, - 288: {region: 0xc3, script: 0x5a, flags: 0x0}, - 289: {region: 0xd0, script: 0x5a, flags: 0x0}, - 290: {region: 0x165, script: 0x5a, flags: 0x0}, - 291: {region: 0xdb, script: 0x22, flags: 0x0}, - 292: {region: 0x52, script: 0x5a, flags: 0x0}, - 293: {region: 0x165, script: 0x5a, flags: 0x0}, - 294: {region: 0x165, script: 0x5a, flags: 0x0}, - 295: {region: 0x165, script: 0x5a, flags: 0x0}, - 296: {region: 0xcd, script: 0xea, flags: 0x0}, - 297: {region: 0x165, script: 0x5a, flags: 0x0}, - 298: {region: 0x165, script: 0x5a, flags: 0x0}, - 299: {region: 0x114, script: 0x5a, flags: 0x0}, - 300: {region: 0x37, script: 0x5a, flags: 0x0}, - 301: {region: 0x43, script: 0xec, flags: 0x0}, - 302: {region: 0x165, script: 0x5a, flags: 0x0}, - 303: {region: 0xa4, script: 0x5a, flags: 0x0}, - 304: {region: 0x80, script: 0x5a, flags: 0x0}, - 305: {region: 0xd6, script: 0x5a, flags: 0x0}, - 306: {region: 0x9e, script: 0x5a, flags: 0x0}, - 307: {region: 0x6b, script: 0x29, flags: 0x0}, - 308: {region: 0x165, script: 0x5a, flags: 0x0}, - 309: {region: 0xc4, script: 0x4b, flags: 0x0}, - 310: {region: 0x87, script: 0x34, flags: 0x0}, - 311: {region: 0x165, script: 0x5a, flags: 0x0}, - 312: {region: 0x165, script: 0x5a, flags: 0x0}, + 255: {region: 0x107, script: 0x20, flags: 0x0}, + 256: {region: 0x7c, script: 0x5b, flags: 0x0}, + 257: {region: 0x64, script: 0x5b, flags: 0x0}, + 258: {region: 0x166, script: 0x5b, flags: 0x0}, + 259: {region: 0x166, script: 0x5b, flags: 0x0}, + 260: {region: 0x166, script: 0x5b, flags: 0x0}, + 261: {region: 0x166, script: 0x5b, flags: 0x0}, + 262: {region: 0x136, script: 0x5b, flags: 0x0}, + 263: {region: 0x107, script: 0x20, flags: 0x0}, + 264: {region: 0xa5, script: 0x5b, flags: 0x0}, + 265: {region: 0x166, script: 0x5b, flags: 0x0}, + 266: {region: 0x166, script: 0x5b, flags: 0x0}, + 267: {region: 0x9a, script: 0x5, flags: 0x0}, + 268: {region: 0x166, script: 0x5b, flags: 0x0}, + 269: {region: 0x61, script: 0x5b, flags: 0x0}, + 270: {region: 0x166, script: 0x5b, flags: 0x0}, + 271: {region: 0x49, script: 0x5b, flags: 0x0}, + 272: {region: 0x166, script: 0x5b, flags: 0x0}, + 273: {region: 0x166, script: 0x5b, flags: 0x0}, + 274: {region: 0x166, script: 0x5b, flags: 0x0}, + 275: {region: 0x166, script: 0x5, flags: 0x0}, + 276: {region: 0x49, script: 0x5b, flags: 0x0}, + 277: {region: 0x166, script: 0x5b, flags: 0x0}, + 278: {region: 0x166, script: 0x5b, flags: 0x0}, + 279: {region: 0xd5, script: 0x5b, flags: 0x0}, + 280: {region: 0x4f, script: 0x5b, flags: 0x0}, + 281: {region: 0x166, script: 0x5b, flags: 0x0}, + 282: {region: 0x9a, script: 0x5, flags: 0x0}, + 283: {region: 0x166, script: 0x5b, flags: 0x0}, + 284: {region: 0x166, script: 0x5b, flags: 0x0}, + 285: {region: 0x166, script: 0x5b, flags: 0x0}, + 286: {region: 0x166, script: 0x2c, flags: 0x0}, + 287: {region: 0x61, script: 0x5b, flags: 0x0}, + 288: {region: 0xc4, script: 0x5b, flags: 0x0}, + 289: {region: 0xd1, script: 0x5b, flags: 0x0}, + 290: {region: 0x166, script: 0x5b, flags: 0x0}, + 291: {region: 0xdc, script: 0x22, flags: 0x0}, + 292: {region: 0x52, script: 0x5b, flags: 0x0}, + 293: {region: 0x166, script: 0x5b, flags: 0x0}, + 294: {region: 0x166, script: 0x5b, flags: 0x0}, + 295: {region: 0x166, script: 0x5b, flags: 0x0}, + 296: {region: 0xce, script: 0xed, flags: 0x0}, + 297: {region: 0x166, script: 0x5b, flags: 0x0}, + 298: {region: 0x166, script: 0x5b, flags: 0x0}, + 299: {region: 0x115, script: 0x5b, flags: 0x0}, + 300: {region: 0x37, script: 0x5b, flags: 0x0}, + 301: {region: 0x43, script: 0xef, flags: 0x0}, + 302: {region: 0x166, script: 0x5b, flags: 0x0}, + 303: {region: 0xa5, script: 0x5b, flags: 0x0}, + 304: {region: 0x81, script: 0x5b, flags: 0x0}, + 305: {region: 0xd7, script: 0x5b, flags: 0x0}, + 306: {region: 0x9f, script: 0x5b, flags: 0x0}, + 307: {region: 0x6c, script: 0x29, flags: 0x0}, + 308: {region: 0x166, script: 0x5b, flags: 0x0}, + 309: {region: 0xc5, script: 0x4b, flags: 0x0}, + 310: {region: 0x88, script: 0x34, flags: 0x0}, + 311: {region: 0x166, script: 0x5b, flags: 0x0}, + 312: {region: 0x166, script: 0x5b, flags: 0x0}, 313: {region: 0xa, script: 0x2, flags: 0x1}, - 314: {region: 0x165, script: 0x5a, flags: 0x0}, - 315: {region: 0x165, script: 0x5a, flags: 0x0}, - 316: {region: 0x1, script: 0x5a, flags: 0x0}, - 317: {region: 0x165, script: 0x5a, flags: 0x0}, - 318: {region: 0x6e, script: 0x5a, flags: 0x0}, - 319: {region: 0x135, script: 0x5a, flags: 0x0}, - 320: {region: 0x6a, script: 0x5a, flags: 0x0}, - 321: {region: 0x165, script: 0x5a, flags: 0x0}, - 322: {region: 0x9e, script: 0x46, flags: 0x0}, - 323: {region: 0x165, script: 0x5a, flags: 0x0}, - 324: {region: 0x165, script: 0x5a, flags: 0x0}, - 325: {region: 0x6e, script: 0x5a, flags: 0x0}, - 326: {region: 0x52, script: 0x5a, flags: 0x0}, - 327: {region: 0x6e, script: 0x5a, flags: 0x0}, - 328: {region: 0x9c, script: 0x5, flags: 0x0}, - 329: {region: 0x165, script: 0x5a, flags: 0x0}, - 330: {region: 0x165, script: 0x5a, flags: 0x0}, - 331: {region: 0x165, script: 0x5a, flags: 0x0}, - 332: {region: 0x165, script: 0x5a, flags: 0x0}, - 333: {region: 0x86, script: 0x5a, flags: 0x0}, + 314: {region: 0x166, script: 0x5b, flags: 0x0}, + 315: {region: 0x166, script: 0x5b, flags: 0x0}, + 316: {region: 0x1, script: 0x5b, flags: 0x0}, + 317: {region: 0x166, script: 0x5b, flags: 0x0}, + 318: {region: 0x6f, script: 0x5b, flags: 0x0}, + 319: {region: 0x136, script: 0x5b, flags: 0x0}, + 320: {region: 0x6b, script: 0x5b, flags: 0x0}, + 321: {region: 0x166, script: 0x5b, flags: 0x0}, + 322: {region: 0x9f, script: 0x46, flags: 0x0}, + 323: {region: 0x166, script: 0x5b, flags: 0x0}, + 324: {region: 0x166, script: 0x5b, flags: 0x0}, + 325: {region: 0x6f, script: 0x5b, flags: 0x0}, + 326: {region: 0x52, script: 0x5b, flags: 0x0}, + 327: {region: 0x6f, script: 0x5b, flags: 0x0}, + 328: {region: 0x9d, script: 0x5, flags: 0x0}, + 329: {region: 0x166, script: 0x5b, flags: 0x0}, + 330: {region: 0x166, script: 0x5b, flags: 0x0}, + 331: {region: 0x166, script: 0x5b, flags: 0x0}, + 332: {region: 0x166, script: 0x5b, flags: 0x0}, + 333: {region: 0x87, script: 0x5b, flags: 0x0}, 334: {region: 0xc, script: 0x2, flags: 0x1}, - 335: {region: 0x165, script: 0x5a, flags: 0x0}, - 336: {region: 0xc3, script: 0x5a, flags: 0x0}, - 337: {region: 0x72, script: 0x5a, flags: 0x0}, - 338: {region: 0x10b, script: 0x5, flags: 0x0}, - 339: {region: 0xe7, script: 0x5a, flags: 0x0}, - 340: {region: 0x10c, script: 0x5a, flags: 0x0}, - 341: {region: 0x73, script: 0x5a, flags: 0x0}, - 342: {region: 0x165, script: 0x5a, flags: 0x0}, - 343: {region: 0x165, script: 0x5a, flags: 0x0}, - 344: {region: 0x76, script: 0x5a, flags: 0x0}, - 345: {region: 0x165, script: 0x5a, flags: 0x0}, - 346: {region: 0x3b, script: 0x5a, flags: 0x0}, - 347: {region: 0x165, script: 0x5a, flags: 0x0}, - 348: {region: 0x165, script: 0x5a, flags: 0x0}, - 349: {region: 0x165, script: 0x5a, flags: 0x0}, - 350: {region: 0x78, script: 0x5a, flags: 0x0}, - 351: {region: 0x135, script: 0x5a, flags: 0x0}, - 352: {region: 0x78, script: 0x5a, flags: 0x0}, - 353: {region: 0x60, script: 0x5a, flags: 0x0}, - 354: {region: 0x60, script: 0x5a, flags: 0x0}, + 335: {region: 0x166, script: 0x5b, flags: 0x0}, + 336: {region: 0xc4, script: 0x5b, flags: 0x0}, + 337: {region: 0x73, script: 0x5b, flags: 0x0}, + 338: {region: 0x10c, script: 0x5, flags: 0x0}, + 339: {region: 0xe8, script: 0x5b, flags: 0x0}, + 340: {region: 0x10d, script: 0x5b, flags: 0x0}, + 341: {region: 0x74, script: 0x5b, flags: 0x0}, + 342: {region: 0x166, script: 0x5b, flags: 0x0}, + 343: {region: 0x166, script: 0x5b, flags: 0x0}, + 344: {region: 0x77, script: 0x5b, flags: 0x0}, + 345: {region: 0x166, script: 0x5b, flags: 0x0}, + 346: {region: 0x3b, script: 0x5b, flags: 0x0}, + 347: {region: 0x166, script: 0x5b, flags: 0x0}, + 348: {region: 0x166, script: 0x5b, flags: 0x0}, + 349: {region: 0x166, script: 0x5b, flags: 0x0}, + 350: {region: 0x79, script: 0x5b, flags: 0x0}, + 351: {region: 0x136, script: 0x5b, flags: 0x0}, + 352: {region: 0x79, script: 0x5b, flags: 0x0}, + 353: {region: 0x61, script: 0x5b, flags: 0x0}, + 354: {region: 0x61, script: 0x5b, flags: 0x0}, 355: {region: 0x52, script: 0x5, flags: 0x0}, - 356: {region: 0x140, script: 0x5a, flags: 0x0}, - 357: {region: 0x165, script: 0x5a, flags: 0x0}, - 358: {region: 0x84, script: 0x5a, flags: 0x0}, - 359: {region: 0x165, script: 0x5a, flags: 0x0}, - 360: {region: 0xd4, script: 0x5a, flags: 0x0}, - 361: {region: 0x9e, script: 0x5a, flags: 0x0}, - 362: {region: 0xd6, script: 0x5a, flags: 0x0}, - 363: {region: 0x165, script: 0x5a, flags: 0x0}, - 364: {region: 0x10b, script: 0x5a, flags: 0x0}, - 365: {region: 0xd9, script: 0x5a, flags: 0x0}, - 366: {region: 0x96, script: 0x5a, flags: 0x0}, - 367: {region: 0x80, script: 0x5a, flags: 0x0}, - 368: {region: 0x165, script: 0x5a, flags: 0x0}, - 369: {region: 0xbc, script: 0x5a, flags: 0x0}, - 370: {region: 0x165, script: 0x5a, flags: 0x0}, - 371: {region: 0x165, script: 0x5a, flags: 0x0}, - 372: {region: 0x165, script: 0x5a, flags: 0x0}, + 356: {region: 0x141, script: 0x5b, flags: 0x0}, + 357: {region: 0x166, script: 0x5b, flags: 0x0}, + 358: {region: 0x85, script: 0x5b, flags: 0x0}, + 359: {region: 0x166, script: 0x5b, flags: 0x0}, + 360: {region: 0xd5, script: 0x5b, flags: 0x0}, + 361: {region: 0x9f, script: 0x5b, flags: 0x0}, + 362: {region: 0xd7, script: 0x5b, flags: 0x0}, + 363: {region: 0x166, script: 0x5b, flags: 0x0}, + 364: {region: 0x10c, script: 0x5b, flags: 0x0}, + 365: {region: 0xda, script: 0x5b, flags: 0x0}, + 366: {region: 0x97, script: 0x5b, flags: 0x0}, + 367: {region: 0x81, script: 0x5b, flags: 0x0}, + 368: {region: 0x166, script: 0x5b, flags: 0x0}, + 369: {region: 0xbd, script: 0x5b, flags: 0x0}, + 370: {region: 0x166, script: 0x5b, flags: 0x0}, + 371: {region: 0x166, script: 0x5b, flags: 0x0}, + 372: {region: 0x166, script: 0x5b, flags: 0x0}, 373: {region: 0x53, script: 0x3b, flags: 0x0}, - 374: {region: 0x165, script: 0x5a, flags: 0x0}, - 375: {region: 0x95, script: 0x5a, flags: 0x0}, - 376: {region: 0x165, script: 0x5a, flags: 0x0}, - 377: {region: 0x165, script: 0x5a, flags: 0x0}, - 378: {region: 0x99, script: 0x22, flags: 0x0}, - 379: {region: 0x165, script: 0x5a, flags: 0x0}, - 380: {region: 0x9c, script: 0x5, flags: 0x0}, - 381: {region: 0x7e, script: 0x5a, flags: 0x0}, - 382: {region: 0x7b, script: 0x5a, flags: 0x0}, - 383: {region: 0x165, script: 0x5a, flags: 0x0}, - 384: {region: 0x165, script: 0x5a, flags: 0x0}, - 385: {region: 0x165, script: 0x5a, flags: 0x0}, - 386: {region: 0x165, script: 0x5a, flags: 0x0}, - 387: {region: 0x165, script: 0x5a, flags: 0x0}, - 388: {region: 0x165, script: 0x5a, flags: 0x0}, - 389: {region: 0x6f, script: 0x2c, flags: 0x0}, - 390: {region: 0x165, script: 0x5a, flags: 0x0}, - 391: {region: 0xdb, script: 0x22, flags: 0x0}, - 392: {region: 0x165, script: 0x5a, flags: 0x0}, - 393: {region: 0xa7, script: 0x5a, flags: 0x0}, - 394: {region: 0x165, script: 0x5a, flags: 0x0}, - 395: {region: 0xe8, script: 0x5, flags: 0x0}, - 396: {region: 0x165, script: 0x5a, flags: 0x0}, - 397: {region: 0xe8, script: 0x5, flags: 0x0}, - 398: {region: 0x165, script: 0x5a, flags: 0x0}, - 399: {region: 0x165, script: 0x5a, flags: 0x0}, - 400: {region: 0x6e, script: 0x5a, flags: 0x0}, - 401: {region: 0x9c, script: 0x5, flags: 0x0}, - 402: {region: 0x165, script: 0x5a, flags: 0x0}, - 403: {region: 0x165, script: 0x2c, flags: 0x0}, - 404: {region: 0xf1, script: 0x5a, flags: 0x0}, - 405: {region: 0x165, script: 0x5a, flags: 0x0}, - 406: {region: 0x165, script: 0x5a, flags: 0x0}, - 407: {region: 0x165, script: 0x5a, flags: 0x0}, - 408: {region: 0x165, script: 0x2c, flags: 0x0}, - 409: {region: 0x165, script: 0x5a, flags: 0x0}, - 410: {region: 0x99, script: 0x22, flags: 0x0}, - 411: {region: 0x99, script: 0xe6, flags: 0x0}, - 412: {region: 0x95, script: 0x5a, flags: 0x0}, - 413: {region: 0xd9, script: 0x5a, flags: 0x0}, - 414: {region: 0x130, script: 0x32, flags: 0x0}, - 415: {region: 0x165, script: 0x5a, flags: 0x0}, + 374: {region: 0x166, script: 0x5b, flags: 0x0}, + 375: {region: 0x96, script: 0x5b, flags: 0x0}, + 376: {region: 0x166, script: 0x5b, flags: 0x0}, + 377: {region: 0x166, script: 0x5b, flags: 0x0}, + 378: {region: 0x9a, script: 0x22, flags: 0x0}, + 379: {region: 0x166, script: 0x5b, flags: 0x0}, + 380: {region: 0x9d, script: 0x5, flags: 0x0}, + 381: {region: 0x7f, script: 0x5b, flags: 0x0}, + 382: {region: 0x7c, script: 0x5b, flags: 0x0}, + 383: {region: 0x166, script: 0x5b, flags: 0x0}, + 384: {region: 0x166, script: 0x5b, flags: 0x0}, + 385: {region: 0x166, script: 0x5b, flags: 0x0}, + 386: {region: 0x166, script: 0x5b, flags: 0x0}, + 387: {region: 0x166, script: 0x5b, flags: 0x0}, + 388: {region: 0x166, script: 0x5b, flags: 0x0}, + 389: {region: 0x70, script: 0x2c, flags: 0x0}, + 390: {region: 0x166, script: 0x5b, flags: 0x0}, + 391: {region: 0xdc, script: 0x22, flags: 0x0}, + 392: {region: 0x166, script: 0x5b, flags: 0x0}, + 393: {region: 0xa8, script: 0x5b, flags: 0x0}, + 394: {region: 0x166, script: 0x5b, flags: 0x0}, + 395: {region: 0xe9, script: 0x5, flags: 0x0}, + 396: {region: 0x166, script: 0x5b, flags: 0x0}, + 397: {region: 0xe9, script: 0x5, flags: 0x0}, + 398: {region: 0x166, script: 0x5b, flags: 0x0}, + 399: {region: 0x166, script: 0x5b, flags: 0x0}, + 400: {region: 0x6f, script: 0x5b, flags: 0x0}, + 401: {region: 0x9d, script: 0x5, flags: 0x0}, + 402: {region: 0x166, script: 0x5b, flags: 0x0}, + 403: {region: 0x166, script: 0x2c, flags: 0x0}, + 404: {region: 0xf2, script: 0x5b, flags: 0x0}, + 405: {region: 0x166, script: 0x5b, flags: 0x0}, + 406: {region: 0x166, script: 0x5b, flags: 0x0}, + 407: {region: 0x166, script: 0x5b, flags: 0x0}, + 408: {region: 0x166, script: 0x2c, flags: 0x0}, + 409: {region: 0x166, script: 0x5b, flags: 0x0}, + 410: {region: 0x9a, script: 0x22, flags: 0x0}, + 411: {region: 0x9a, script: 0xe9, flags: 0x0}, + 412: {region: 0x96, script: 0x5b, flags: 0x0}, + 413: {region: 0xda, script: 0x5b, flags: 0x0}, + 414: {region: 0x131, script: 0x32, flags: 0x0}, + 415: {region: 0x166, script: 0x5b, flags: 0x0}, 416: {region: 0xe, script: 0x2, flags: 0x1}, - 417: {region: 0x99, script: 0xe, flags: 0x0}, - 418: {region: 0x165, script: 0x5a, flags: 0x0}, - 419: {region: 0x4e, script: 0x5a, flags: 0x0}, - 420: {region: 0x99, script: 0x35, flags: 0x0}, - 421: {region: 0x41, script: 0x5a, flags: 0x0}, - 422: {region: 0x54, script: 0x5a, flags: 0x0}, - 423: {region: 0x165, script: 0x5a, flags: 0x0}, - 424: {region: 0x80, script: 0x5a, flags: 0x0}, - 425: {region: 0x165, script: 0x5a, flags: 0x0}, - 426: {region: 0x165, script: 0x5a, flags: 0x0}, - 427: {region: 0xa4, script: 0x5a, flags: 0x0}, - 428: {region: 0x98, script: 0x5a, flags: 0x0}, - 429: {region: 0x165, script: 0x5a, flags: 0x0}, - 430: {region: 0xdb, script: 0x22, flags: 0x0}, - 431: {region: 0x165, script: 0x5a, flags: 0x0}, - 432: {region: 0x165, script: 0x5, flags: 0x0}, - 433: {region: 0x49, script: 0x5a, flags: 0x0}, - 434: {region: 0x165, script: 0x5, flags: 0x0}, - 435: {region: 0x165, script: 0x5a, flags: 0x0}, + 417: {region: 0x9a, script: 0xe, flags: 0x0}, + 418: {region: 0x166, script: 0x5b, flags: 0x0}, + 419: {region: 0x4e, script: 0x5b, flags: 0x0}, + 420: {region: 0x9a, script: 0x35, flags: 0x0}, + 421: {region: 0x41, script: 0x5b, flags: 0x0}, + 422: {region: 0x54, script: 0x5b, flags: 0x0}, + 423: {region: 0x166, script: 0x5b, flags: 0x0}, + 424: {region: 0x81, script: 0x5b, flags: 0x0}, + 425: {region: 0x166, script: 0x5b, flags: 0x0}, + 426: {region: 0x166, script: 0x5b, flags: 0x0}, + 427: {region: 0xa5, script: 0x5b, flags: 0x0}, + 428: {region: 0x99, script: 0x5b, flags: 0x0}, + 429: {region: 0x166, script: 0x5b, flags: 0x0}, + 430: {region: 0xdc, script: 0x22, flags: 0x0}, + 431: {region: 0x166, script: 0x5b, flags: 0x0}, + 432: {region: 0x166, script: 0x5, flags: 0x0}, + 433: {region: 0x49, script: 0x5b, flags: 0x0}, + 434: {region: 0x166, script: 0x5, flags: 0x0}, + 435: {region: 0x166, script: 0x5b, flags: 0x0}, 436: {region: 0x10, script: 0x3, flags: 0x1}, - 437: {region: 0x165, script: 0x5a, flags: 0x0}, + 437: {region: 0x166, script: 0x5b, flags: 0x0}, 438: {region: 0x53, script: 0x3b, flags: 0x0}, - 439: {region: 0x165, script: 0x5a, flags: 0x0}, - 440: {region: 0x135, script: 0x5a, flags: 0x0}, + 439: {region: 0x166, script: 0x5b, flags: 0x0}, + 440: {region: 0x136, script: 0x5b, flags: 0x0}, 441: {region: 0x24, script: 0x5, flags: 0x0}, - 442: {region: 0x165, script: 0x5a, flags: 0x0}, - 443: {region: 0x165, script: 0x2c, flags: 0x0}, - 444: {region: 0x97, script: 0x3e, flags: 0x0}, - 445: {region: 0x165, script: 0x5a, flags: 0x0}, - 446: {region: 0x99, script: 0x22, flags: 0x0}, - 447: {region: 0x165, script: 0x5a, flags: 0x0}, - 448: {region: 0x73, script: 0x5a, flags: 0x0}, - 449: {region: 0x165, script: 0x5a, flags: 0x0}, - 450: {region: 0x165, script: 0x5a, flags: 0x0}, - 451: {region: 0xe7, script: 0x5a, flags: 0x0}, - 452: {region: 0x165, script: 0x5a, flags: 0x0}, - 453: {region: 0x12b, script: 0x40, flags: 0x0}, - 454: {region: 0x53, script: 0x90, flags: 0x0}, - 455: {region: 0x165, script: 0x5a, flags: 0x0}, - 456: {region: 0xe8, script: 0x5, flags: 0x0}, - 457: {region: 0x99, script: 0x22, flags: 0x0}, - 458: {region: 0xaf, script: 0x41, flags: 0x0}, - 459: {region: 0xe7, script: 0x5a, flags: 0x0}, - 460: {region: 0xe8, script: 0x5, flags: 0x0}, - 461: {region: 0xe6, script: 0x5a, flags: 0x0}, - 462: {region: 0x99, script: 0x22, flags: 0x0}, - 463: {region: 0x99, script: 0x22, flags: 0x0}, - 464: {region: 0x165, script: 0x5a, flags: 0x0}, - 465: {region: 0x90, script: 0x5a, flags: 0x0}, - 466: {region: 0x60, script: 0x5a, flags: 0x0}, + 442: {region: 0x166, script: 0x5b, flags: 0x0}, + 443: {region: 0x166, script: 0x2c, flags: 0x0}, + 444: {region: 0x98, script: 0x3e, flags: 0x0}, + 445: {region: 0x166, script: 0x5b, flags: 0x0}, + 446: {region: 0x9a, script: 0x22, flags: 0x0}, + 447: {region: 0x166, script: 0x5b, flags: 0x0}, + 448: {region: 0x74, script: 0x5b, flags: 0x0}, + 449: {region: 0x166, script: 0x5b, flags: 0x0}, + 450: {region: 0x166, script: 0x5b, flags: 0x0}, + 451: {region: 0xe8, script: 0x5b, flags: 0x0}, + 452: {region: 0x166, script: 0x5b, flags: 0x0}, + 453: {region: 0x12c, script: 0x40, flags: 0x0}, + 454: {region: 0x53, script: 0x92, flags: 0x0}, + 455: {region: 0x166, script: 0x5b, flags: 0x0}, + 456: {region: 0xe9, script: 0x5, flags: 0x0}, + 457: {region: 0x9a, script: 0x22, flags: 0x0}, + 458: {region: 0xb0, script: 0x41, flags: 0x0}, + 459: {region: 0xe8, script: 0x5b, flags: 0x0}, + 460: {region: 0xe9, script: 0x5, flags: 0x0}, + 461: {region: 0xe7, script: 0x5b, flags: 0x0}, + 462: {region: 0x9a, script: 0x22, flags: 0x0}, + 463: {region: 0x9a, script: 0x22, flags: 0x0}, + 464: {region: 0x166, script: 0x5b, flags: 0x0}, + 465: {region: 0x91, script: 0x5b, flags: 0x0}, + 466: {region: 0x61, script: 0x5b, flags: 0x0}, 467: {region: 0x53, script: 0x3b, flags: 0x0}, - 468: {region: 0x91, script: 0x5a, flags: 0x0}, - 469: {region: 0x92, script: 0x5a, flags: 0x0}, - 470: {region: 0x165, script: 0x5a, flags: 0x0}, + 468: {region: 0x92, script: 0x5b, flags: 0x0}, + 469: {region: 0x93, script: 0x5b, flags: 0x0}, + 470: {region: 0x166, script: 0x5b, flags: 0x0}, 471: {region: 0x28, script: 0x8, flags: 0x0}, - 472: {region: 0xd2, script: 0x5a, flags: 0x0}, - 473: {region: 0x78, script: 0x5a, flags: 0x0}, - 474: {region: 0x165, script: 0x5a, flags: 0x0}, - 475: {region: 0x165, script: 0x5a, flags: 0x0}, - 476: {region: 0xd0, script: 0x5a, flags: 0x0}, - 477: {region: 0xd6, script: 0x5a, flags: 0x0}, - 478: {region: 0x165, script: 0x5a, flags: 0x0}, - 479: {region: 0x165, script: 0x5a, flags: 0x0}, - 480: {region: 0x165, script: 0x5a, flags: 0x0}, - 481: {region: 0x95, script: 0x5a, flags: 0x0}, - 482: {region: 0x165, script: 0x5a, flags: 0x0}, - 483: {region: 0x165, script: 0x5a, flags: 0x0}, - 484: {region: 0x165, script: 0x5a, flags: 0x0}, - 486: {region: 0x122, script: 0x5a, flags: 0x0}, - 487: {region: 0xd6, script: 0x5a, flags: 0x0}, - 488: {region: 0x165, script: 0x5a, flags: 0x0}, - 489: {region: 0x165, script: 0x5a, flags: 0x0}, - 490: {region: 0x53, script: 0xfa, flags: 0x0}, - 491: {region: 0x165, script: 0x5a, flags: 0x0}, - 492: {region: 0x135, script: 0x5a, flags: 0x0}, - 493: {region: 0x165, script: 0x5a, flags: 0x0}, - 494: {region: 0x49, script: 0x5a, flags: 0x0}, - 495: {region: 0x165, script: 0x5a, flags: 0x0}, - 496: {region: 0x165, script: 0x5a, flags: 0x0}, - 497: {region: 0xe7, script: 0x5a, flags: 0x0}, - 498: {region: 0x165, script: 0x5a, flags: 0x0}, - 499: {region: 0x95, script: 0x5a, flags: 0x0}, - 500: {region: 0x106, script: 0x20, flags: 0x0}, - 501: {region: 0x1, script: 0x5a, flags: 0x0}, - 502: {region: 0x165, script: 0x5a, flags: 0x0}, - 503: {region: 0x165, script: 0x5a, flags: 0x0}, - 504: {region: 0x9d, script: 0x5a, flags: 0x0}, - 505: {region: 0x9e, script: 0x5a, flags: 0x0}, + 472: {region: 0xd3, script: 0x5b, flags: 0x0}, + 473: {region: 0x79, script: 0x5b, flags: 0x0}, + 474: {region: 0x166, script: 0x5b, flags: 0x0}, + 475: {region: 0x166, script: 0x5b, flags: 0x0}, + 476: {region: 0xd1, script: 0x5b, flags: 0x0}, + 477: {region: 0xd7, script: 0x5b, flags: 0x0}, + 478: {region: 0x166, script: 0x5b, flags: 0x0}, + 479: {region: 0x166, script: 0x5b, flags: 0x0}, + 480: {region: 0x166, script: 0x5b, flags: 0x0}, + 481: {region: 0x96, script: 0x5b, flags: 0x0}, + 482: {region: 0x166, script: 0x5b, flags: 0x0}, + 483: {region: 0x166, script: 0x5b, flags: 0x0}, + 484: {region: 0x166, script: 0x5b, flags: 0x0}, + 486: {region: 0x123, script: 0x5b, flags: 0x0}, + 487: {region: 0xd7, script: 0x5b, flags: 0x0}, + 488: {region: 0x166, script: 0x5b, flags: 0x0}, + 489: {region: 0x166, script: 0x5b, flags: 0x0}, + 490: {region: 0x53, script: 0xfd, flags: 0x0}, + 491: {region: 0x166, script: 0x5b, flags: 0x0}, + 492: {region: 0x136, script: 0x5b, flags: 0x0}, + 493: {region: 0x166, script: 0x5b, flags: 0x0}, + 494: {region: 0x49, script: 0x5b, flags: 0x0}, + 495: {region: 0x166, script: 0x5b, flags: 0x0}, + 496: {region: 0x166, script: 0x5b, flags: 0x0}, + 497: {region: 0xe8, script: 0x5b, flags: 0x0}, + 498: {region: 0x166, script: 0x5b, flags: 0x0}, + 499: {region: 0x96, script: 0x5b, flags: 0x0}, + 500: {region: 0x107, script: 0x20, flags: 0x0}, + 501: {region: 0x1, script: 0x5b, flags: 0x0}, + 502: {region: 0x166, script: 0x5b, flags: 0x0}, + 503: {region: 0x166, script: 0x5b, flags: 0x0}, + 504: {region: 0x9e, script: 0x5b, flags: 0x0}, + 505: {region: 0x9f, script: 0x5b, flags: 0x0}, 506: {region: 0x49, script: 0x17, flags: 0x0}, - 507: {region: 0x97, script: 0x3e, flags: 0x0}, - 508: {region: 0x165, script: 0x5a, flags: 0x0}, - 509: {region: 0x165, script: 0x5a, flags: 0x0}, - 510: {region: 0x106, script: 0x5a, flags: 0x0}, - 511: {region: 0x165, script: 0x5a, flags: 0x0}, - 512: {region: 0xa2, script: 0x49, flags: 0x0}, - 513: {region: 0x165, script: 0x5a, flags: 0x0}, - 514: {region: 0xa0, script: 0x5a, flags: 0x0}, - 515: {region: 0x1, script: 0x5a, flags: 0x0}, - 516: {region: 0x165, script: 0x5a, flags: 0x0}, - 517: {region: 0x165, script: 0x5a, flags: 0x0}, - 518: {region: 0x165, script: 0x5a, flags: 0x0}, - 519: {region: 0x52, script: 0x5a, flags: 0x0}, - 520: {region: 0x130, script: 0x3e, flags: 0x0}, - 521: {region: 0x165, script: 0x5a, flags: 0x0}, - 522: {region: 0x12f, script: 0x5a, flags: 0x0}, - 523: {region: 0xdb, script: 0x22, flags: 0x0}, - 524: {region: 0x165, script: 0x5a, flags: 0x0}, - 525: {region: 0x63, script: 0x5a, flags: 0x0}, - 526: {region: 0x95, script: 0x5a, flags: 0x0}, - 527: {region: 0x95, script: 0x5a, flags: 0x0}, - 528: {region: 0x7d, script: 0x2e, flags: 0x0}, - 529: {region: 0x137, script: 0x20, flags: 0x0}, - 530: {region: 0x67, script: 0x5a, flags: 0x0}, - 531: {region: 0xc4, script: 0x5a, flags: 0x0}, - 532: {region: 0x165, script: 0x5a, flags: 0x0}, - 533: {region: 0x165, script: 0x5a, flags: 0x0}, - 534: {region: 0xd6, script: 0x5a, flags: 0x0}, - 535: {region: 0xa4, script: 0x5a, flags: 0x0}, - 536: {region: 0xc3, script: 0x5a, flags: 0x0}, - 537: {region: 0x106, script: 0x20, flags: 0x0}, - 538: {region: 0x165, script: 0x5a, flags: 0x0}, - 539: {region: 0x165, script: 0x5a, flags: 0x0}, - 540: {region: 0x165, script: 0x5a, flags: 0x0}, - 541: {region: 0x165, script: 0x5a, flags: 0x0}, - 542: {region: 0xd4, script: 0x5, flags: 0x0}, - 543: {region: 0xd6, script: 0x5a, flags: 0x0}, - 544: {region: 0x164, script: 0x5a, flags: 0x0}, - 545: {region: 0x165, script: 0x5a, flags: 0x0}, - 546: {region: 0x165, script: 0x5a, flags: 0x0}, - 547: {region: 0x12f, script: 0x5a, flags: 0x0}, - 548: {region: 0x122, script: 0x5, flags: 0x0}, - 549: {region: 0x165, script: 0x5a, flags: 0x0}, - 550: {region: 0x123, script: 0xeb, flags: 0x0}, - 551: {region: 0x5a, script: 0x5a, flags: 0x0}, - 552: {region: 0x52, script: 0x5a, flags: 0x0}, - 553: {region: 0x165, script: 0x5a, flags: 0x0}, - 554: {region: 0x4f, script: 0x5a, flags: 0x0}, - 555: {region: 0x99, script: 0x22, flags: 0x0}, - 556: {region: 0x99, script: 0x22, flags: 0x0}, - 557: {region: 0x4b, script: 0x5a, flags: 0x0}, - 558: {region: 0x95, script: 0x5a, flags: 0x0}, - 559: {region: 0x165, script: 0x5a, flags: 0x0}, - 560: {region: 0x41, script: 0x5a, flags: 0x0}, - 561: {region: 0x99, script: 0x5a, flags: 0x0}, - 562: {region: 0x53, script: 0xe2, flags: 0x0}, - 563: {region: 0x99, script: 0x22, flags: 0x0}, - 564: {region: 0xc3, script: 0x5a, flags: 0x0}, - 565: {region: 0x165, script: 0x5a, flags: 0x0}, - 566: {region: 0x99, script: 0x75, flags: 0x0}, - 567: {region: 0xe8, script: 0x5, flags: 0x0}, - 568: {region: 0x165, script: 0x5a, flags: 0x0}, - 569: {region: 0xa4, script: 0x5a, flags: 0x0}, - 570: {region: 0x165, script: 0x5a, flags: 0x0}, - 571: {region: 0x12b, script: 0x5a, flags: 0x0}, - 572: {region: 0x165, script: 0x5a, flags: 0x0}, - 573: {region: 0xd2, script: 0x5a, flags: 0x0}, - 574: {region: 0x165, script: 0x5a, flags: 0x0}, - 575: {region: 0xaf, script: 0x57, flags: 0x0}, - 576: {region: 0x165, script: 0x5a, flags: 0x0}, - 577: {region: 0x165, script: 0x5a, flags: 0x0}, + 507: {region: 0x98, script: 0x3e, flags: 0x0}, + 508: {region: 0x166, script: 0x5b, flags: 0x0}, + 509: {region: 0x166, script: 0x5b, flags: 0x0}, + 510: {region: 0x107, script: 0x5b, flags: 0x0}, + 511: {region: 0x166, script: 0x5b, flags: 0x0}, + 512: {region: 0xa3, script: 0x49, flags: 0x0}, + 513: {region: 0x166, script: 0x5b, flags: 0x0}, + 514: {region: 0xa1, script: 0x5b, flags: 0x0}, + 515: {region: 0x1, script: 0x5b, flags: 0x0}, + 516: {region: 0x166, script: 0x5b, flags: 0x0}, + 517: {region: 0x166, script: 0x5b, flags: 0x0}, + 518: {region: 0x166, script: 0x5b, flags: 0x0}, + 519: {region: 0x52, script: 0x5b, flags: 0x0}, + 520: {region: 0x131, script: 0x3e, flags: 0x0}, + 521: {region: 0x166, script: 0x5b, flags: 0x0}, + 522: {region: 0x130, script: 0x5b, flags: 0x0}, + 523: {region: 0xdc, script: 0x22, flags: 0x0}, + 524: {region: 0x166, script: 0x5b, flags: 0x0}, + 525: {region: 0x64, script: 0x5b, flags: 0x0}, + 526: {region: 0x96, script: 0x5b, flags: 0x0}, + 527: {region: 0x96, script: 0x5b, flags: 0x0}, + 528: {region: 0x7e, script: 0x2e, flags: 0x0}, + 529: {region: 0x138, script: 0x20, flags: 0x0}, + 530: {region: 0x68, script: 0x5b, flags: 0x0}, + 531: {region: 0xc5, script: 0x5b, flags: 0x0}, + 532: {region: 0x166, script: 0x5b, flags: 0x0}, + 533: {region: 0x166, script: 0x5b, flags: 0x0}, + 534: {region: 0xd7, script: 0x5b, flags: 0x0}, + 535: {region: 0xa5, script: 0x5b, flags: 0x0}, + 536: {region: 0xc4, script: 0x5b, flags: 0x0}, + 537: {region: 0x107, script: 0x20, flags: 0x0}, + 538: {region: 0x166, script: 0x5b, flags: 0x0}, + 539: {region: 0x166, script: 0x5b, flags: 0x0}, + 540: {region: 0x166, script: 0x5b, flags: 0x0}, + 541: {region: 0x166, script: 0x5b, flags: 0x0}, + 542: {region: 0xd5, script: 0x5, flags: 0x0}, + 543: {region: 0xd7, script: 0x5b, flags: 0x0}, + 544: {region: 0x165, script: 0x5b, flags: 0x0}, + 545: {region: 0x166, script: 0x5b, flags: 0x0}, + 546: {region: 0x166, script: 0x5b, flags: 0x0}, + 547: {region: 0x130, script: 0x5b, flags: 0x0}, + 548: {region: 0x123, script: 0x5, flags: 0x0}, + 549: {region: 0x166, script: 0x5b, flags: 0x0}, + 550: {region: 0x124, script: 0xee, flags: 0x0}, + 551: {region: 0x5b, script: 0x5b, flags: 0x0}, + 552: {region: 0x52, script: 0x5b, flags: 0x0}, + 553: {region: 0x166, script: 0x5b, flags: 0x0}, + 554: {region: 0x4f, script: 0x5b, flags: 0x0}, + 555: {region: 0x9a, script: 0x22, flags: 0x0}, + 556: {region: 0x9a, script: 0x22, flags: 0x0}, + 557: {region: 0x4b, script: 0x5b, flags: 0x0}, + 558: {region: 0x96, script: 0x5b, flags: 0x0}, + 559: {region: 0x166, script: 0x5b, flags: 0x0}, + 560: {region: 0x41, script: 0x5b, flags: 0x0}, + 561: {region: 0x9a, script: 0x5b, flags: 0x0}, + 562: {region: 0x53, script: 0xe5, flags: 0x0}, + 563: {region: 0x9a, script: 0x22, flags: 0x0}, + 564: {region: 0xc4, script: 0x5b, flags: 0x0}, + 565: {region: 0x166, script: 0x5b, flags: 0x0}, + 566: {region: 0x9a, script: 0x76, flags: 0x0}, + 567: {region: 0xe9, script: 0x5, flags: 0x0}, + 568: {region: 0x166, script: 0x5b, flags: 0x0}, + 569: {region: 0xa5, script: 0x5b, flags: 0x0}, + 570: {region: 0x166, script: 0x5b, flags: 0x0}, + 571: {region: 0x12c, script: 0x5b, flags: 0x0}, + 572: {region: 0x166, script: 0x5b, flags: 0x0}, + 573: {region: 0xd3, script: 0x5b, flags: 0x0}, + 574: {region: 0x166, script: 0x5b, flags: 0x0}, + 575: {region: 0xb0, script: 0x58, flags: 0x0}, + 576: {region: 0x166, script: 0x5b, flags: 0x0}, + 577: {region: 0x166, script: 0x5b, flags: 0x0}, 578: {region: 0x13, script: 0x6, flags: 0x1}, - 579: {region: 0x165, script: 0x5a, flags: 0x0}, - 580: {region: 0x52, script: 0x5a, flags: 0x0}, - 581: {region: 0x82, script: 0x5a, flags: 0x0}, - 582: {region: 0xa4, script: 0x5a, flags: 0x0}, - 583: {region: 0x165, script: 0x5a, flags: 0x0}, - 584: {region: 0x165, script: 0x5a, flags: 0x0}, - 585: {region: 0x165, script: 0x5a, flags: 0x0}, - 586: {region: 0xa6, script: 0x4e, flags: 0x0}, - 587: {region: 0x2a, script: 0x5a, flags: 0x0}, - 588: {region: 0x165, script: 0x5a, flags: 0x0}, - 589: {region: 0x165, script: 0x5a, flags: 0x0}, - 590: {region: 0x165, script: 0x5a, flags: 0x0}, - 591: {region: 0x165, script: 0x5a, flags: 0x0}, - 592: {region: 0x165, script: 0x5a, flags: 0x0}, - 593: {region: 0x99, script: 0x52, flags: 0x0}, - 594: {region: 0x8b, script: 0x5a, flags: 0x0}, - 595: {region: 0x165, script: 0x5a, flags: 0x0}, - 596: {region: 0xab, script: 0x53, flags: 0x0}, - 597: {region: 0x106, script: 0x20, flags: 0x0}, - 598: {region: 0x99, script: 0x22, flags: 0x0}, - 599: {region: 0x165, script: 0x5a, flags: 0x0}, - 600: {region: 0x75, script: 0x5a, flags: 0x0}, - 601: {region: 0x165, script: 0x5a, flags: 0x0}, - 602: {region: 0xb4, script: 0x5a, flags: 0x0}, - 603: {region: 0x165, script: 0x5a, flags: 0x0}, - 604: {region: 0x165, script: 0x5a, flags: 0x0}, - 605: {region: 0x165, script: 0x5a, flags: 0x0}, - 606: {region: 0x165, script: 0x5a, flags: 0x0}, - 607: {region: 0x165, script: 0x5a, flags: 0x0}, - 608: {region: 0x165, script: 0x5a, flags: 0x0}, - 609: {region: 0x165, script: 0x5a, flags: 0x0}, - 610: {region: 0x165, script: 0x2c, flags: 0x0}, - 611: {region: 0x165, script: 0x5a, flags: 0x0}, - 612: {region: 0x106, script: 0x20, flags: 0x0}, - 613: {region: 0x112, script: 0x5a, flags: 0x0}, - 614: {region: 0xe7, script: 0x5a, flags: 0x0}, - 615: {region: 0x106, script: 0x5a, flags: 0x0}, - 616: {region: 0x165, script: 0x5a, flags: 0x0}, - 617: {region: 0x99, script: 0x22, flags: 0x0}, - 618: {region: 0x99, script: 0x5, flags: 0x0}, - 619: {region: 0x12f, script: 0x5a, flags: 0x0}, - 620: {region: 0x165, script: 0x5a, flags: 0x0}, - 621: {region: 0x52, script: 0x5a, flags: 0x0}, - 622: {region: 0x60, script: 0x5a, flags: 0x0}, - 623: {region: 0x165, script: 0x5a, flags: 0x0}, - 624: {region: 0x165, script: 0x5a, flags: 0x0}, - 625: {region: 0x165, script: 0x2c, flags: 0x0}, - 626: {region: 0x165, script: 0x5a, flags: 0x0}, - 627: {region: 0x165, script: 0x5a, flags: 0x0}, + 579: {region: 0x166, script: 0x5b, flags: 0x0}, + 580: {region: 0x52, script: 0x5b, flags: 0x0}, + 581: {region: 0x83, script: 0x5b, flags: 0x0}, + 582: {region: 0xa5, script: 0x5b, flags: 0x0}, + 583: {region: 0x166, script: 0x5b, flags: 0x0}, + 584: {region: 0x166, script: 0x5b, flags: 0x0}, + 585: {region: 0x166, script: 0x5b, flags: 0x0}, + 586: {region: 0xa7, script: 0x4f, flags: 0x0}, + 587: {region: 0x2a, script: 0x5b, flags: 0x0}, + 588: {region: 0x166, script: 0x5b, flags: 0x0}, + 589: {region: 0x166, script: 0x5b, flags: 0x0}, + 590: {region: 0x166, script: 0x5b, flags: 0x0}, + 591: {region: 0x166, script: 0x5b, flags: 0x0}, + 592: {region: 0x166, script: 0x5b, flags: 0x0}, + 593: {region: 0x9a, script: 0x53, flags: 0x0}, + 594: {region: 0x8c, script: 0x5b, flags: 0x0}, + 595: {region: 0x166, script: 0x5b, flags: 0x0}, + 596: {region: 0xac, script: 0x54, flags: 0x0}, + 597: {region: 0x107, script: 0x20, flags: 0x0}, + 598: {region: 0x9a, script: 0x22, flags: 0x0}, + 599: {region: 0x166, script: 0x5b, flags: 0x0}, + 600: {region: 0x76, script: 0x5b, flags: 0x0}, + 601: {region: 0x166, script: 0x5b, flags: 0x0}, + 602: {region: 0xb5, script: 0x5b, flags: 0x0}, + 603: {region: 0x166, script: 0x5b, flags: 0x0}, + 604: {region: 0x166, script: 0x5b, flags: 0x0}, + 605: {region: 0x166, script: 0x5b, flags: 0x0}, + 606: {region: 0x166, script: 0x5b, flags: 0x0}, + 607: {region: 0x166, script: 0x5b, flags: 0x0}, + 608: {region: 0x166, script: 0x5b, flags: 0x0}, + 609: {region: 0x166, script: 0x5b, flags: 0x0}, + 610: {region: 0x166, script: 0x2c, flags: 0x0}, + 611: {region: 0x166, script: 0x5b, flags: 0x0}, + 612: {region: 0x107, script: 0x20, flags: 0x0}, + 613: {region: 0x113, script: 0x5b, flags: 0x0}, + 614: {region: 0xe8, script: 0x5b, flags: 0x0}, + 615: {region: 0x107, script: 0x5b, flags: 0x0}, + 616: {region: 0x166, script: 0x5b, flags: 0x0}, + 617: {region: 0x9a, script: 0x22, flags: 0x0}, + 618: {region: 0x9a, script: 0x5, flags: 0x0}, + 619: {region: 0x130, script: 0x5b, flags: 0x0}, + 620: {region: 0x166, script: 0x5b, flags: 0x0}, + 621: {region: 0x52, script: 0x5b, flags: 0x0}, + 622: {region: 0x61, script: 0x5b, flags: 0x0}, + 623: {region: 0x166, script: 0x5b, flags: 0x0}, + 624: {region: 0x166, script: 0x5b, flags: 0x0}, + 625: {region: 0x166, script: 0x2c, flags: 0x0}, + 626: {region: 0x166, script: 0x5b, flags: 0x0}, + 627: {region: 0x166, script: 0x5b, flags: 0x0}, 628: {region: 0x19, script: 0x3, flags: 0x1}, - 629: {region: 0x165, script: 0x5a, flags: 0x0}, - 630: {region: 0x165, script: 0x5a, flags: 0x0}, - 631: {region: 0x165, script: 0x5a, flags: 0x0}, - 632: {region: 0x165, script: 0x5a, flags: 0x0}, - 633: {region: 0x106, script: 0x20, flags: 0x0}, - 634: {region: 0x165, script: 0x5a, flags: 0x0}, - 635: {region: 0x165, script: 0x5a, flags: 0x0}, - 636: {region: 0x165, script: 0x5a, flags: 0x0}, - 637: {region: 0x106, script: 0x20, flags: 0x0}, - 638: {region: 0x165, script: 0x5a, flags: 0x0}, - 639: {region: 0x95, script: 0x5a, flags: 0x0}, - 640: {region: 0xe8, script: 0x5, flags: 0x0}, - 641: {region: 0x7b, script: 0x5a, flags: 0x0}, - 642: {region: 0x165, script: 0x5a, flags: 0x0}, - 643: {region: 0x165, script: 0x5a, flags: 0x0}, - 644: {region: 0x165, script: 0x5a, flags: 0x0}, - 645: {region: 0x165, script: 0x2c, flags: 0x0}, - 646: {region: 0x123, script: 0xeb, flags: 0x0}, - 647: {region: 0xe8, script: 0x5, flags: 0x0}, - 648: {region: 0x165, script: 0x5a, flags: 0x0}, - 649: {region: 0x165, script: 0x5a, flags: 0x0}, + 629: {region: 0x166, script: 0x5b, flags: 0x0}, + 630: {region: 0x166, script: 0x5b, flags: 0x0}, + 631: {region: 0x166, script: 0x5b, flags: 0x0}, + 632: {region: 0x166, script: 0x5b, flags: 0x0}, + 633: {region: 0x107, script: 0x20, flags: 0x0}, + 634: {region: 0x166, script: 0x5b, flags: 0x0}, + 635: {region: 0x166, script: 0x5b, flags: 0x0}, + 636: {region: 0x166, script: 0x5b, flags: 0x0}, + 637: {region: 0x107, script: 0x20, flags: 0x0}, + 638: {region: 0x166, script: 0x5b, flags: 0x0}, + 639: {region: 0x96, script: 0x5b, flags: 0x0}, + 640: {region: 0xe9, script: 0x5, flags: 0x0}, + 641: {region: 0x7c, script: 0x5b, flags: 0x0}, + 642: {region: 0x166, script: 0x5b, flags: 0x0}, + 643: {region: 0x166, script: 0x5b, flags: 0x0}, + 644: {region: 0x166, script: 0x5b, flags: 0x0}, + 645: {region: 0x166, script: 0x2c, flags: 0x0}, + 646: {region: 0x124, script: 0xee, flags: 0x0}, + 647: {region: 0xe9, script: 0x5, flags: 0x0}, + 648: {region: 0x166, script: 0x5b, flags: 0x0}, + 649: {region: 0x166, script: 0x5b, flags: 0x0}, 650: {region: 0x1c, script: 0x5, flags: 0x1}, - 651: {region: 0x165, script: 0x5a, flags: 0x0}, - 652: {region: 0x165, script: 0x5a, flags: 0x0}, - 653: {region: 0x165, script: 0x5a, flags: 0x0}, - 654: {region: 0x138, script: 0x5a, flags: 0x0}, - 655: {region: 0x87, script: 0x5e, flags: 0x0}, - 656: {region: 0x97, script: 0x3e, flags: 0x0}, - 657: {region: 0x12f, script: 0x5a, flags: 0x0}, - 658: {region: 0xe8, script: 0x5, flags: 0x0}, - 659: {region: 0x131, script: 0x5a, flags: 0x0}, - 660: {region: 0x165, script: 0x5a, flags: 0x0}, - 661: {region: 0xb7, script: 0x5a, flags: 0x0}, - 662: {region: 0x106, script: 0x20, flags: 0x0}, - 663: {region: 0x165, script: 0x5a, flags: 0x0}, - 664: {region: 0x95, script: 0x5a, flags: 0x0}, - 665: {region: 0x165, script: 0x5a, flags: 0x0}, - 666: {region: 0x53, script: 0xeb, flags: 0x0}, - 667: {region: 0x165, script: 0x5a, flags: 0x0}, - 668: {region: 0x165, script: 0x5a, flags: 0x0}, - 669: {region: 0x165, script: 0x5a, flags: 0x0}, - 670: {region: 0x165, script: 0x5a, flags: 0x0}, - 671: {region: 0x99, script: 0x5c, flags: 0x0}, - 672: {region: 0x165, script: 0x5a, flags: 0x0}, - 673: {region: 0x165, script: 0x5a, flags: 0x0}, - 674: {region: 0x106, script: 0x20, flags: 0x0}, - 675: {region: 0x131, script: 0x5a, flags: 0x0}, - 676: {region: 0x165, script: 0x5a, flags: 0x0}, - 677: {region: 0xd9, script: 0x5a, flags: 0x0}, - 678: {region: 0x165, script: 0x5a, flags: 0x0}, - 679: {region: 0x165, script: 0x5a, flags: 0x0}, + 651: {region: 0x166, script: 0x5b, flags: 0x0}, + 652: {region: 0x166, script: 0x5b, flags: 0x0}, + 653: {region: 0x166, script: 0x5b, flags: 0x0}, + 654: {region: 0x139, script: 0x5b, flags: 0x0}, + 655: {region: 0x88, script: 0x5f, flags: 0x0}, + 656: {region: 0x98, script: 0x3e, flags: 0x0}, + 657: {region: 0x130, script: 0x5b, flags: 0x0}, + 658: {region: 0xe9, script: 0x5, flags: 0x0}, + 659: {region: 0x132, script: 0x5b, flags: 0x0}, + 660: {region: 0x166, script: 0x5b, flags: 0x0}, + 661: {region: 0xb8, script: 0x5b, flags: 0x0}, + 662: {region: 0x107, script: 0x20, flags: 0x0}, + 663: {region: 0x166, script: 0x5b, flags: 0x0}, + 664: {region: 0x96, script: 0x5b, flags: 0x0}, + 665: {region: 0x166, script: 0x5b, flags: 0x0}, + 666: {region: 0x53, script: 0xee, flags: 0x0}, + 667: {region: 0x166, script: 0x5b, flags: 0x0}, + 668: {region: 0x166, script: 0x5b, flags: 0x0}, + 669: {region: 0x166, script: 0x5b, flags: 0x0}, + 670: {region: 0x166, script: 0x5b, flags: 0x0}, + 671: {region: 0x9a, script: 0x5d, flags: 0x0}, + 672: {region: 0x166, script: 0x5b, flags: 0x0}, + 673: {region: 0x166, script: 0x5b, flags: 0x0}, + 674: {region: 0x107, script: 0x20, flags: 0x0}, + 675: {region: 0x132, script: 0x5b, flags: 0x0}, + 676: {region: 0x166, script: 0x5b, flags: 0x0}, + 677: {region: 0xda, script: 0x5b, flags: 0x0}, + 678: {region: 0x166, script: 0x5b, flags: 0x0}, + 679: {region: 0x166, script: 0x5b, flags: 0x0}, 680: {region: 0x21, script: 0x2, flags: 0x1}, - 681: {region: 0x165, script: 0x5a, flags: 0x0}, - 682: {region: 0x165, script: 0x5a, flags: 0x0}, - 683: {region: 0x9e, script: 0x5a, flags: 0x0}, - 684: {region: 0x53, script: 0x60, flags: 0x0}, - 685: {region: 0x95, script: 0x5a, flags: 0x0}, - 686: {region: 0x9c, script: 0x5, flags: 0x0}, - 687: {region: 0x135, script: 0x5a, flags: 0x0}, - 688: {region: 0x165, script: 0x5a, flags: 0x0}, - 689: {region: 0x165, script: 0x5a, flags: 0x0}, - 690: {region: 0x99, script: 0xe6, flags: 0x0}, - 691: {region: 0x9e, script: 0x5a, flags: 0x0}, - 692: {region: 0x165, script: 0x5a, flags: 0x0}, - 693: {region: 0x4b, script: 0x5a, flags: 0x0}, - 694: {region: 0x165, script: 0x5a, flags: 0x0}, - 695: {region: 0x165, script: 0x5a, flags: 0x0}, - 696: {region: 0xaf, script: 0x57, flags: 0x0}, - 697: {region: 0x165, script: 0x5a, flags: 0x0}, - 698: {region: 0x165, script: 0x5a, flags: 0x0}, - 699: {region: 0x4b, script: 0x5a, flags: 0x0}, - 700: {region: 0x165, script: 0x5a, flags: 0x0}, - 701: {region: 0x165, script: 0x5a, flags: 0x0}, - 702: {region: 0x162, script: 0x5a, flags: 0x0}, - 703: {region: 0x9c, script: 0x5, flags: 0x0}, - 704: {region: 0xb6, script: 0x5a, flags: 0x0}, - 705: {region: 0xb8, script: 0x5a, flags: 0x0}, - 706: {region: 0x4b, script: 0x5a, flags: 0x0}, - 707: {region: 0x4b, script: 0x5a, flags: 0x0}, - 708: {region: 0xa4, script: 0x5a, flags: 0x0}, - 709: {region: 0xa4, script: 0x5a, flags: 0x0}, - 710: {region: 0x9c, script: 0x5, flags: 0x0}, - 711: {region: 0xb8, script: 0x5a, flags: 0x0}, - 712: {region: 0x123, script: 0xeb, flags: 0x0}, + 681: {region: 0x166, script: 0x5b, flags: 0x0}, + 682: {region: 0x166, script: 0x5b, flags: 0x0}, + 683: {region: 0x9f, script: 0x5b, flags: 0x0}, + 684: {region: 0x53, script: 0x61, flags: 0x0}, + 685: {region: 0x96, script: 0x5b, flags: 0x0}, + 686: {region: 0x9d, script: 0x5, flags: 0x0}, + 687: {region: 0x136, script: 0x5b, flags: 0x0}, + 688: {region: 0x166, script: 0x5b, flags: 0x0}, + 689: {region: 0x166, script: 0x5b, flags: 0x0}, + 690: {region: 0x9a, script: 0xe9, flags: 0x0}, + 691: {region: 0x9f, script: 0x5b, flags: 0x0}, + 692: {region: 0x166, script: 0x5b, flags: 0x0}, + 693: {region: 0x4b, script: 0x5b, flags: 0x0}, + 694: {region: 0x166, script: 0x5b, flags: 0x0}, + 695: {region: 0x166, script: 0x5b, flags: 0x0}, + 696: {region: 0xb0, script: 0x58, flags: 0x0}, + 697: {region: 0x166, script: 0x5b, flags: 0x0}, + 698: {region: 0x166, script: 0x5b, flags: 0x0}, + 699: {region: 0x4b, script: 0x5b, flags: 0x0}, + 700: {region: 0x166, script: 0x5b, flags: 0x0}, + 701: {region: 0x166, script: 0x5b, flags: 0x0}, + 702: {region: 0x163, script: 0x5b, flags: 0x0}, + 703: {region: 0x9d, script: 0x5, flags: 0x0}, + 704: {region: 0xb7, script: 0x5b, flags: 0x0}, + 705: {region: 0xb9, script: 0x5b, flags: 0x0}, + 706: {region: 0x4b, script: 0x5b, flags: 0x0}, + 707: {region: 0x4b, script: 0x5b, flags: 0x0}, + 708: {region: 0xa5, script: 0x5b, flags: 0x0}, + 709: {region: 0xa5, script: 0x5b, flags: 0x0}, + 710: {region: 0x9d, script: 0x5, flags: 0x0}, + 711: {region: 0xb9, script: 0x5b, flags: 0x0}, + 712: {region: 0x124, script: 0xee, flags: 0x0}, 713: {region: 0x53, script: 0x3b, flags: 0x0}, - 714: {region: 0x12b, script: 0x5a, flags: 0x0}, - 715: {region: 0x95, script: 0x5a, flags: 0x0}, - 716: {region: 0x52, script: 0x5a, flags: 0x0}, - 717: {region: 0x99, script: 0x22, flags: 0x0}, - 718: {region: 0x99, script: 0x22, flags: 0x0}, - 719: {region: 0x95, script: 0x5a, flags: 0x0}, + 714: {region: 0x12c, script: 0x5b, flags: 0x0}, + 715: {region: 0x96, script: 0x5b, flags: 0x0}, + 716: {region: 0x52, script: 0x5b, flags: 0x0}, + 717: {region: 0x9a, script: 0x22, flags: 0x0}, + 718: {region: 0x9a, script: 0x22, flags: 0x0}, + 719: {region: 0x96, script: 0x5b, flags: 0x0}, 720: {region: 0x23, script: 0x3, flags: 0x1}, - 721: {region: 0xa4, script: 0x5a, flags: 0x0}, - 722: {region: 0x165, script: 0x5a, flags: 0x0}, - 723: {region: 0xcf, script: 0x5a, flags: 0x0}, - 724: {region: 0x165, script: 0x5a, flags: 0x0}, - 725: {region: 0x165, script: 0x5a, flags: 0x0}, - 726: {region: 0x165, script: 0x5a, flags: 0x0}, - 727: {region: 0x165, script: 0x5a, flags: 0x0}, - 728: {region: 0x165, script: 0x5a, flags: 0x0}, - 729: {region: 0x165, script: 0x5a, flags: 0x0}, - 730: {region: 0x165, script: 0x5a, flags: 0x0}, - 731: {region: 0x165, script: 0x5a, flags: 0x0}, - 732: {region: 0x165, script: 0x5a, flags: 0x0}, - 733: {region: 0x165, script: 0x5a, flags: 0x0}, - 734: {region: 0x165, script: 0x5a, flags: 0x0}, - 735: {region: 0x165, script: 0x5, flags: 0x0}, - 736: {region: 0x106, script: 0x20, flags: 0x0}, - 737: {region: 0xe7, script: 0x5a, flags: 0x0}, - 738: {region: 0x165, script: 0x5a, flags: 0x0}, - 739: {region: 0x95, script: 0x5a, flags: 0x0}, - 740: {region: 0x165, script: 0x2c, flags: 0x0}, - 741: {region: 0x165, script: 0x5a, flags: 0x0}, - 742: {region: 0x165, script: 0x5a, flags: 0x0}, - 743: {region: 0x165, script: 0x5a, flags: 0x0}, - 744: {region: 0x112, script: 0x5a, flags: 0x0}, - 745: {region: 0xa4, script: 0x5a, flags: 0x0}, - 746: {region: 0x165, script: 0x5a, flags: 0x0}, - 747: {region: 0x165, script: 0x5a, flags: 0x0}, - 748: {region: 0x123, script: 0x5, flags: 0x0}, - 749: {region: 0xcc, script: 0x5a, flags: 0x0}, - 750: {region: 0x165, script: 0x5a, flags: 0x0}, - 751: {region: 0x165, script: 0x5a, flags: 0x0}, - 752: {region: 0x165, script: 0x5a, flags: 0x0}, - 753: {region: 0xbf, script: 0x5a, flags: 0x0}, - 754: {region: 0xd1, script: 0x5a, flags: 0x0}, - 755: {region: 0x165, script: 0x5a, flags: 0x0}, - 756: {region: 0x52, script: 0x5a, flags: 0x0}, - 757: {region: 0xdb, script: 0x22, flags: 0x0}, - 758: {region: 0x12f, script: 0x5a, flags: 0x0}, - 759: {region: 0xc0, script: 0x5a, flags: 0x0}, - 760: {region: 0x165, script: 0x5a, flags: 0x0}, - 761: {region: 0x165, script: 0x5a, flags: 0x0}, - 762: {region: 0xe0, script: 0x5a, flags: 0x0}, - 763: {region: 0x165, script: 0x5a, flags: 0x0}, - 764: {region: 0x95, script: 0x5a, flags: 0x0}, - 765: {region: 0x9b, script: 0x3d, flags: 0x0}, - 766: {region: 0x165, script: 0x5a, flags: 0x0}, - 767: {region: 0xc2, script: 0x20, flags: 0x0}, - 768: {region: 0x165, script: 0x5, flags: 0x0}, - 769: {region: 0x165, script: 0x5a, flags: 0x0}, - 770: {region: 0x165, script: 0x5a, flags: 0x0}, - 771: {region: 0x165, script: 0x5a, flags: 0x0}, - 772: {region: 0x99, script: 0x6e, flags: 0x0}, - 773: {region: 0x165, script: 0x5a, flags: 0x0}, - 774: {region: 0x165, script: 0x5a, flags: 0x0}, - 775: {region: 0x10b, script: 0x5a, flags: 0x0}, - 776: {region: 0x165, script: 0x5a, flags: 0x0}, - 777: {region: 0x165, script: 0x5a, flags: 0x0}, - 778: {region: 0x165, script: 0x5a, flags: 0x0}, + 721: {region: 0xa5, script: 0x5b, flags: 0x0}, + 722: {region: 0x166, script: 0x5b, flags: 0x0}, + 723: {region: 0xd0, script: 0x5b, flags: 0x0}, + 724: {region: 0x166, script: 0x5b, flags: 0x0}, + 725: {region: 0x166, script: 0x5b, flags: 0x0}, + 726: {region: 0x166, script: 0x5b, flags: 0x0}, + 727: {region: 0x166, script: 0x5b, flags: 0x0}, + 728: {region: 0x166, script: 0x5b, flags: 0x0}, + 729: {region: 0x166, script: 0x5b, flags: 0x0}, + 730: {region: 0x166, script: 0x5b, flags: 0x0}, + 731: {region: 0x166, script: 0x5b, flags: 0x0}, + 732: {region: 0x166, script: 0x5b, flags: 0x0}, + 733: {region: 0x166, script: 0x5b, flags: 0x0}, + 734: {region: 0x166, script: 0x5b, flags: 0x0}, + 735: {region: 0x166, script: 0x5, flags: 0x0}, + 736: {region: 0x107, script: 0x20, flags: 0x0}, + 737: {region: 0xe8, script: 0x5b, flags: 0x0}, + 738: {region: 0x166, script: 0x5b, flags: 0x0}, + 739: {region: 0x96, script: 0x5b, flags: 0x0}, + 740: {region: 0x166, script: 0x2c, flags: 0x0}, + 741: {region: 0x166, script: 0x5b, flags: 0x0}, + 742: {region: 0x166, script: 0x5b, flags: 0x0}, + 743: {region: 0x166, script: 0x5b, flags: 0x0}, + 744: {region: 0x113, script: 0x5b, flags: 0x0}, + 745: {region: 0xa5, script: 0x5b, flags: 0x0}, + 746: {region: 0x166, script: 0x5b, flags: 0x0}, + 747: {region: 0x166, script: 0x5b, flags: 0x0}, + 748: {region: 0x124, script: 0x5, flags: 0x0}, + 749: {region: 0xcd, script: 0x5b, flags: 0x0}, + 750: {region: 0x166, script: 0x5b, flags: 0x0}, + 751: {region: 0x166, script: 0x5b, flags: 0x0}, + 752: {region: 0x166, script: 0x5b, flags: 0x0}, + 753: {region: 0xc0, script: 0x5b, flags: 0x0}, + 754: {region: 0xd2, script: 0x5b, flags: 0x0}, + 755: {region: 0x166, script: 0x5b, flags: 0x0}, + 756: {region: 0x52, script: 0x5b, flags: 0x0}, + 757: {region: 0xdc, script: 0x22, flags: 0x0}, + 758: {region: 0x130, script: 0x5b, flags: 0x0}, + 759: {region: 0xc1, script: 0x5b, flags: 0x0}, + 760: {region: 0x166, script: 0x5b, flags: 0x0}, + 761: {region: 0x166, script: 0x5b, flags: 0x0}, + 762: {region: 0xe1, script: 0x5b, flags: 0x0}, + 763: {region: 0x166, script: 0x5b, flags: 0x0}, + 764: {region: 0x96, script: 0x5b, flags: 0x0}, + 765: {region: 0x9c, script: 0x3d, flags: 0x0}, + 766: {region: 0x166, script: 0x5b, flags: 0x0}, + 767: {region: 0xc3, script: 0x20, flags: 0x0}, + 768: {region: 0x166, script: 0x5, flags: 0x0}, + 769: {region: 0x166, script: 0x5b, flags: 0x0}, + 770: {region: 0x166, script: 0x5b, flags: 0x0}, + 771: {region: 0x166, script: 0x5b, flags: 0x0}, + 772: {region: 0x9a, script: 0x6f, flags: 0x0}, + 773: {region: 0x166, script: 0x5b, flags: 0x0}, + 774: {region: 0x166, script: 0x5b, flags: 0x0}, + 775: {region: 0x10c, script: 0x5b, flags: 0x0}, + 776: {region: 0x166, script: 0x5b, flags: 0x0}, + 777: {region: 0x166, script: 0x5b, flags: 0x0}, + 778: {region: 0x166, script: 0x5b, flags: 0x0}, 779: {region: 0x26, script: 0x3, flags: 0x1}, - 780: {region: 0x165, script: 0x5a, flags: 0x0}, - 781: {region: 0x165, script: 0x5a, flags: 0x0}, - 782: {region: 0x99, script: 0xe, flags: 0x0}, - 783: {region: 0xc4, script: 0x75, flags: 0x0}, - 785: {region: 0x165, script: 0x5a, flags: 0x0}, - 786: {region: 0x49, script: 0x5a, flags: 0x0}, - 787: {region: 0x49, script: 0x5a, flags: 0x0}, - 788: {region: 0x37, script: 0x5a, flags: 0x0}, - 789: {region: 0x165, script: 0x5a, flags: 0x0}, - 790: {region: 0x165, script: 0x5a, flags: 0x0}, - 791: {region: 0x165, script: 0x5a, flags: 0x0}, - 792: {region: 0x165, script: 0x5a, flags: 0x0}, - 793: {region: 0x165, script: 0x5a, flags: 0x0}, - 794: {region: 0x165, script: 0x5a, flags: 0x0}, - 795: {region: 0x99, script: 0x22, flags: 0x0}, - 796: {region: 0xdb, script: 0x22, flags: 0x0}, - 797: {region: 0x106, script: 0x20, flags: 0x0}, - 798: {region: 0x35, script: 0x72, flags: 0x0}, + 780: {region: 0x166, script: 0x5b, flags: 0x0}, + 781: {region: 0x166, script: 0x5b, flags: 0x0}, + 782: {region: 0x9a, script: 0xe, flags: 0x0}, + 783: {region: 0xc5, script: 0x76, flags: 0x0}, + 785: {region: 0x166, script: 0x5b, flags: 0x0}, + 786: {region: 0x49, script: 0x5b, flags: 0x0}, + 787: {region: 0x49, script: 0x5b, flags: 0x0}, + 788: {region: 0x37, script: 0x5b, flags: 0x0}, + 789: {region: 0x166, script: 0x5b, flags: 0x0}, + 790: {region: 0x166, script: 0x5b, flags: 0x0}, + 791: {region: 0x166, script: 0x5b, flags: 0x0}, + 792: {region: 0x166, script: 0x5b, flags: 0x0}, + 793: {region: 0x166, script: 0x5b, flags: 0x0}, + 794: {region: 0x166, script: 0x5b, flags: 0x0}, + 795: {region: 0x9a, script: 0x22, flags: 0x0}, + 796: {region: 0xdc, script: 0x22, flags: 0x0}, + 797: {region: 0x107, script: 0x20, flags: 0x0}, + 798: {region: 0x35, script: 0x73, flags: 0x0}, 799: {region: 0x29, script: 0x3, flags: 0x1}, - 800: {region: 0xcb, script: 0x5a, flags: 0x0}, - 801: {region: 0x165, script: 0x5a, flags: 0x0}, - 802: {region: 0x165, script: 0x5a, flags: 0x0}, - 803: {region: 0x165, script: 0x5a, flags: 0x0}, - 804: {region: 0x99, script: 0x22, flags: 0x0}, - 805: {region: 0x52, script: 0x5a, flags: 0x0}, - 807: {region: 0x165, script: 0x5a, flags: 0x0}, - 808: {region: 0x135, script: 0x5a, flags: 0x0}, - 809: {region: 0x165, script: 0x5a, flags: 0x0}, - 810: {region: 0x165, script: 0x5a, flags: 0x0}, - 811: {region: 0xe8, script: 0x5, flags: 0x0}, - 812: {region: 0xc3, script: 0x5a, flags: 0x0}, - 813: {region: 0x99, script: 0x22, flags: 0x0}, - 814: {region: 0x95, script: 0x5a, flags: 0x0}, - 815: {region: 0x164, script: 0x5a, flags: 0x0}, - 816: {region: 0x165, script: 0x5a, flags: 0x0}, - 817: {region: 0xc4, script: 0x75, flags: 0x0}, - 818: {region: 0x165, script: 0x5a, flags: 0x0}, - 819: {region: 0x165, script: 0x2c, flags: 0x0}, - 820: {region: 0x106, script: 0x20, flags: 0x0}, - 821: {region: 0x165, script: 0x5a, flags: 0x0}, - 822: {region: 0x131, script: 0x5a, flags: 0x0}, - 823: {region: 0x9c, script: 0x66, flags: 0x0}, - 824: {region: 0x165, script: 0x5a, flags: 0x0}, - 825: {region: 0x165, script: 0x5a, flags: 0x0}, - 826: {region: 0x9c, script: 0x5, flags: 0x0}, - 827: {region: 0x165, script: 0x5a, flags: 0x0}, - 828: {region: 0x165, script: 0x5a, flags: 0x0}, - 829: {region: 0x165, script: 0x5a, flags: 0x0}, - 830: {region: 0xdd, script: 0x5a, flags: 0x0}, - 831: {region: 0x165, script: 0x5a, flags: 0x0}, - 832: {region: 0x165, script: 0x5a, flags: 0x0}, - 834: {region: 0x165, script: 0x5a, flags: 0x0}, + 800: {region: 0xcc, script: 0x5b, flags: 0x0}, + 801: {region: 0x166, script: 0x5b, flags: 0x0}, + 802: {region: 0x166, script: 0x5b, flags: 0x0}, + 803: {region: 0x166, script: 0x5b, flags: 0x0}, + 804: {region: 0x9a, script: 0x22, flags: 0x0}, + 805: {region: 0x52, script: 0x5b, flags: 0x0}, + 807: {region: 0x166, script: 0x5b, flags: 0x0}, + 808: {region: 0x136, script: 0x5b, flags: 0x0}, + 809: {region: 0x166, script: 0x5b, flags: 0x0}, + 810: {region: 0x166, script: 0x5b, flags: 0x0}, + 811: {region: 0xe9, script: 0x5, flags: 0x0}, + 812: {region: 0xc4, script: 0x5b, flags: 0x0}, + 813: {region: 0x9a, script: 0x22, flags: 0x0}, + 814: {region: 0x96, script: 0x5b, flags: 0x0}, + 815: {region: 0x165, script: 0x5b, flags: 0x0}, + 816: {region: 0x166, script: 0x5b, flags: 0x0}, + 817: {region: 0xc5, script: 0x76, flags: 0x0}, + 818: {region: 0x166, script: 0x5b, flags: 0x0}, + 819: {region: 0x166, script: 0x2c, flags: 0x0}, + 820: {region: 0x107, script: 0x20, flags: 0x0}, + 821: {region: 0x166, script: 0x5b, flags: 0x0}, + 822: {region: 0x132, script: 0x5b, flags: 0x0}, + 823: {region: 0x9d, script: 0x67, flags: 0x0}, + 824: {region: 0x166, script: 0x5b, flags: 0x0}, + 825: {region: 0x166, script: 0x5b, flags: 0x0}, + 826: {region: 0x9d, script: 0x5, flags: 0x0}, + 827: {region: 0x166, script: 0x5b, flags: 0x0}, + 828: {region: 0x166, script: 0x5b, flags: 0x0}, + 829: {region: 0x166, script: 0x5b, flags: 0x0}, + 830: {region: 0xde, script: 0x5b, flags: 0x0}, + 831: {region: 0x166, script: 0x5b, flags: 0x0}, + 832: {region: 0x166, script: 0x5b, flags: 0x0}, + 834: {region: 0x166, script: 0x5b, flags: 0x0}, 835: {region: 0x53, script: 0x3b, flags: 0x0}, - 836: {region: 0x9e, script: 0x5a, flags: 0x0}, - 837: {region: 0xd2, script: 0x5a, flags: 0x0}, - 838: {region: 0x165, script: 0x5a, flags: 0x0}, - 839: {region: 0xda, script: 0x5a, flags: 0x0}, - 840: {region: 0x165, script: 0x5a, flags: 0x0}, - 841: {region: 0x165, script: 0x5a, flags: 0x0}, - 842: {region: 0x165, script: 0x5a, flags: 0x0}, - 843: {region: 0xcf, script: 0x5a, flags: 0x0}, - 844: {region: 0x165, script: 0x5a, flags: 0x0}, - 845: {region: 0x165, script: 0x5a, flags: 0x0}, - 846: {region: 0x164, script: 0x5a, flags: 0x0}, - 847: {region: 0xd1, script: 0x5a, flags: 0x0}, - 848: {region: 0x60, script: 0x5a, flags: 0x0}, - 849: {region: 0xdb, script: 0x22, flags: 0x0}, - 850: {region: 0x165, script: 0x5a, flags: 0x0}, - 851: {region: 0xdb, script: 0x22, flags: 0x0}, - 852: {region: 0x165, script: 0x5a, flags: 0x0}, - 853: {region: 0x165, script: 0x5a, flags: 0x0}, - 854: {region: 0xd2, script: 0x5a, flags: 0x0}, - 855: {region: 0x165, script: 0x5a, flags: 0x0}, - 856: {region: 0x165, script: 0x5a, flags: 0x0}, - 857: {region: 0xd1, script: 0x5a, flags: 0x0}, - 858: {region: 0x165, script: 0x5a, flags: 0x0}, - 859: {region: 0xcf, script: 0x5a, flags: 0x0}, - 860: {region: 0xcf, script: 0x5a, flags: 0x0}, - 861: {region: 0x165, script: 0x5a, flags: 0x0}, - 862: {region: 0x165, script: 0x5a, flags: 0x0}, - 863: {region: 0x95, script: 0x5a, flags: 0x0}, - 864: {region: 0x165, script: 0x5a, flags: 0x0}, - 865: {region: 0xdf, script: 0x5a, flags: 0x0}, - 866: {region: 0x165, script: 0x5a, flags: 0x0}, - 867: {region: 0x165, script: 0x5a, flags: 0x0}, - 868: {region: 0x99, script: 0x5a, flags: 0x0}, - 869: {region: 0x165, script: 0x5a, flags: 0x0}, - 870: {region: 0x165, script: 0x5a, flags: 0x0}, - 871: {region: 0xd9, script: 0x5a, flags: 0x0}, - 872: {region: 0x52, script: 0x5a, flags: 0x0}, - 873: {region: 0x165, script: 0x5a, flags: 0x0}, - 874: {region: 0xda, script: 0x5a, flags: 0x0}, - 875: {region: 0x165, script: 0x5a, flags: 0x0}, - 876: {region: 0x52, script: 0x5a, flags: 0x0}, - 877: {region: 0x165, script: 0x5a, flags: 0x0}, - 878: {region: 0x165, script: 0x5a, flags: 0x0}, - 879: {region: 0xda, script: 0x5a, flags: 0x0}, - 880: {region: 0x123, script: 0x56, flags: 0x0}, - 881: {region: 0x99, script: 0x22, flags: 0x0}, - 882: {region: 0x10c, script: 0xc9, flags: 0x0}, - 883: {region: 0x165, script: 0x5a, flags: 0x0}, - 884: {region: 0x165, script: 0x5a, flags: 0x0}, - 885: {region: 0x84, script: 0x7c, flags: 0x0}, - 886: {region: 0x161, script: 0x5a, flags: 0x0}, - 887: {region: 0x165, script: 0x5a, flags: 0x0}, + 836: {region: 0x9f, script: 0x5b, flags: 0x0}, + 837: {region: 0xd3, script: 0x5b, flags: 0x0}, + 838: {region: 0x166, script: 0x5b, flags: 0x0}, + 839: {region: 0xdb, script: 0x5b, flags: 0x0}, + 840: {region: 0x166, script: 0x5b, flags: 0x0}, + 841: {region: 0x166, script: 0x5b, flags: 0x0}, + 842: {region: 0x166, script: 0x5b, flags: 0x0}, + 843: {region: 0xd0, script: 0x5b, flags: 0x0}, + 844: {region: 0x166, script: 0x5b, flags: 0x0}, + 845: {region: 0x166, script: 0x5b, flags: 0x0}, + 846: {region: 0x165, script: 0x5b, flags: 0x0}, + 847: {region: 0xd2, script: 0x5b, flags: 0x0}, + 848: {region: 0x61, script: 0x5b, flags: 0x0}, + 849: {region: 0xdc, script: 0x22, flags: 0x0}, + 850: {region: 0x166, script: 0x5b, flags: 0x0}, + 851: {region: 0xdc, script: 0x22, flags: 0x0}, + 852: {region: 0x166, script: 0x5b, flags: 0x0}, + 853: {region: 0x166, script: 0x5b, flags: 0x0}, + 854: {region: 0xd3, script: 0x5b, flags: 0x0}, + 855: {region: 0x166, script: 0x5b, flags: 0x0}, + 856: {region: 0x166, script: 0x5b, flags: 0x0}, + 857: {region: 0xd2, script: 0x5b, flags: 0x0}, + 858: {region: 0x166, script: 0x5b, flags: 0x0}, + 859: {region: 0xd0, script: 0x5b, flags: 0x0}, + 860: {region: 0xd0, script: 0x5b, flags: 0x0}, + 861: {region: 0x166, script: 0x5b, flags: 0x0}, + 862: {region: 0x166, script: 0x5b, flags: 0x0}, + 863: {region: 0x96, script: 0x5b, flags: 0x0}, + 864: {region: 0x166, script: 0x5b, flags: 0x0}, + 865: {region: 0xe0, script: 0x5b, flags: 0x0}, + 866: {region: 0x166, script: 0x5b, flags: 0x0}, + 867: {region: 0x166, script: 0x5b, flags: 0x0}, + 868: {region: 0x9a, script: 0x5b, flags: 0x0}, + 869: {region: 0x166, script: 0x5b, flags: 0x0}, + 870: {region: 0x166, script: 0x5b, flags: 0x0}, + 871: {region: 0xda, script: 0x5b, flags: 0x0}, + 872: {region: 0x52, script: 0x5b, flags: 0x0}, + 873: {region: 0x166, script: 0x5b, flags: 0x0}, + 874: {region: 0xdb, script: 0x5b, flags: 0x0}, + 875: {region: 0x166, script: 0x5b, flags: 0x0}, + 876: {region: 0x52, script: 0x5b, flags: 0x0}, + 877: {region: 0x166, script: 0x5b, flags: 0x0}, + 878: {region: 0x166, script: 0x5b, flags: 0x0}, + 879: {region: 0xdb, script: 0x5b, flags: 0x0}, + 880: {region: 0x124, script: 0x57, flags: 0x0}, + 881: {region: 0x9a, script: 0x22, flags: 0x0}, + 882: {region: 0x10d, script: 0xcb, flags: 0x0}, + 883: {region: 0x166, script: 0x5b, flags: 0x0}, + 884: {region: 0x166, script: 0x5b, flags: 0x0}, + 885: {region: 0x85, script: 0x7e, flags: 0x0}, + 886: {region: 0x162, script: 0x5b, flags: 0x0}, + 887: {region: 0x166, script: 0x5b, flags: 0x0}, 888: {region: 0x49, script: 0x17, flags: 0x0}, - 889: {region: 0x165, script: 0x5a, flags: 0x0}, - 890: {region: 0x161, script: 0x5a, flags: 0x0}, - 891: {region: 0x165, script: 0x5a, flags: 0x0}, - 892: {region: 0x165, script: 0x5a, flags: 0x0}, - 893: {region: 0x165, script: 0x5a, flags: 0x0}, - 894: {region: 0x165, script: 0x5a, flags: 0x0}, - 895: {region: 0x165, script: 0x5a, flags: 0x0}, - 896: {region: 0x117, script: 0x5a, flags: 0x0}, - 897: {region: 0x165, script: 0x5a, flags: 0x0}, - 898: {region: 0x165, script: 0x5a, flags: 0x0}, - 899: {region: 0x135, script: 0x5a, flags: 0x0}, - 900: {region: 0x165, script: 0x5a, flags: 0x0}, - 901: {region: 0x53, script: 0x5a, flags: 0x0}, - 902: {region: 0x165, script: 0x5a, flags: 0x0}, - 903: {region: 0xce, script: 0x5a, flags: 0x0}, - 904: {region: 0x12f, script: 0x5a, flags: 0x0}, - 905: {region: 0x131, script: 0x5a, flags: 0x0}, - 906: {region: 0x80, script: 0x5a, flags: 0x0}, - 907: {region: 0x78, script: 0x5a, flags: 0x0}, - 908: {region: 0x165, script: 0x5a, flags: 0x0}, - 910: {region: 0x165, script: 0x5a, flags: 0x0}, - 911: {region: 0x165, script: 0x5a, flags: 0x0}, - 912: {region: 0x6f, script: 0x5a, flags: 0x0}, - 913: {region: 0x165, script: 0x5a, flags: 0x0}, - 914: {region: 0x165, script: 0x5a, flags: 0x0}, - 915: {region: 0x165, script: 0x5a, flags: 0x0}, - 916: {region: 0x165, script: 0x5a, flags: 0x0}, - 917: {region: 0x99, script: 0x81, flags: 0x0}, - 918: {region: 0x165, script: 0x5a, flags: 0x0}, - 919: {region: 0x165, script: 0x5, flags: 0x0}, - 920: {region: 0x7d, script: 0x20, flags: 0x0}, - 921: {region: 0x135, script: 0x82, flags: 0x0}, - 922: {region: 0x165, script: 0x5, flags: 0x0}, - 923: {region: 0xc5, script: 0x80, flags: 0x0}, - 924: {region: 0x165, script: 0x5a, flags: 0x0}, + 889: {region: 0x166, script: 0x5b, flags: 0x0}, + 890: {region: 0x162, script: 0x5b, flags: 0x0}, + 891: {region: 0x166, script: 0x5b, flags: 0x0}, + 892: {region: 0x166, script: 0x5b, flags: 0x0}, + 893: {region: 0x166, script: 0x5b, flags: 0x0}, + 894: {region: 0x166, script: 0x5b, flags: 0x0}, + 895: {region: 0x166, script: 0x5b, flags: 0x0}, + 896: {region: 0x118, script: 0x5b, flags: 0x0}, + 897: {region: 0x166, script: 0x5b, flags: 0x0}, + 898: {region: 0x166, script: 0x5b, flags: 0x0}, + 899: {region: 0x136, script: 0x5b, flags: 0x0}, + 900: {region: 0x166, script: 0x5b, flags: 0x0}, + 901: {region: 0x53, script: 0x5b, flags: 0x0}, + 902: {region: 0x166, script: 0x5b, flags: 0x0}, + 903: {region: 0xcf, script: 0x5b, flags: 0x0}, + 904: {region: 0x130, script: 0x5b, flags: 0x0}, + 905: {region: 0x132, script: 0x5b, flags: 0x0}, + 906: {region: 0x81, script: 0x5b, flags: 0x0}, + 907: {region: 0x79, script: 0x5b, flags: 0x0}, + 908: {region: 0x166, script: 0x5b, flags: 0x0}, + 910: {region: 0x166, script: 0x5b, flags: 0x0}, + 911: {region: 0x166, script: 0x5b, flags: 0x0}, + 912: {region: 0x70, script: 0x5b, flags: 0x0}, + 913: {region: 0x166, script: 0x5b, flags: 0x0}, + 914: {region: 0x166, script: 0x5b, flags: 0x0}, + 915: {region: 0x166, script: 0x5b, flags: 0x0}, + 916: {region: 0x166, script: 0x5b, flags: 0x0}, + 917: {region: 0x9a, script: 0x83, flags: 0x0}, + 918: {region: 0x166, script: 0x5b, flags: 0x0}, + 919: {region: 0x166, script: 0x5, flags: 0x0}, + 920: {region: 0x7e, script: 0x20, flags: 0x0}, + 921: {region: 0x136, script: 0x84, flags: 0x0}, + 922: {region: 0x166, script: 0x5, flags: 0x0}, + 923: {region: 0xc6, script: 0x82, flags: 0x0}, + 924: {region: 0x166, script: 0x5b, flags: 0x0}, 925: {region: 0x2c, script: 0x3, flags: 0x1}, - 926: {region: 0xe7, script: 0x5a, flags: 0x0}, + 926: {region: 0xe8, script: 0x5b, flags: 0x0}, 927: {region: 0x2f, script: 0x2, flags: 0x1}, - 928: {region: 0xe7, script: 0x5a, flags: 0x0}, - 929: {region: 0x30, script: 0x5a, flags: 0x0}, - 930: {region: 0xf0, script: 0x5a, flags: 0x0}, - 931: {region: 0x165, script: 0x5a, flags: 0x0}, - 932: {region: 0x78, script: 0x5a, flags: 0x0}, - 933: {region: 0xd6, script: 0x5a, flags: 0x0}, - 934: {region: 0x135, script: 0x5a, flags: 0x0}, - 935: {region: 0x49, script: 0x5a, flags: 0x0}, - 936: {region: 0x165, script: 0x5a, flags: 0x0}, - 937: {region: 0x9c, script: 0xf7, flags: 0x0}, - 938: {region: 0x165, script: 0x5a, flags: 0x0}, - 939: {region: 0x60, script: 0x5a, flags: 0x0}, - 940: {region: 0x165, script: 0x5, flags: 0x0}, - 941: {region: 0xb0, script: 0x8e, flags: 0x0}, - 943: {region: 0x165, script: 0x5a, flags: 0x0}, - 944: {region: 0x165, script: 0x5a, flags: 0x0}, - 945: {region: 0x99, script: 0x12, flags: 0x0}, - 946: {region: 0xa4, script: 0x5a, flags: 0x0}, - 947: {region: 0xe9, script: 0x5a, flags: 0x0}, - 948: {region: 0x165, script: 0x5a, flags: 0x0}, - 949: {region: 0x9e, script: 0x5a, flags: 0x0}, - 950: {region: 0x165, script: 0x5a, flags: 0x0}, - 951: {region: 0x165, script: 0x5a, flags: 0x0}, - 952: {region: 0x87, script: 0x34, flags: 0x0}, - 953: {region: 0x75, script: 0x5a, flags: 0x0}, - 954: {region: 0x165, script: 0x5a, flags: 0x0}, - 955: {region: 0xe8, script: 0x4d, flags: 0x0}, - 956: {region: 0x9c, script: 0x5, flags: 0x0}, - 957: {region: 0x1, script: 0x5a, flags: 0x0}, + 928: {region: 0xe8, script: 0x5b, flags: 0x0}, + 929: {region: 0x30, script: 0x5b, flags: 0x0}, + 930: {region: 0xf1, script: 0x5b, flags: 0x0}, + 931: {region: 0x166, script: 0x5b, flags: 0x0}, + 932: {region: 0x79, script: 0x5b, flags: 0x0}, + 933: {region: 0xd7, script: 0x5b, flags: 0x0}, + 934: {region: 0x136, script: 0x5b, flags: 0x0}, + 935: {region: 0x49, script: 0x5b, flags: 0x0}, + 936: {region: 0x166, script: 0x5b, flags: 0x0}, + 937: {region: 0x9d, script: 0xfa, flags: 0x0}, + 938: {region: 0x166, script: 0x5b, flags: 0x0}, + 939: {region: 0x61, script: 0x5b, flags: 0x0}, + 940: {region: 0x166, script: 0x5, flags: 0x0}, + 941: {region: 0xb1, script: 0x90, flags: 0x0}, + 943: {region: 0x166, script: 0x5b, flags: 0x0}, + 944: {region: 0x166, script: 0x5b, flags: 0x0}, + 945: {region: 0x9a, script: 0x12, flags: 0x0}, + 946: {region: 0xa5, script: 0x5b, flags: 0x0}, + 947: {region: 0xea, script: 0x5b, flags: 0x0}, + 948: {region: 0x166, script: 0x5b, flags: 0x0}, + 949: {region: 0x9f, script: 0x5b, flags: 0x0}, + 950: {region: 0x166, script: 0x5b, flags: 0x0}, + 951: {region: 0x166, script: 0x5b, flags: 0x0}, + 952: {region: 0x88, script: 0x34, flags: 0x0}, + 953: {region: 0x76, script: 0x5b, flags: 0x0}, + 954: {region: 0x166, script: 0x5b, flags: 0x0}, + 955: {region: 0xe9, script: 0x4e, flags: 0x0}, + 956: {region: 0x9d, script: 0x5, flags: 0x0}, + 957: {region: 0x1, script: 0x5b, flags: 0x0}, 958: {region: 0x24, script: 0x5, flags: 0x0}, - 959: {region: 0x165, script: 0x5a, flags: 0x0}, - 960: {region: 0x41, script: 0x5a, flags: 0x0}, - 961: {region: 0x165, script: 0x5a, flags: 0x0}, - 962: {region: 0x7a, script: 0x5a, flags: 0x0}, - 963: {region: 0x165, script: 0x5a, flags: 0x0}, - 964: {region: 0xe4, script: 0x5a, flags: 0x0}, - 965: {region: 0x89, script: 0x5a, flags: 0x0}, - 966: {region: 0x69, script: 0x5a, flags: 0x0}, - 967: {region: 0x165, script: 0x5a, flags: 0x0}, - 968: {region: 0x99, script: 0x22, flags: 0x0}, - 969: {region: 0x165, script: 0x5a, flags: 0x0}, - 970: {region: 0x102, script: 0x5a, flags: 0x0}, - 971: {region: 0x95, script: 0x5a, flags: 0x0}, - 972: {region: 0x165, script: 0x5a, flags: 0x0}, - 973: {region: 0x165, script: 0x5a, flags: 0x0}, - 974: {region: 0x9e, script: 0x5a, flags: 0x0}, - 975: {region: 0x165, script: 0x5, flags: 0x0}, - 976: {region: 0x99, script: 0x5a, flags: 0x0}, + 959: {region: 0x166, script: 0x5b, flags: 0x0}, + 960: {region: 0x41, script: 0x5b, flags: 0x0}, + 961: {region: 0x166, script: 0x5b, flags: 0x0}, + 962: {region: 0x7b, script: 0x5b, flags: 0x0}, + 963: {region: 0x166, script: 0x5b, flags: 0x0}, + 964: {region: 0xe5, script: 0x5b, flags: 0x0}, + 965: {region: 0x8a, script: 0x5b, flags: 0x0}, + 966: {region: 0x6a, script: 0x5b, flags: 0x0}, + 967: {region: 0x166, script: 0x5b, flags: 0x0}, + 968: {region: 0x9a, script: 0x22, flags: 0x0}, + 969: {region: 0x166, script: 0x5b, flags: 0x0}, + 970: {region: 0x103, script: 0x5b, flags: 0x0}, + 971: {region: 0x96, script: 0x5b, flags: 0x0}, + 972: {region: 0x166, script: 0x5b, flags: 0x0}, + 973: {region: 0x166, script: 0x5b, flags: 0x0}, + 974: {region: 0x9f, script: 0x5b, flags: 0x0}, + 975: {region: 0x166, script: 0x5, flags: 0x0}, + 976: {region: 0x9a, script: 0x5b, flags: 0x0}, 977: {region: 0x31, script: 0x2, flags: 0x1}, - 978: {region: 0xdb, script: 0x22, flags: 0x0}, + 978: {region: 0xdc, script: 0x22, flags: 0x0}, 979: {region: 0x35, script: 0xe, flags: 0x0}, - 980: {region: 0x4e, script: 0x5a, flags: 0x0}, - 981: {region: 0x72, script: 0x5a, flags: 0x0}, - 982: {region: 0x4e, script: 0x5a, flags: 0x0}, - 983: {region: 0x9c, script: 0x5, flags: 0x0}, - 984: {region: 0x10c, script: 0x5a, flags: 0x0}, - 985: {region: 0x3a, script: 0x5a, flags: 0x0}, - 986: {region: 0x165, script: 0x5a, flags: 0x0}, - 987: {region: 0xd1, script: 0x5a, flags: 0x0}, - 988: {region: 0x104, script: 0x5a, flags: 0x0}, - 989: {region: 0x95, script: 0x5a, flags: 0x0}, - 990: {region: 0x12f, script: 0x5a, flags: 0x0}, - 991: {region: 0x165, script: 0x5a, flags: 0x0}, - 992: {region: 0x165, script: 0x5a, flags: 0x0}, - 993: {region: 0x73, script: 0x5a, flags: 0x0}, - 994: {region: 0x106, script: 0x20, flags: 0x0}, - 995: {region: 0x130, script: 0x20, flags: 0x0}, - 996: {region: 0x109, script: 0x5a, flags: 0x0}, - 997: {region: 0x107, script: 0x5a, flags: 0x0}, - 998: {region: 0x12f, script: 0x5a, flags: 0x0}, - 999: {region: 0x165, script: 0x5a, flags: 0x0}, - 1000: {region: 0xa2, script: 0x4c, flags: 0x0}, - 1001: {region: 0x99, script: 0x22, flags: 0x0}, - 1002: {region: 0x80, script: 0x5a, flags: 0x0}, - 1003: {region: 0x106, script: 0x20, flags: 0x0}, - 1004: {region: 0xa4, script: 0x5a, flags: 0x0}, - 1005: {region: 0x95, script: 0x5a, flags: 0x0}, - 1006: {region: 0x99, script: 0x5a, flags: 0x0}, - 1007: {region: 0x114, script: 0x5a, flags: 0x0}, - 1008: {region: 0x99, script: 0xcd, flags: 0x0}, - 1009: {region: 0x165, script: 0x5a, flags: 0x0}, - 1010: {region: 0x165, script: 0x5a, flags: 0x0}, - 1011: {region: 0x12f, script: 0x5a, flags: 0x0}, - 1012: {region: 0x9e, script: 0x5a, flags: 0x0}, - 1013: {region: 0x99, script: 0x22, flags: 0x0}, - 1014: {region: 0x165, script: 0x5, flags: 0x0}, - 1015: {region: 0x9e, script: 0x5a, flags: 0x0}, - 1016: {region: 0x7b, script: 0x5a, flags: 0x0}, - 1017: {region: 0x49, script: 0x5a, flags: 0x0}, + 980: {region: 0x4e, script: 0x5b, flags: 0x0}, + 981: {region: 0x73, script: 0x5b, flags: 0x0}, + 982: {region: 0x4e, script: 0x5b, flags: 0x0}, + 983: {region: 0x9d, script: 0x5, flags: 0x0}, + 984: {region: 0x10d, script: 0x5b, flags: 0x0}, + 985: {region: 0x3a, script: 0x5b, flags: 0x0}, + 986: {region: 0x166, script: 0x5b, flags: 0x0}, + 987: {region: 0xd2, script: 0x5b, flags: 0x0}, + 988: {region: 0x105, script: 0x5b, flags: 0x0}, + 989: {region: 0x96, script: 0x5b, flags: 0x0}, + 990: {region: 0x130, script: 0x5b, flags: 0x0}, + 991: {region: 0x166, script: 0x5b, flags: 0x0}, + 992: {region: 0x166, script: 0x5b, flags: 0x0}, + 993: {region: 0x74, script: 0x5b, flags: 0x0}, + 994: {region: 0x107, script: 0x20, flags: 0x0}, + 995: {region: 0x131, script: 0x20, flags: 0x0}, + 996: {region: 0x10a, script: 0x5b, flags: 0x0}, + 997: {region: 0x108, script: 0x5b, flags: 0x0}, + 998: {region: 0x130, script: 0x5b, flags: 0x0}, + 999: {region: 0x166, script: 0x5b, flags: 0x0}, + 1000: {region: 0xa3, script: 0x4c, flags: 0x0}, + 1001: {region: 0x9a, script: 0x22, flags: 0x0}, + 1002: {region: 0x81, script: 0x5b, flags: 0x0}, + 1003: {region: 0x107, script: 0x20, flags: 0x0}, + 1004: {region: 0xa5, script: 0x5b, flags: 0x0}, + 1005: {region: 0x96, script: 0x5b, flags: 0x0}, + 1006: {region: 0x9a, script: 0x5b, flags: 0x0}, + 1007: {region: 0x115, script: 0x5b, flags: 0x0}, + 1008: {region: 0x9a, script: 0xcf, flags: 0x0}, + 1009: {region: 0x166, script: 0x5b, flags: 0x0}, + 1010: {region: 0x166, script: 0x5b, flags: 0x0}, + 1011: {region: 0x130, script: 0x5b, flags: 0x0}, + 1012: {region: 0x9f, script: 0x5b, flags: 0x0}, + 1013: {region: 0x9a, script: 0x22, flags: 0x0}, + 1014: {region: 0x166, script: 0x5, flags: 0x0}, + 1015: {region: 0x9f, script: 0x5b, flags: 0x0}, + 1016: {region: 0x7c, script: 0x5b, flags: 0x0}, + 1017: {region: 0x49, script: 0x5b, flags: 0x0}, 1018: {region: 0x33, script: 0x4, flags: 0x1}, - 1019: {region: 0x9e, script: 0x5a, flags: 0x0}, - 1020: {region: 0x9c, script: 0x5, flags: 0x0}, - 1021: {region: 0xda, script: 0x5a, flags: 0x0}, - 1022: {region: 0x4f, script: 0x5a, flags: 0x0}, - 1023: {region: 0xd1, script: 0x5a, flags: 0x0}, - 1024: {region: 0xcf, script: 0x5a, flags: 0x0}, - 1025: {region: 0xc3, script: 0x5a, flags: 0x0}, - 1026: {region: 0x4c, script: 0x5a, flags: 0x0}, - 1027: {region: 0x96, script: 0x7e, flags: 0x0}, - 1028: {region: 0xb6, script: 0x5a, flags: 0x0}, - 1029: {region: 0x165, script: 0x2c, flags: 0x0}, - 1030: {region: 0x165, script: 0x5a, flags: 0x0}, - 1032: {region: 0xba, script: 0xe8, flags: 0x0}, - 1033: {region: 0x165, script: 0x5a, flags: 0x0}, - 1034: {region: 0xc4, script: 0x75, flags: 0x0}, - 1035: {region: 0x165, script: 0x5, flags: 0x0}, - 1036: {region: 0xb3, script: 0xd4, flags: 0x0}, - 1037: {region: 0x6f, script: 0x5a, flags: 0x0}, - 1038: {region: 0x165, script: 0x5a, flags: 0x0}, - 1039: {region: 0x165, script: 0x5a, flags: 0x0}, - 1040: {region: 0x165, script: 0x5a, flags: 0x0}, - 1041: {region: 0x165, script: 0x5a, flags: 0x0}, - 1042: {region: 0x111, script: 0x5a, flags: 0x0}, - 1043: {region: 0x165, script: 0x5a, flags: 0x0}, - 1044: {region: 0xe8, script: 0x5, flags: 0x0}, - 1045: {region: 0x165, script: 0x5a, flags: 0x0}, - 1046: {region: 0x10f, script: 0x5a, flags: 0x0}, - 1047: {region: 0x165, script: 0x5a, flags: 0x0}, - 1048: {region: 0xe9, script: 0x5a, flags: 0x0}, - 1049: {region: 0x165, script: 0x5a, flags: 0x0}, - 1050: {region: 0x95, script: 0x5a, flags: 0x0}, - 1051: {region: 0x142, script: 0x5a, flags: 0x0}, - 1052: {region: 0x10c, script: 0x5a, flags: 0x0}, - 1054: {region: 0x10c, script: 0x5a, flags: 0x0}, - 1055: {region: 0x72, script: 0x5a, flags: 0x0}, - 1056: {region: 0x97, script: 0xca, flags: 0x0}, - 1057: {region: 0x165, script: 0x5a, flags: 0x0}, - 1058: {region: 0x72, script: 0x5a, flags: 0x0}, - 1059: {region: 0x164, script: 0x5a, flags: 0x0}, - 1060: {region: 0x165, script: 0x5a, flags: 0x0}, - 1061: {region: 0xc3, script: 0x5a, flags: 0x0}, - 1062: {region: 0x165, script: 0x5a, flags: 0x0}, - 1063: {region: 0x165, script: 0x5a, flags: 0x0}, - 1064: {region: 0x165, script: 0x5a, flags: 0x0}, - 1065: {region: 0x115, script: 0x5a, flags: 0x0}, - 1066: {region: 0x165, script: 0x5a, flags: 0x0}, - 1067: {region: 0x165, script: 0x5a, flags: 0x0}, - 1068: {region: 0x123, script: 0xeb, flags: 0x0}, - 1069: {region: 0x165, script: 0x5a, flags: 0x0}, - 1070: {region: 0x165, script: 0x5a, flags: 0x0}, - 1071: {region: 0x165, script: 0x5a, flags: 0x0}, - 1072: {region: 0x165, script: 0x5a, flags: 0x0}, - 1073: {region: 0x27, script: 0x5a, flags: 0x0}, + 1019: {region: 0x9f, script: 0x5b, flags: 0x0}, + 1020: {region: 0x9d, script: 0x5, flags: 0x0}, + 1021: {region: 0xdb, script: 0x5b, flags: 0x0}, + 1022: {region: 0x4f, script: 0x5b, flags: 0x0}, + 1023: {region: 0xd2, script: 0x5b, flags: 0x0}, + 1024: {region: 0xd0, script: 0x5b, flags: 0x0}, + 1025: {region: 0xc4, script: 0x5b, flags: 0x0}, + 1026: {region: 0x4c, script: 0x5b, flags: 0x0}, + 1027: {region: 0x97, script: 0x80, flags: 0x0}, + 1028: {region: 0xb7, script: 0x5b, flags: 0x0}, + 1029: {region: 0x166, script: 0x2c, flags: 0x0}, + 1030: {region: 0x166, script: 0x5b, flags: 0x0}, + 1032: {region: 0xbb, script: 0xeb, flags: 0x0}, + 1033: {region: 0x166, script: 0x5b, flags: 0x0}, + 1034: {region: 0xc5, script: 0x76, flags: 0x0}, + 1035: {region: 0x166, script: 0x5, flags: 0x0}, + 1036: {region: 0xb4, script: 0xd6, flags: 0x0}, + 1037: {region: 0x70, script: 0x5b, flags: 0x0}, + 1038: {region: 0x166, script: 0x5b, flags: 0x0}, + 1039: {region: 0x166, script: 0x5b, flags: 0x0}, + 1040: {region: 0x166, script: 0x5b, flags: 0x0}, + 1041: {region: 0x166, script: 0x5b, flags: 0x0}, + 1042: {region: 0x112, script: 0x5b, flags: 0x0}, + 1043: {region: 0x166, script: 0x5b, flags: 0x0}, + 1044: {region: 0xe9, script: 0x5, flags: 0x0}, + 1045: {region: 0x166, script: 0x5b, flags: 0x0}, + 1046: {region: 0x110, script: 0x5b, flags: 0x0}, + 1047: {region: 0x166, script: 0x5b, flags: 0x0}, + 1048: {region: 0xea, script: 0x5b, flags: 0x0}, + 1049: {region: 0x166, script: 0x5b, flags: 0x0}, + 1050: {region: 0x96, script: 0x5b, flags: 0x0}, + 1051: {region: 0x143, script: 0x5b, flags: 0x0}, + 1052: {region: 0x10d, script: 0x5b, flags: 0x0}, + 1054: {region: 0x10d, script: 0x5b, flags: 0x0}, + 1055: {region: 0x73, script: 0x5b, flags: 0x0}, + 1056: {region: 0x98, script: 0xcc, flags: 0x0}, + 1057: {region: 0x166, script: 0x5b, flags: 0x0}, + 1058: {region: 0x73, script: 0x5b, flags: 0x0}, + 1059: {region: 0x165, script: 0x5b, flags: 0x0}, + 1060: {region: 0x166, script: 0x5b, flags: 0x0}, + 1061: {region: 0xc4, script: 0x5b, flags: 0x0}, + 1062: {region: 0x166, script: 0x5b, flags: 0x0}, + 1063: {region: 0x166, script: 0x5b, flags: 0x0}, + 1064: {region: 0x166, script: 0x5b, flags: 0x0}, + 1065: {region: 0x116, script: 0x5b, flags: 0x0}, + 1066: {region: 0x166, script: 0x5b, flags: 0x0}, + 1067: {region: 0x166, script: 0x5b, flags: 0x0}, + 1068: {region: 0x124, script: 0xee, flags: 0x0}, + 1069: {region: 0x166, script: 0x5b, flags: 0x0}, + 1070: {region: 0x166, script: 0x5b, flags: 0x0}, + 1071: {region: 0x166, script: 0x5b, flags: 0x0}, + 1072: {region: 0x166, script: 0x5b, flags: 0x0}, + 1073: {region: 0x27, script: 0x5b, flags: 0x0}, 1074: {region: 0x37, script: 0x5, flags: 0x1}, - 1075: {region: 0x99, script: 0xd7, flags: 0x0}, - 1076: {region: 0x116, script: 0x5a, flags: 0x0}, - 1077: {region: 0x114, script: 0x5a, flags: 0x0}, - 1078: {region: 0x99, script: 0x22, flags: 0x0}, - 1079: {region: 0x161, script: 0x5a, flags: 0x0}, - 1080: {region: 0x165, script: 0x5a, flags: 0x0}, - 1081: {region: 0x165, script: 0x5a, flags: 0x0}, - 1082: {region: 0x6d, script: 0x5a, flags: 0x0}, - 1083: {region: 0x161, script: 0x5a, flags: 0x0}, - 1084: {region: 0x165, script: 0x5a, flags: 0x0}, - 1085: {region: 0x60, script: 0x5a, flags: 0x0}, - 1086: {region: 0x95, script: 0x5a, flags: 0x0}, - 1087: {region: 0x165, script: 0x5a, flags: 0x0}, - 1088: {region: 0x165, script: 0x5a, flags: 0x0}, - 1089: {region: 0x12f, script: 0x5a, flags: 0x0}, - 1090: {region: 0x165, script: 0x5a, flags: 0x0}, - 1091: {region: 0x84, script: 0x5a, flags: 0x0}, - 1092: {region: 0x10c, script: 0x5a, flags: 0x0}, - 1093: {region: 0x12f, script: 0x5a, flags: 0x0}, - 1094: {region: 0x15f, script: 0x5, flags: 0x0}, - 1095: {region: 0x4b, script: 0x5a, flags: 0x0}, - 1096: {region: 0x60, script: 0x5a, flags: 0x0}, - 1097: {region: 0x165, script: 0x5a, flags: 0x0}, - 1098: {region: 0x99, script: 0x22, flags: 0x0}, - 1099: {region: 0x95, script: 0x5a, flags: 0x0}, - 1100: {region: 0x165, script: 0x5a, flags: 0x0}, + 1075: {region: 0x9a, script: 0xd9, flags: 0x0}, + 1076: {region: 0x117, script: 0x5b, flags: 0x0}, + 1077: {region: 0x115, script: 0x5b, flags: 0x0}, + 1078: {region: 0x9a, script: 0x22, flags: 0x0}, + 1079: {region: 0x162, script: 0x5b, flags: 0x0}, + 1080: {region: 0x166, script: 0x5b, flags: 0x0}, + 1081: {region: 0x166, script: 0x5b, flags: 0x0}, + 1082: {region: 0x6e, script: 0x5b, flags: 0x0}, + 1083: {region: 0x162, script: 0x5b, flags: 0x0}, + 1084: {region: 0x166, script: 0x5b, flags: 0x0}, + 1085: {region: 0x61, script: 0x5b, flags: 0x0}, + 1086: {region: 0x96, script: 0x5b, flags: 0x0}, + 1087: {region: 0x166, script: 0x5b, flags: 0x0}, + 1088: {region: 0x166, script: 0x5b, flags: 0x0}, + 1089: {region: 0x130, script: 0x5b, flags: 0x0}, + 1090: {region: 0x166, script: 0x5b, flags: 0x0}, + 1091: {region: 0x85, script: 0x5b, flags: 0x0}, + 1092: {region: 0x10d, script: 0x5b, flags: 0x0}, + 1093: {region: 0x130, script: 0x5b, flags: 0x0}, + 1094: {region: 0x160, script: 0x5, flags: 0x0}, + 1095: {region: 0x4b, script: 0x5b, flags: 0x0}, + 1096: {region: 0x61, script: 0x5b, flags: 0x0}, + 1097: {region: 0x166, script: 0x5b, flags: 0x0}, + 1098: {region: 0x9a, script: 0x22, flags: 0x0}, + 1099: {region: 0x96, script: 0x5b, flags: 0x0}, + 1100: {region: 0x166, script: 0x5b, flags: 0x0}, 1101: {region: 0x35, script: 0xe, flags: 0x0}, - 1102: {region: 0x9b, script: 0xdb, flags: 0x0}, - 1103: {region: 0xe9, script: 0x5a, flags: 0x0}, - 1104: {region: 0x99, script: 0xe3, flags: 0x0}, - 1105: {region: 0xdb, script: 0x22, flags: 0x0}, - 1106: {region: 0x165, script: 0x5a, flags: 0x0}, - 1107: {region: 0x165, script: 0x5a, flags: 0x0}, - 1108: {region: 0x165, script: 0x5a, flags: 0x0}, - 1109: {region: 0x165, script: 0x5a, flags: 0x0}, - 1110: {region: 0x165, script: 0x5a, flags: 0x0}, - 1111: {region: 0x165, script: 0x5a, flags: 0x0}, - 1112: {region: 0x165, script: 0x5a, flags: 0x0}, - 1113: {region: 0x165, script: 0x5a, flags: 0x0}, - 1114: {region: 0xe7, script: 0x5a, flags: 0x0}, - 1115: {region: 0x165, script: 0x5a, flags: 0x0}, - 1116: {region: 0x165, script: 0x5a, flags: 0x0}, - 1117: {region: 0x99, script: 0x52, flags: 0x0}, - 1118: {region: 0x53, script: 0xe1, flags: 0x0}, - 1119: {region: 0xdb, script: 0x22, flags: 0x0}, - 1120: {region: 0xdb, script: 0x22, flags: 0x0}, - 1121: {region: 0x99, script: 0xe6, flags: 0x0}, - 1122: {region: 0x165, script: 0x5a, flags: 0x0}, - 1123: {region: 0x112, script: 0x5a, flags: 0x0}, - 1124: {region: 0x131, script: 0x5a, flags: 0x0}, - 1125: {region: 0x126, script: 0x5a, flags: 0x0}, - 1126: {region: 0x165, script: 0x5a, flags: 0x0}, + 1102: {region: 0x9c, script: 0xde, flags: 0x0}, + 1103: {region: 0xea, script: 0x5b, flags: 0x0}, + 1104: {region: 0x9a, script: 0xe6, flags: 0x0}, + 1105: {region: 0xdc, script: 0x22, flags: 0x0}, + 1106: {region: 0x166, script: 0x5b, flags: 0x0}, + 1107: {region: 0x166, script: 0x5b, flags: 0x0}, + 1108: {region: 0x166, script: 0x5b, flags: 0x0}, + 1109: {region: 0x166, script: 0x5b, flags: 0x0}, + 1110: {region: 0x166, script: 0x5b, flags: 0x0}, + 1111: {region: 0x166, script: 0x5b, flags: 0x0}, + 1112: {region: 0x166, script: 0x5b, flags: 0x0}, + 1113: {region: 0x166, script: 0x5b, flags: 0x0}, + 1114: {region: 0xe8, script: 0x5b, flags: 0x0}, + 1115: {region: 0x166, script: 0x5b, flags: 0x0}, + 1116: {region: 0x166, script: 0x5b, flags: 0x0}, + 1117: {region: 0x9a, script: 0x53, flags: 0x0}, + 1118: {region: 0x53, script: 0xe4, flags: 0x0}, + 1119: {region: 0xdc, script: 0x22, flags: 0x0}, + 1120: {region: 0xdc, script: 0x22, flags: 0x0}, + 1121: {region: 0x9a, script: 0xe9, flags: 0x0}, + 1122: {region: 0x166, script: 0x5b, flags: 0x0}, + 1123: {region: 0x113, script: 0x5b, flags: 0x0}, + 1124: {region: 0x132, script: 0x5b, flags: 0x0}, + 1125: {region: 0x127, script: 0x5b, flags: 0x0}, + 1126: {region: 0x166, script: 0x5b, flags: 0x0}, 1127: {region: 0x3c, script: 0x3, flags: 0x1}, - 1128: {region: 0x165, script: 0x5a, flags: 0x0}, - 1129: {region: 0x165, script: 0x5a, flags: 0x0}, - 1130: {region: 0x165, script: 0x5a, flags: 0x0}, - 1131: {region: 0x123, script: 0xeb, flags: 0x0}, - 1132: {region: 0xdb, script: 0x22, flags: 0x0}, - 1133: {region: 0xdb, script: 0x22, flags: 0x0}, - 1134: {region: 0xdb, script: 0x22, flags: 0x0}, - 1135: {region: 0x6f, script: 0x2c, flags: 0x0}, - 1136: {region: 0x165, script: 0x5a, flags: 0x0}, - 1137: {region: 0x6d, script: 0x2c, flags: 0x0}, - 1138: {region: 0x165, script: 0x5a, flags: 0x0}, - 1139: {region: 0x165, script: 0x5a, flags: 0x0}, - 1140: {region: 0x165, script: 0x5a, flags: 0x0}, - 1141: {region: 0xd6, script: 0x5a, flags: 0x0}, - 1142: {region: 0x127, script: 0x5a, flags: 0x0}, - 1143: {region: 0x125, script: 0x5a, flags: 0x0}, - 1144: {region: 0x32, script: 0x5a, flags: 0x0}, - 1145: {region: 0xdb, script: 0x22, flags: 0x0}, - 1146: {region: 0xe7, script: 0x5a, flags: 0x0}, - 1147: {region: 0x165, script: 0x5a, flags: 0x0}, - 1148: {region: 0x165, script: 0x5a, flags: 0x0}, - 1149: {region: 0x32, script: 0x5a, flags: 0x0}, - 1150: {region: 0xd4, script: 0x5a, flags: 0x0}, - 1151: {region: 0x165, script: 0x5a, flags: 0x0}, - 1152: {region: 0x161, script: 0x5a, flags: 0x0}, - 1153: {region: 0x165, script: 0x5a, flags: 0x0}, - 1154: {region: 0x129, script: 0x5a, flags: 0x0}, - 1155: {region: 0x165, script: 0x5a, flags: 0x0}, - 1156: {region: 0xce, script: 0x5a, flags: 0x0}, - 1157: {region: 0x165, script: 0x5a, flags: 0x0}, - 1158: {region: 0xe6, script: 0x5a, flags: 0x0}, - 1159: {region: 0x165, script: 0x5a, flags: 0x0}, - 1160: {region: 0x165, script: 0x5a, flags: 0x0}, - 1161: {region: 0x165, script: 0x5a, flags: 0x0}, - 1162: {region: 0x12b, script: 0x5a, flags: 0x0}, - 1163: {region: 0x12b, script: 0x5a, flags: 0x0}, - 1164: {region: 0x12e, script: 0x5a, flags: 0x0}, - 1165: {region: 0x165, script: 0x5, flags: 0x0}, - 1166: {region: 0x161, script: 0x5a, flags: 0x0}, - 1167: {region: 0x87, script: 0x34, flags: 0x0}, - 1168: {region: 0xdb, script: 0x22, flags: 0x0}, - 1169: {region: 0xe7, script: 0x5a, flags: 0x0}, - 1170: {region: 0x43, script: 0xec, flags: 0x0}, - 1171: {region: 0x165, script: 0x5a, flags: 0x0}, - 1172: {region: 0x106, script: 0x20, flags: 0x0}, - 1173: {region: 0x165, script: 0x5a, flags: 0x0}, - 1174: {region: 0x165, script: 0x5a, flags: 0x0}, - 1175: {region: 0x131, script: 0x5a, flags: 0x0}, - 1176: {region: 0x165, script: 0x5a, flags: 0x0}, - 1177: {region: 0x123, script: 0xeb, flags: 0x0}, - 1178: {region: 0x32, script: 0x5a, flags: 0x0}, - 1179: {region: 0x165, script: 0x5a, flags: 0x0}, - 1180: {region: 0x165, script: 0x5a, flags: 0x0}, - 1181: {region: 0xce, script: 0x5a, flags: 0x0}, - 1182: {region: 0x165, script: 0x5a, flags: 0x0}, - 1183: {region: 0x165, script: 0x5a, flags: 0x0}, - 1184: {region: 0x12d, script: 0x5a, flags: 0x0}, - 1185: {region: 0x165, script: 0x5a, flags: 0x0}, - 1187: {region: 0x165, script: 0x5a, flags: 0x0}, - 1188: {region: 0xd4, script: 0x5a, flags: 0x0}, - 1189: {region: 0x53, script: 0xe4, flags: 0x0}, - 1190: {region: 0xe5, script: 0x5a, flags: 0x0}, - 1191: {region: 0x165, script: 0x5a, flags: 0x0}, - 1192: {region: 0x106, script: 0x20, flags: 0x0}, - 1193: {region: 0xba, script: 0x5a, flags: 0x0}, - 1194: {region: 0x165, script: 0x5a, flags: 0x0}, - 1195: {region: 0x106, script: 0x20, flags: 0x0}, + 1128: {region: 0x166, script: 0x5b, flags: 0x0}, + 1129: {region: 0x166, script: 0x5b, flags: 0x0}, + 1130: {region: 0x166, script: 0x5b, flags: 0x0}, + 1131: {region: 0x124, script: 0xee, flags: 0x0}, + 1132: {region: 0xdc, script: 0x22, flags: 0x0}, + 1133: {region: 0xdc, script: 0x22, flags: 0x0}, + 1134: {region: 0xdc, script: 0x22, flags: 0x0}, + 1135: {region: 0x70, script: 0x2c, flags: 0x0}, + 1136: {region: 0x166, script: 0x5b, flags: 0x0}, + 1137: {region: 0x6e, script: 0x2c, flags: 0x0}, + 1138: {region: 0x166, script: 0x5b, flags: 0x0}, + 1139: {region: 0x166, script: 0x5b, flags: 0x0}, + 1140: {region: 0x166, script: 0x5b, flags: 0x0}, + 1141: {region: 0xd7, script: 0x5b, flags: 0x0}, + 1142: {region: 0x128, script: 0x5b, flags: 0x0}, + 1143: {region: 0x126, script: 0x5b, flags: 0x0}, + 1144: {region: 0x32, script: 0x5b, flags: 0x0}, + 1145: {region: 0xdc, script: 0x22, flags: 0x0}, + 1146: {region: 0xe8, script: 0x5b, flags: 0x0}, + 1147: {region: 0x166, script: 0x5b, flags: 0x0}, + 1148: {region: 0x166, script: 0x5b, flags: 0x0}, + 1149: {region: 0x32, script: 0x5b, flags: 0x0}, + 1150: {region: 0xd5, script: 0x5b, flags: 0x0}, + 1151: {region: 0x166, script: 0x5b, flags: 0x0}, + 1152: {region: 0x162, script: 0x5b, flags: 0x0}, + 1153: {region: 0x166, script: 0x5b, flags: 0x0}, + 1154: {region: 0x12a, script: 0x5b, flags: 0x0}, + 1155: {region: 0x166, script: 0x5b, flags: 0x0}, + 1156: {region: 0xcf, script: 0x5b, flags: 0x0}, + 1157: {region: 0x166, script: 0x5b, flags: 0x0}, + 1158: {region: 0xe7, script: 0x5b, flags: 0x0}, + 1159: {region: 0x166, script: 0x5b, flags: 0x0}, + 1160: {region: 0x166, script: 0x5b, flags: 0x0}, + 1161: {region: 0x166, script: 0x5b, flags: 0x0}, + 1162: {region: 0x12c, script: 0x5b, flags: 0x0}, + 1163: {region: 0x12c, script: 0x5b, flags: 0x0}, + 1164: {region: 0x12f, script: 0x5b, flags: 0x0}, + 1165: {region: 0x166, script: 0x5, flags: 0x0}, + 1166: {region: 0x162, script: 0x5b, flags: 0x0}, + 1167: {region: 0x88, script: 0x34, flags: 0x0}, + 1168: {region: 0xdc, script: 0x22, flags: 0x0}, + 1169: {region: 0xe8, script: 0x5b, flags: 0x0}, + 1170: {region: 0x43, script: 0xef, flags: 0x0}, + 1171: {region: 0x166, script: 0x5b, flags: 0x0}, + 1172: {region: 0x107, script: 0x20, flags: 0x0}, + 1173: {region: 0x166, script: 0x5b, flags: 0x0}, + 1174: {region: 0x166, script: 0x5b, flags: 0x0}, + 1175: {region: 0x132, script: 0x5b, flags: 0x0}, + 1176: {region: 0x166, script: 0x5b, flags: 0x0}, + 1177: {region: 0x124, script: 0xee, flags: 0x0}, + 1178: {region: 0x32, script: 0x5b, flags: 0x0}, + 1179: {region: 0x166, script: 0x5b, flags: 0x0}, + 1180: {region: 0x166, script: 0x5b, flags: 0x0}, + 1181: {region: 0xcf, script: 0x5b, flags: 0x0}, + 1182: {region: 0x166, script: 0x5b, flags: 0x0}, + 1183: {region: 0x166, script: 0x5b, flags: 0x0}, + 1184: {region: 0x12e, script: 0x5b, flags: 0x0}, + 1185: {region: 0x166, script: 0x5b, flags: 0x0}, + 1187: {region: 0x166, script: 0x5b, flags: 0x0}, + 1188: {region: 0xd5, script: 0x5b, flags: 0x0}, + 1189: {region: 0x53, script: 0xe7, flags: 0x0}, + 1190: {region: 0xe6, script: 0x5b, flags: 0x0}, + 1191: {region: 0x166, script: 0x5b, flags: 0x0}, + 1192: {region: 0x107, script: 0x20, flags: 0x0}, + 1193: {region: 0xbb, script: 0x5b, flags: 0x0}, + 1194: {region: 0x166, script: 0x5b, flags: 0x0}, + 1195: {region: 0x107, script: 0x20, flags: 0x0}, 1196: {region: 0x3f, script: 0x4, flags: 0x1}, - 1197: {region: 0x11c, script: 0xf0, flags: 0x0}, - 1198: {region: 0x130, script: 0x20, flags: 0x0}, - 1199: {region: 0x75, script: 0x5a, flags: 0x0}, - 1200: {region: 0x2a, script: 0x5a, flags: 0x0}, + 1197: {region: 0x11d, script: 0xf3, flags: 0x0}, + 1198: {region: 0x131, script: 0x20, flags: 0x0}, + 1199: {region: 0x76, script: 0x5b, flags: 0x0}, + 1200: {region: 0x2a, script: 0x5b, flags: 0x0}, 1202: {region: 0x43, script: 0x3, flags: 0x1}, - 1203: {region: 0x99, script: 0xe, flags: 0x0}, - 1204: {region: 0xe8, script: 0x5, flags: 0x0}, - 1205: {region: 0x165, script: 0x5a, flags: 0x0}, - 1206: {region: 0x165, script: 0x5a, flags: 0x0}, - 1207: {region: 0x165, script: 0x5a, flags: 0x0}, - 1208: {region: 0x165, script: 0x5a, flags: 0x0}, - 1209: {region: 0x165, script: 0x5a, flags: 0x0}, - 1210: {region: 0x165, script: 0x5a, flags: 0x0}, - 1211: {region: 0x165, script: 0x5a, flags: 0x0}, + 1203: {region: 0x9a, script: 0xe, flags: 0x0}, + 1204: {region: 0xe9, script: 0x5, flags: 0x0}, + 1205: {region: 0x166, script: 0x5b, flags: 0x0}, + 1206: {region: 0x166, script: 0x5b, flags: 0x0}, + 1207: {region: 0x166, script: 0x5b, flags: 0x0}, + 1208: {region: 0x166, script: 0x5b, flags: 0x0}, + 1209: {region: 0x166, script: 0x5b, flags: 0x0}, + 1210: {region: 0x166, script: 0x5b, flags: 0x0}, + 1211: {region: 0x166, script: 0x5b, flags: 0x0}, 1212: {region: 0x46, script: 0x4, flags: 0x1}, - 1213: {region: 0x165, script: 0x5a, flags: 0x0}, - 1214: {region: 0xb4, script: 0xf1, flags: 0x0}, - 1215: {region: 0x165, script: 0x5a, flags: 0x0}, - 1216: {region: 0x161, script: 0x5a, flags: 0x0}, - 1217: {region: 0x9e, script: 0x5a, flags: 0x0}, - 1218: {region: 0x106, script: 0x5a, flags: 0x0}, - 1219: {region: 0x13e, script: 0x5a, flags: 0x0}, - 1220: {region: 0x11b, script: 0x5a, flags: 0x0}, - 1221: {region: 0x165, script: 0x5a, flags: 0x0}, - 1222: {region: 0x36, script: 0x5a, flags: 0x0}, - 1223: {region: 0x60, script: 0x5a, flags: 0x0}, - 1224: {region: 0xd1, script: 0x5a, flags: 0x0}, - 1225: {region: 0x1, script: 0x5a, flags: 0x0}, - 1226: {region: 0x106, script: 0x5a, flags: 0x0}, - 1227: {region: 0x6a, script: 0x5a, flags: 0x0}, - 1228: {region: 0x12f, script: 0x5a, flags: 0x0}, - 1229: {region: 0x165, script: 0x5a, flags: 0x0}, - 1230: {region: 0x36, script: 0x5a, flags: 0x0}, - 1231: {region: 0x4e, script: 0x5a, flags: 0x0}, - 1232: {region: 0x165, script: 0x5a, flags: 0x0}, - 1233: {region: 0x6f, script: 0x2c, flags: 0x0}, - 1234: {region: 0x165, script: 0x5a, flags: 0x0}, - 1235: {region: 0xe7, script: 0x5a, flags: 0x0}, - 1236: {region: 0x2f, script: 0x5a, flags: 0x0}, - 1237: {region: 0x99, script: 0xe6, flags: 0x0}, - 1238: {region: 0x99, script: 0x22, flags: 0x0}, - 1239: {region: 0x165, script: 0x5a, flags: 0x0}, - 1240: {region: 0x165, script: 0x5a, flags: 0x0}, - 1241: {region: 0x165, script: 0x5a, flags: 0x0}, - 1242: {region: 0x165, script: 0x5a, flags: 0x0}, - 1243: {region: 0x165, script: 0x5a, flags: 0x0}, - 1244: {region: 0x165, script: 0x5a, flags: 0x0}, - 1245: {region: 0x165, script: 0x5a, flags: 0x0}, - 1246: {region: 0x165, script: 0x5a, flags: 0x0}, - 1247: {region: 0x165, script: 0x5a, flags: 0x0}, - 1248: {region: 0x140, script: 0x5a, flags: 0x0}, - 1249: {region: 0x165, script: 0x5a, flags: 0x0}, - 1250: {region: 0x165, script: 0x5a, flags: 0x0}, - 1251: {region: 0xa8, script: 0x5, flags: 0x0}, - 1252: {region: 0x165, script: 0x5a, flags: 0x0}, - 1253: {region: 0x114, script: 0x5a, flags: 0x0}, - 1254: {region: 0x165, script: 0x5a, flags: 0x0}, - 1255: {region: 0x165, script: 0x5a, flags: 0x0}, - 1256: {region: 0x165, script: 0x5a, flags: 0x0}, - 1257: {region: 0x165, script: 0x5a, flags: 0x0}, - 1258: {region: 0x99, script: 0x22, flags: 0x0}, + 1213: {region: 0x166, script: 0x5b, flags: 0x0}, + 1214: {region: 0xb5, script: 0xf4, flags: 0x0}, + 1215: {region: 0x166, script: 0x5b, flags: 0x0}, + 1216: {region: 0x162, script: 0x5b, flags: 0x0}, + 1217: {region: 0x9f, script: 0x5b, flags: 0x0}, + 1218: {region: 0x107, script: 0x5b, flags: 0x0}, + 1219: {region: 0x13f, script: 0x5b, flags: 0x0}, + 1220: {region: 0x11c, script: 0x5b, flags: 0x0}, + 1221: {region: 0x166, script: 0x5b, flags: 0x0}, + 1222: {region: 0x36, script: 0x5b, flags: 0x0}, + 1223: {region: 0x61, script: 0x5b, flags: 0x0}, + 1224: {region: 0xd2, script: 0x5b, flags: 0x0}, + 1225: {region: 0x1, script: 0x5b, flags: 0x0}, + 1226: {region: 0x107, script: 0x5b, flags: 0x0}, + 1227: {region: 0x6b, script: 0x5b, flags: 0x0}, + 1228: {region: 0x130, script: 0x5b, flags: 0x0}, + 1229: {region: 0x166, script: 0x5b, flags: 0x0}, + 1230: {region: 0x36, script: 0x5b, flags: 0x0}, + 1231: {region: 0x4e, script: 0x5b, flags: 0x0}, + 1232: {region: 0x166, script: 0x5b, flags: 0x0}, + 1233: {region: 0x70, script: 0x2c, flags: 0x0}, + 1234: {region: 0x166, script: 0x5b, flags: 0x0}, + 1235: {region: 0xe8, script: 0x5b, flags: 0x0}, + 1236: {region: 0x2f, script: 0x5b, flags: 0x0}, + 1237: {region: 0x9a, script: 0xe9, flags: 0x0}, + 1238: {region: 0x9a, script: 0x22, flags: 0x0}, + 1239: {region: 0x166, script: 0x5b, flags: 0x0}, + 1240: {region: 0x166, script: 0x5b, flags: 0x0}, + 1241: {region: 0x166, script: 0x5b, flags: 0x0}, + 1242: {region: 0x166, script: 0x5b, flags: 0x0}, + 1243: {region: 0x166, script: 0x5b, flags: 0x0}, + 1244: {region: 0x166, script: 0x5b, flags: 0x0}, + 1245: {region: 0x166, script: 0x5b, flags: 0x0}, + 1246: {region: 0x166, script: 0x5b, flags: 0x0}, + 1247: {region: 0x166, script: 0x5b, flags: 0x0}, + 1248: {region: 0x141, script: 0x5b, flags: 0x0}, + 1249: {region: 0x166, script: 0x5b, flags: 0x0}, + 1250: {region: 0x166, script: 0x5b, flags: 0x0}, + 1251: {region: 0xa9, script: 0x5, flags: 0x0}, + 1252: {region: 0x166, script: 0x5b, flags: 0x0}, + 1253: {region: 0x115, script: 0x5b, flags: 0x0}, + 1254: {region: 0x166, script: 0x5b, flags: 0x0}, + 1255: {region: 0x166, script: 0x5b, flags: 0x0}, + 1256: {region: 0x166, script: 0x5b, flags: 0x0}, + 1257: {region: 0x166, script: 0x5b, flags: 0x0}, + 1258: {region: 0x9a, script: 0x22, flags: 0x0}, 1259: {region: 0x53, script: 0x3b, flags: 0x0}, - 1260: {region: 0x165, script: 0x5a, flags: 0x0}, - 1261: {region: 0x165, script: 0x5a, flags: 0x0}, - 1262: {region: 0x41, script: 0x5a, flags: 0x0}, - 1263: {region: 0x165, script: 0x5a, flags: 0x0}, - 1264: {region: 0x12b, script: 0x18, flags: 0x0}, - 1265: {region: 0x165, script: 0x5a, flags: 0x0}, - 1266: {region: 0x161, script: 0x5a, flags: 0x0}, - 1267: {region: 0x165, script: 0x5a, flags: 0x0}, - 1268: {region: 0x12b, script: 0x62, flags: 0x0}, - 1269: {region: 0x12b, script: 0x63, flags: 0x0}, - 1270: {region: 0x7d, script: 0x2e, flags: 0x0}, - 1271: {region: 0x53, script: 0x67, flags: 0x0}, - 1272: {region: 0x10b, script: 0x6c, flags: 0x0}, - 1273: {region: 0x108, script: 0x77, flags: 0x0}, - 1274: {region: 0x99, script: 0x22, flags: 0x0}, - 1275: {region: 0x131, script: 0x5a, flags: 0x0}, - 1276: {region: 0x165, script: 0x5a, flags: 0x0}, - 1277: {region: 0x9c, script: 0x91, flags: 0x0}, - 1278: {region: 0x165, script: 0x5a, flags: 0x0}, - 1279: {region: 0x15e, script: 0xcc, flags: 0x0}, - 1280: {region: 0x165, script: 0x5a, flags: 0x0}, - 1281: {region: 0x165, script: 0x5a, flags: 0x0}, - 1282: {region: 0xdb, script: 0x22, flags: 0x0}, - 1283: {region: 0x165, script: 0x5a, flags: 0x0}, - 1284: {region: 0x165, script: 0x5a, flags: 0x0}, - 1285: {region: 0xd1, script: 0x5a, flags: 0x0}, - 1286: {region: 0x75, script: 0x5a, flags: 0x0}, - 1287: {region: 0x165, script: 0x5a, flags: 0x0}, - 1288: {region: 0x165, script: 0x5a, flags: 0x0}, - 1289: {region: 0x52, script: 0x5a, flags: 0x0}, - 1290: {region: 0x165, script: 0x5a, flags: 0x0}, - 1291: {region: 0x165, script: 0x5a, flags: 0x0}, - 1292: {region: 0x165, script: 0x5a, flags: 0x0}, - 1293: {region: 0x52, script: 0x5a, flags: 0x0}, - 1294: {region: 0x165, script: 0x5a, flags: 0x0}, - 1295: {region: 0x165, script: 0x5a, flags: 0x0}, - 1296: {region: 0x165, script: 0x5a, flags: 0x0}, - 1297: {region: 0x165, script: 0x5a, flags: 0x0}, + 1260: {region: 0x166, script: 0x5b, flags: 0x0}, + 1261: {region: 0x166, script: 0x5b, flags: 0x0}, + 1262: {region: 0x41, script: 0x5b, flags: 0x0}, + 1263: {region: 0x166, script: 0x5b, flags: 0x0}, + 1264: {region: 0x12c, script: 0x18, flags: 0x0}, + 1265: {region: 0x166, script: 0x5b, flags: 0x0}, + 1266: {region: 0x162, script: 0x5b, flags: 0x0}, + 1267: {region: 0x166, script: 0x5b, flags: 0x0}, + 1268: {region: 0x12c, script: 0x63, flags: 0x0}, + 1269: {region: 0x12c, script: 0x64, flags: 0x0}, + 1270: {region: 0x7e, script: 0x2e, flags: 0x0}, + 1271: {region: 0x53, script: 0x68, flags: 0x0}, + 1272: {region: 0x10c, script: 0x6d, flags: 0x0}, + 1273: {region: 0x109, script: 0x79, flags: 0x0}, + 1274: {region: 0x9a, script: 0x22, flags: 0x0}, + 1275: {region: 0x132, script: 0x5b, flags: 0x0}, + 1276: {region: 0x166, script: 0x5b, flags: 0x0}, + 1277: {region: 0x9d, script: 0x93, flags: 0x0}, + 1278: {region: 0x166, script: 0x5b, flags: 0x0}, + 1279: {region: 0x15f, script: 0xce, flags: 0x0}, + 1280: {region: 0x166, script: 0x5b, flags: 0x0}, + 1281: {region: 0x166, script: 0x5b, flags: 0x0}, + 1282: {region: 0xdc, script: 0x22, flags: 0x0}, + 1283: {region: 0x166, script: 0x5b, flags: 0x0}, + 1284: {region: 0x166, script: 0x5b, flags: 0x0}, + 1285: {region: 0xd2, script: 0x5b, flags: 0x0}, + 1286: {region: 0x76, script: 0x5b, flags: 0x0}, + 1287: {region: 0x166, script: 0x5b, flags: 0x0}, + 1288: {region: 0x166, script: 0x5b, flags: 0x0}, + 1289: {region: 0x52, script: 0x5b, flags: 0x0}, + 1290: {region: 0x166, script: 0x5b, flags: 0x0}, + 1291: {region: 0x166, script: 0x5b, flags: 0x0}, + 1292: {region: 0x166, script: 0x5b, flags: 0x0}, + 1293: {region: 0x52, script: 0x5b, flags: 0x0}, + 1294: {region: 0x166, script: 0x5b, flags: 0x0}, + 1295: {region: 0x166, script: 0x5b, flags: 0x0}, + 1296: {region: 0x166, script: 0x5b, flags: 0x0}, + 1297: {region: 0x166, script: 0x5b, flags: 0x0}, 1298: {region: 0x1, script: 0x3e, flags: 0x0}, - 1299: {region: 0x165, script: 0x5a, flags: 0x0}, - 1300: {region: 0x165, script: 0x5a, flags: 0x0}, - 1301: {region: 0x165, script: 0x5a, flags: 0x0}, - 1302: {region: 0x165, script: 0x5a, flags: 0x0}, - 1303: {region: 0x165, script: 0x5a, flags: 0x0}, - 1304: {region: 0xd6, script: 0x5a, flags: 0x0}, - 1305: {region: 0x165, script: 0x5a, flags: 0x0}, - 1306: {region: 0x165, script: 0x5a, flags: 0x0}, - 1307: {region: 0x165, script: 0x5a, flags: 0x0}, - 1308: {region: 0x41, script: 0x5a, flags: 0x0}, - 1309: {region: 0x165, script: 0x5a, flags: 0x0}, - 1310: {region: 0xcf, script: 0x5a, flags: 0x0}, + 1299: {region: 0x166, script: 0x5b, flags: 0x0}, + 1300: {region: 0x166, script: 0x5b, flags: 0x0}, + 1301: {region: 0x166, script: 0x5b, flags: 0x0}, + 1302: {region: 0x166, script: 0x5b, flags: 0x0}, + 1303: {region: 0x166, script: 0x5b, flags: 0x0}, + 1304: {region: 0xd7, script: 0x5b, flags: 0x0}, + 1305: {region: 0x166, script: 0x5b, flags: 0x0}, + 1306: {region: 0x166, script: 0x5b, flags: 0x0}, + 1307: {region: 0x166, script: 0x5b, flags: 0x0}, + 1308: {region: 0x41, script: 0x5b, flags: 0x0}, + 1309: {region: 0x166, script: 0x5b, flags: 0x0}, + 1310: {region: 0xd0, script: 0x5b, flags: 0x0}, 1311: {region: 0x4a, script: 0x3, flags: 0x1}, - 1312: {region: 0x165, script: 0x5a, flags: 0x0}, - 1313: {region: 0x165, script: 0x5a, flags: 0x0}, - 1314: {region: 0x165, script: 0x5a, flags: 0x0}, - 1315: {region: 0x53, script: 0x5a, flags: 0x0}, - 1316: {region: 0x10b, script: 0x5a, flags: 0x0}, - 1318: {region: 0xa8, script: 0x5, flags: 0x0}, - 1319: {region: 0xd9, script: 0x5a, flags: 0x0}, - 1320: {region: 0xba, script: 0xe8, flags: 0x0}, + 1312: {region: 0x166, script: 0x5b, flags: 0x0}, + 1313: {region: 0x166, script: 0x5b, flags: 0x0}, + 1314: {region: 0x166, script: 0x5b, flags: 0x0}, + 1315: {region: 0x53, script: 0x5b, flags: 0x0}, + 1316: {region: 0x10c, script: 0x5b, flags: 0x0}, + 1318: {region: 0xa9, script: 0x5, flags: 0x0}, + 1319: {region: 0xda, script: 0x5b, flags: 0x0}, + 1320: {region: 0xbb, script: 0xeb, flags: 0x0}, 1321: {region: 0x4d, script: 0x14, flags: 0x1}, - 1322: {region: 0x53, script: 0x7d, flags: 0x0}, - 1323: {region: 0x165, script: 0x5a, flags: 0x0}, - 1324: {region: 0x122, script: 0x5a, flags: 0x0}, - 1325: {region: 0xd0, script: 0x5a, flags: 0x0}, - 1326: {region: 0x165, script: 0x5a, flags: 0x0}, - 1327: {region: 0x161, script: 0x5a, flags: 0x0}, - 1329: {region: 0x12b, script: 0x5a, flags: 0x0}, + 1322: {region: 0x53, script: 0x7f, flags: 0x0}, + 1323: {region: 0x166, script: 0x5b, flags: 0x0}, + 1324: {region: 0x123, script: 0x5b, flags: 0x0}, + 1325: {region: 0xd1, script: 0x5b, flags: 0x0}, + 1326: {region: 0x166, script: 0x5b, flags: 0x0}, + 1327: {region: 0x162, script: 0x5b, flags: 0x0}, + 1329: {region: 0x12c, script: 0x5b, flags: 0x0}, } // likelyLangList holds lists info associated with likelyLang. // Size: 582 bytes, 97 elements var likelyLangList = [97]likelyScriptRegion{ - 0: {region: 0x9c, script: 0x7, flags: 0x0}, - 1: {region: 0xa1, script: 0x78, flags: 0x2}, - 2: {region: 0x11c, script: 0x85, flags: 0x2}, - 3: {region: 0x32, script: 0x5a, flags: 0x0}, - 4: {region: 0x9b, script: 0x5, flags: 0x4}, - 5: {region: 0x9c, script: 0x5, flags: 0x4}, - 6: {region: 0x106, script: 0x20, flags: 0x4}, - 7: {region: 0x9c, script: 0x5, flags: 0x2}, - 8: {region: 0x106, script: 0x20, flags: 0x0}, + 0: {region: 0x9d, script: 0x7, flags: 0x0}, + 1: {region: 0xa2, script: 0x7a, flags: 0x2}, + 2: {region: 0x11d, script: 0x87, flags: 0x2}, + 3: {region: 0x32, script: 0x5b, flags: 0x0}, + 4: {region: 0x9c, script: 0x5, flags: 0x4}, + 5: {region: 0x9d, script: 0x5, flags: 0x4}, + 6: {region: 0x107, script: 0x20, flags: 0x4}, + 7: {region: 0x9d, script: 0x5, flags: 0x2}, + 8: {region: 0x107, script: 0x20, flags: 0x0}, 9: {region: 0x38, script: 0x2f, flags: 0x2}, - 10: {region: 0x135, script: 0x5a, flags: 0x0}, - 11: {region: 0x7b, script: 0xcf, flags: 0x2}, - 12: {region: 0x114, script: 0x5a, flags: 0x0}, - 13: {region: 0x84, script: 0x1, flags: 0x2}, - 14: {region: 0x5d, script: 0x1f, flags: 0x0}, - 15: {region: 0x87, script: 0x5f, flags: 0x2}, - 16: {region: 0xd6, script: 0x5a, flags: 0x0}, + 10: {region: 0x136, script: 0x5b, flags: 0x0}, + 11: {region: 0x7c, script: 0xd1, flags: 0x2}, + 12: {region: 0x115, script: 0x5b, flags: 0x0}, + 13: {region: 0x85, script: 0x1, flags: 0x2}, + 14: {region: 0x5e, script: 0x1f, flags: 0x0}, + 15: {region: 0x88, script: 0x60, flags: 0x2}, + 16: {region: 0xd7, script: 0x5b, flags: 0x0}, 17: {region: 0x52, script: 0x5, flags: 0x4}, - 18: {region: 0x10b, script: 0x5, flags: 0x4}, - 19: {region: 0xae, script: 0x20, flags: 0x0}, + 18: {region: 0x10c, script: 0x5, flags: 0x4}, + 19: {region: 0xaf, script: 0x20, flags: 0x0}, 20: {region: 0x24, script: 0x5, flags: 0x4}, 21: {region: 0x53, script: 0x5, flags: 0x4}, - 22: {region: 0x9c, script: 0x5, flags: 0x4}, - 23: {region: 0xc5, script: 0x5, flags: 0x4}, + 22: {region: 0x9d, script: 0x5, flags: 0x4}, + 23: {region: 0xc6, script: 0x5, flags: 0x4}, 24: {region: 0x53, script: 0x5, flags: 0x2}, - 25: {region: 0x12b, script: 0x5a, flags: 0x0}, - 26: {region: 0xb0, script: 0x5, flags: 0x4}, - 27: {region: 0x9b, script: 0x5, flags: 0x2}, - 28: {region: 0xa5, script: 0x20, flags: 0x0}, + 25: {region: 0x12c, script: 0x5b, flags: 0x0}, + 26: {region: 0xb1, script: 0x5, flags: 0x4}, + 27: {region: 0x9c, script: 0x5, flags: 0x2}, + 28: {region: 0xa6, script: 0x20, flags: 0x0}, 29: {region: 0x53, script: 0x5, flags: 0x4}, - 30: {region: 0x12b, script: 0x5a, flags: 0x4}, + 30: {region: 0x12c, script: 0x5b, flags: 0x4}, 31: {region: 0x53, script: 0x5, flags: 0x2}, - 32: {region: 0x12b, script: 0x5a, flags: 0x2}, - 33: {region: 0xdb, script: 0x22, flags: 0x0}, - 34: {region: 0x99, script: 0x5d, flags: 0x2}, - 35: {region: 0x83, script: 0x5a, flags: 0x0}, - 36: {region: 0x84, script: 0x7c, flags: 0x4}, - 37: {region: 0x84, script: 0x7c, flags: 0x2}, - 38: {region: 0xc5, script: 0x20, flags: 0x0}, - 39: {region: 0x53, script: 0x70, flags: 0x4}, - 40: {region: 0x53, script: 0x70, flags: 0x2}, - 41: {region: 0xd0, script: 0x5a, flags: 0x0}, + 32: {region: 0x12c, script: 0x5b, flags: 0x2}, + 33: {region: 0xdc, script: 0x22, flags: 0x0}, + 34: {region: 0x9a, script: 0x5e, flags: 0x2}, + 35: {region: 0x84, script: 0x5b, flags: 0x0}, + 36: {region: 0x85, script: 0x7e, flags: 0x4}, + 37: {region: 0x85, script: 0x7e, flags: 0x2}, + 38: {region: 0xc6, script: 0x20, flags: 0x0}, + 39: {region: 0x53, script: 0x71, flags: 0x4}, + 40: {region: 0x53, script: 0x71, flags: 0x2}, + 41: {region: 0xd1, script: 0x5b, flags: 0x0}, 42: {region: 0x4a, script: 0x5, flags: 0x4}, - 43: {region: 0x95, script: 0x5, flags: 0x4}, - 44: {region: 0x99, script: 0x36, flags: 0x0}, - 45: {region: 0xe8, script: 0x5, flags: 0x4}, - 46: {region: 0xe8, script: 0x5, flags: 0x2}, - 47: {region: 0x9c, script: 0x8b, flags: 0x0}, - 48: {region: 0x53, script: 0x8c, flags: 0x2}, - 49: {region: 0xba, script: 0xe8, flags: 0x0}, - 50: {region: 0xd9, script: 0x5a, flags: 0x4}, - 51: {region: 0xe8, script: 0x5, flags: 0x0}, - 52: {region: 0x99, script: 0x22, flags: 0x2}, - 53: {region: 0x99, script: 0x4f, flags: 0x2}, - 54: {region: 0x99, script: 0xd3, flags: 0x2}, - 55: {region: 0x105, script: 0x20, flags: 0x0}, - 56: {region: 0xbd, script: 0x5a, flags: 0x4}, - 57: {region: 0x104, script: 0x5a, flags: 0x4}, - 58: {region: 0x106, script: 0x5a, flags: 0x4}, - 59: {region: 0x12b, script: 0x5a, flags: 0x4}, - 60: {region: 0x124, script: 0x20, flags: 0x0}, - 61: {region: 0xe8, script: 0x5, flags: 0x4}, - 62: {region: 0xe8, script: 0x5, flags: 0x2}, + 43: {region: 0x96, script: 0x5, flags: 0x4}, + 44: {region: 0x9a, script: 0x36, flags: 0x0}, + 45: {region: 0xe9, script: 0x5, flags: 0x4}, + 46: {region: 0xe9, script: 0x5, flags: 0x2}, + 47: {region: 0x9d, script: 0x8d, flags: 0x0}, + 48: {region: 0x53, script: 0x8e, flags: 0x2}, + 49: {region: 0xbb, script: 0xeb, flags: 0x0}, + 50: {region: 0xda, script: 0x5b, flags: 0x4}, + 51: {region: 0xe9, script: 0x5, flags: 0x0}, + 52: {region: 0x9a, script: 0x22, flags: 0x2}, + 53: {region: 0x9a, script: 0x50, flags: 0x2}, + 54: {region: 0x9a, script: 0xd5, flags: 0x2}, + 55: {region: 0x106, script: 0x20, flags: 0x0}, + 56: {region: 0xbe, script: 0x5b, flags: 0x4}, + 57: {region: 0x105, script: 0x5b, flags: 0x4}, + 58: {region: 0x107, script: 0x5b, flags: 0x4}, + 59: {region: 0x12c, script: 0x5b, flags: 0x4}, + 60: {region: 0x125, script: 0x20, flags: 0x0}, + 61: {region: 0xe9, script: 0x5, flags: 0x4}, + 62: {region: 0xe9, script: 0x5, flags: 0x2}, 63: {region: 0x53, script: 0x5, flags: 0x0}, - 64: {region: 0xae, script: 0x20, flags: 0x4}, - 65: {region: 0xc5, script: 0x20, flags: 0x4}, - 66: {region: 0xae, script: 0x20, flags: 0x2}, - 67: {region: 0x99, script: 0xe, flags: 0x0}, - 68: {region: 0xdb, script: 0x22, flags: 0x4}, - 69: {region: 0xdb, script: 0x22, flags: 0x2}, - 70: {region: 0x137, script: 0x5a, flags: 0x0}, + 64: {region: 0xaf, script: 0x20, flags: 0x4}, + 65: {region: 0xc6, script: 0x20, flags: 0x4}, + 66: {region: 0xaf, script: 0x20, flags: 0x2}, + 67: {region: 0x9a, script: 0xe, flags: 0x0}, + 68: {region: 0xdc, script: 0x22, flags: 0x4}, + 69: {region: 0xdc, script: 0x22, flags: 0x2}, + 70: {region: 0x138, script: 0x5b, flags: 0x0}, 71: {region: 0x24, script: 0x5, flags: 0x4}, 72: {region: 0x53, script: 0x20, flags: 0x4}, 73: {region: 0x24, script: 0x5, flags: 0x2}, - 74: {region: 0x8d, script: 0x3c, flags: 0x0}, + 74: {region: 0x8e, script: 0x3c, flags: 0x0}, 75: {region: 0x53, script: 0x3b, flags: 0x4}, 76: {region: 0x53, script: 0x3b, flags: 0x2}, 77: {region: 0x53, script: 0x3b, flags: 0x0}, 78: {region: 0x2f, script: 0x3c, flags: 0x4}, 79: {region: 0x3e, script: 0x3c, flags: 0x4}, - 80: {region: 0x7b, script: 0x3c, flags: 0x4}, - 81: {region: 0x7e, script: 0x3c, flags: 0x4}, - 82: {region: 0x8d, script: 0x3c, flags: 0x4}, - 83: {region: 0x95, script: 0x3c, flags: 0x4}, - 84: {region: 0xc6, script: 0x3c, flags: 0x4}, - 85: {region: 0xd0, script: 0x3c, flags: 0x4}, - 86: {region: 0xe2, script: 0x3c, flags: 0x4}, - 87: {region: 0xe5, script: 0x3c, flags: 0x4}, - 88: {region: 0xe7, script: 0x3c, flags: 0x4}, - 89: {region: 0x116, script: 0x3c, flags: 0x4}, - 90: {region: 0x123, script: 0x3c, flags: 0x4}, - 91: {region: 0x12e, script: 0x3c, flags: 0x4}, - 92: {region: 0x135, script: 0x3c, flags: 0x4}, - 93: {region: 0x13e, script: 0x3c, flags: 0x4}, - 94: {region: 0x12e, script: 0x11, flags: 0x2}, - 95: {region: 0x12e, script: 0x37, flags: 0x2}, - 96: {region: 0x12e, script: 0x3c, flags: 0x2}, + 80: {region: 0x7c, script: 0x3c, flags: 0x4}, + 81: {region: 0x7f, script: 0x3c, flags: 0x4}, + 82: {region: 0x8e, script: 0x3c, flags: 0x4}, + 83: {region: 0x96, script: 0x3c, flags: 0x4}, + 84: {region: 0xc7, script: 0x3c, flags: 0x4}, + 85: {region: 0xd1, script: 0x3c, flags: 0x4}, + 86: {region: 0xe3, script: 0x3c, flags: 0x4}, + 87: {region: 0xe6, script: 0x3c, flags: 0x4}, + 88: {region: 0xe8, script: 0x3c, flags: 0x4}, + 89: {region: 0x117, script: 0x3c, flags: 0x4}, + 90: {region: 0x124, script: 0x3c, flags: 0x4}, + 91: {region: 0x12f, script: 0x3c, flags: 0x4}, + 92: {region: 0x136, script: 0x3c, flags: 0x4}, + 93: {region: 0x13f, script: 0x3c, flags: 0x4}, + 94: {region: 0x12f, script: 0x11, flags: 0x2}, + 95: {region: 0x12f, script: 0x37, flags: 0x2}, + 96: {region: 0x12f, script: 0x3c, flags: 0x2}, } type likelyLangScript struct { @@ -2987,306 +3009,306 @@ type likelyLangScript struct { // for a given regionID, lang and script are the index and size respectively // of the list in likelyRegionList. // TODO: exclude containers and user-definable regions from the list. -// Size: 2148 bytes, 358 elements -var likelyRegion = [358]likelyLangScript{ - 34: {lang: 0xd7, script: 0x5a, flags: 0x0}, +// Size: 2154 bytes, 359 elements +var likelyRegion = [359]likelyLangScript{ + 34: {lang: 0xd7, script: 0x5b, flags: 0x0}, 35: {lang: 0x3a, script: 0x5, flags: 0x0}, 36: {lang: 0x0, script: 0x2, flags: 0x1}, 39: {lang: 0x2, script: 0x2, flags: 0x1}, 40: {lang: 0x4, script: 0x2, flags: 0x1}, - 42: {lang: 0x3c0, script: 0x5a, flags: 0x0}, - 43: {lang: 0x0, script: 0x5a, flags: 0x0}, - 44: {lang: 0x13e, script: 0x5a, flags: 0x0}, - 45: {lang: 0x41b, script: 0x5a, flags: 0x0}, - 46: {lang: 0x10d, script: 0x5a, flags: 0x0}, - 48: {lang: 0x367, script: 0x5a, flags: 0x0}, - 49: {lang: 0x444, script: 0x5a, flags: 0x0}, - 50: {lang: 0x58, script: 0x5a, flags: 0x0}, + 42: {lang: 0x3c0, script: 0x5b, flags: 0x0}, + 43: {lang: 0x0, script: 0x5b, flags: 0x0}, + 44: {lang: 0x13e, script: 0x5b, flags: 0x0}, + 45: {lang: 0x41b, script: 0x5b, flags: 0x0}, + 46: {lang: 0x10d, script: 0x5b, flags: 0x0}, + 48: {lang: 0x367, script: 0x5b, flags: 0x0}, + 49: {lang: 0x444, script: 0x5b, flags: 0x0}, + 50: {lang: 0x58, script: 0x5b, flags: 0x0}, 51: {lang: 0x6, script: 0x2, flags: 0x1}, 53: {lang: 0xa5, script: 0xe, flags: 0x0}, - 54: {lang: 0x367, script: 0x5a, flags: 0x0}, - 55: {lang: 0x15e, script: 0x5a, flags: 0x0}, + 54: {lang: 0x367, script: 0x5b, flags: 0x0}, + 55: {lang: 0x15e, script: 0x5b, flags: 0x0}, 56: {lang: 0x7e, script: 0x20, flags: 0x0}, 57: {lang: 0x3a, script: 0x5, flags: 0x0}, - 58: {lang: 0x3d9, script: 0x5a, flags: 0x0}, - 59: {lang: 0x15e, script: 0x5a, flags: 0x0}, - 60: {lang: 0x15e, script: 0x5a, flags: 0x0}, - 62: {lang: 0x31f, script: 0x5a, flags: 0x0}, - 63: {lang: 0x13e, script: 0x5a, flags: 0x0}, - 64: {lang: 0x3a1, script: 0x5a, flags: 0x0}, - 65: {lang: 0x3c0, script: 0x5a, flags: 0x0}, + 58: {lang: 0x3d9, script: 0x5b, flags: 0x0}, + 59: {lang: 0x15e, script: 0x5b, flags: 0x0}, + 60: {lang: 0x15e, script: 0x5b, flags: 0x0}, + 62: {lang: 0x31f, script: 0x5b, flags: 0x0}, + 63: {lang: 0x13e, script: 0x5b, flags: 0x0}, + 64: {lang: 0x3a1, script: 0x5b, flags: 0x0}, + 65: {lang: 0x3c0, script: 0x5b, flags: 0x0}, 67: {lang: 0x8, script: 0x2, flags: 0x1}, - 69: {lang: 0x0, script: 0x5a, flags: 0x0}, + 69: {lang: 0x0, script: 0x5b, flags: 0x0}, 71: {lang: 0x71, script: 0x20, flags: 0x0}, 73: {lang: 0x512, script: 0x3e, flags: 0x2}, 74: {lang: 0x31f, script: 0x5, flags: 0x2}, - 75: {lang: 0x445, script: 0x5a, flags: 0x0}, - 76: {lang: 0x15e, script: 0x5a, flags: 0x0}, - 77: {lang: 0x15e, script: 0x5a, flags: 0x0}, - 78: {lang: 0x10d, script: 0x5a, flags: 0x0}, - 79: {lang: 0x15e, script: 0x5a, flags: 0x0}, - 81: {lang: 0x13e, script: 0x5a, flags: 0x0}, - 82: {lang: 0x15e, script: 0x5a, flags: 0x0}, + 75: {lang: 0x445, script: 0x5b, flags: 0x0}, + 76: {lang: 0x15e, script: 0x5b, flags: 0x0}, + 77: {lang: 0x15e, script: 0x5b, flags: 0x0}, + 78: {lang: 0x10d, script: 0x5b, flags: 0x0}, + 79: {lang: 0x15e, script: 0x5b, flags: 0x0}, + 81: {lang: 0x13e, script: 0x5b, flags: 0x0}, + 82: {lang: 0x15e, script: 0x5b, flags: 0x0}, 83: {lang: 0xa, script: 0x4, flags: 0x1}, - 84: {lang: 0x13e, script: 0x5a, flags: 0x0}, - 85: {lang: 0x0, script: 0x5a, flags: 0x0}, - 86: {lang: 0x13e, script: 0x5a, flags: 0x0}, - 89: {lang: 0x13e, script: 0x5a, flags: 0x0}, - 90: {lang: 0x3c0, script: 0x5a, flags: 0x0}, - 91: {lang: 0x3a1, script: 0x5a, flags: 0x0}, - 93: {lang: 0xe, script: 0x2, flags: 0x1}, - 94: {lang: 0xfa, script: 0x5a, flags: 0x0}, - 96: {lang: 0x10d, script: 0x5a, flags: 0x0}, - 98: {lang: 0x1, script: 0x5a, flags: 0x0}, - 99: {lang: 0x101, script: 0x5a, flags: 0x0}, - 101: {lang: 0x13e, script: 0x5a, flags: 0x0}, - 103: {lang: 0x10, script: 0x2, flags: 0x1}, - 104: {lang: 0x13e, script: 0x5a, flags: 0x0}, - 105: {lang: 0x13e, script: 0x5a, flags: 0x0}, - 106: {lang: 0x140, script: 0x5a, flags: 0x0}, - 107: {lang: 0x3a, script: 0x5, flags: 0x0}, + 84: {lang: 0x13e, script: 0x5b, flags: 0x0}, + 85: {lang: 0x0, script: 0x5b, flags: 0x0}, + 87: {lang: 0x13e, script: 0x5b, flags: 0x0}, + 90: {lang: 0x13e, script: 0x5b, flags: 0x0}, + 91: {lang: 0x3c0, script: 0x5b, flags: 0x0}, + 92: {lang: 0x3a1, script: 0x5b, flags: 0x0}, + 94: {lang: 0xe, script: 0x2, flags: 0x1}, + 95: {lang: 0xfa, script: 0x5b, flags: 0x0}, + 97: {lang: 0x10d, script: 0x5b, flags: 0x0}, + 99: {lang: 0x1, script: 0x5b, flags: 0x0}, + 100: {lang: 0x101, script: 0x5b, flags: 0x0}, + 102: {lang: 0x13e, script: 0x5b, flags: 0x0}, + 104: {lang: 0x10, script: 0x2, flags: 0x1}, + 105: {lang: 0x13e, script: 0x5b, flags: 0x0}, + 106: {lang: 0x13e, script: 0x5b, flags: 0x0}, + 107: {lang: 0x140, script: 0x5b, flags: 0x0}, 108: {lang: 0x3a, script: 0x5, flags: 0x0}, - 109: {lang: 0x46f, script: 0x2c, flags: 0x0}, - 110: {lang: 0x13e, script: 0x5a, flags: 0x0}, - 111: {lang: 0x12, script: 0x2, flags: 0x1}, - 113: {lang: 0x10d, script: 0x5a, flags: 0x0}, - 114: {lang: 0x151, script: 0x5a, flags: 0x0}, - 115: {lang: 0x1c0, script: 0x22, flags: 0x2}, - 118: {lang: 0x158, script: 0x5a, flags: 0x0}, - 120: {lang: 0x15e, script: 0x5a, flags: 0x0}, - 122: {lang: 0x15e, script: 0x5a, flags: 0x0}, - 123: {lang: 0x14, script: 0x2, flags: 0x1}, - 125: {lang: 0x16, script: 0x3, flags: 0x1}, - 126: {lang: 0x15e, script: 0x5a, flags: 0x0}, - 128: {lang: 0x21, script: 0x5a, flags: 0x0}, - 130: {lang: 0x245, script: 0x5a, flags: 0x0}, - 132: {lang: 0x15e, script: 0x5a, flags: 0x0}, - 133: {lang: 0x15e, script: 0x5a, flags: 0x0}, - 134: {lang: 0x13e, script: 0x5a, flags: 0x0}, - 135: {lang: 0x19, script: 0x2, flags: 0x1}, - 136: {lang: 0x0, script: 0x5a, flags: 0x0}, - 137: {lang: 0x13e, script: 0x5a, flags: 0x0}, - 139: {lang: 0x3c0, script: 0x5a, flags: 0x0}, - 141: {lang: 0x529, script: 0x3c, flags: 0x0}, - 142: {lang: 0x0, script: 0x5a, flags: 0x0}, - 143: {lang: 0x13e, script: 0x5a, flags: 0x0}, - 144: {lang: 0x1d1, script: 0x5a, flags: 0x0}, - 145: {lang: 0x1d4, script: 0x5a, flags: 0x0}, - 146: {lang: 0x1d5, script: 0x5a, flags: 0x0}, - 148: {lang: 0x13e, script: 0x5a, flags: 0x0}, - 149: {lang: 0x1b, script: 0x2, flags: 0x1}, - 151: {lang: 0x1bc, script: 0x3e, flags: 0x0}, - 153: {lang: 0x1d, script: 0x3, flags: 0x1}, - 155: {lang: 0x3a, script: 0x5, flags: 0x0}, - 156: {lang: 0x20, script: 0x2, flags: 0x1}, - 157: {lang: 0x1f8, script: 0x5a, flags: 0x0}, - 158: {lang: 0x1f9, script: 0x5a, flags: 0x0}, - 161: {lang: 0x3a, script: 0x5, flags: 0x0}, - 162: {lang: 0x200, script: 0x49, flags: 0x0}, - 164: {lang: 0x445, script: 0x5a, flags: 0x0}, - 165: {lang: 0x28a, script: 0x20, flags: 0x0}, - 166: {lang: 0x22, script: 0x3, flags: 0x1}, - 168: {lang: 0x25, script: 0x2, flags: 0x1}, - 170: {lang: 0x254, script: 0x53, flags: 0x0}, - 171: {lang: 0x254, script: 0x53, flags: 0x0}, - 172: {lang: 0x3a, script: 0x5, flags: 0x0}, - 174: {lang: 0x3e2, script: 0x20, flags: 0x0}, - 175: {lang: 0x27, script: 0x2, flags: 0x1}, - 176: {lang: 0x3a, script: 0x5, flags: 0x0}, - 178: {lang: 0x10d, script: 0x5a, flags: 0x0}, - 179: {lang: 0x40c, script: 0xd4, flags: 0x0}, - 181: {lang: 0x43b, script: 0x5a, flags: 0x0}, - 182: {lang: 0x2c0, script: 0x5a, flags: 0x0}, - 183: {lang: 0x15e, script: 0x5a, flags: 0x0}, - 184: {lang: 0x2c7, script: 0x5a, flags: 0x0}, - 185: {lang: 0x3a, script: 0x5, flags: 0x0}, - 186: {lang: 0x29, script: 0x2, flags: 0x1}, - 187: {lang: 0x15e, script: 0x5a, flags: 0x0}, - 188: {lang: 0x2b, script: 0x2, flags: 0x1}, - 189: {lang: 0x432, script: 0x5a, flags: 0x0}, - 190: {lang: 0x15e, script: 0x5a, flags: 0x0}, - 191: {lang: 0x2f1, script: 0x5a, flags: 0x0}, - 194: {lang: 0x2d, script: 0x2, flags: 0x1}, - 195: {lang: 0xa0, script: 0x5a, flags: 0x0}, - 196: {lang: 0x2f, script: 0x2, flags: 0x1}, - 197: {lang: 0x31, script: 0x2, flags: 0x1}, - 198: {lang: 0x33, script: 0x2, flags: 0x1}, - 200: {lang: 0x15e, script: 0x5a, flags: 0x0}, - 201: {lang: 0x35, script: 0x2, flags: 0x1}, - 203: {lang: 0x320, script: 0x5a, flags: 0x0}, - 204: {lang: 0x37, script: 0x3, flags: 0x1}, - 205: {lang: 0x128, script: 0xea, flags: 0x0}, - 207: {lang: 0x13e, script: 0x5a, flags: 0x0}, - 208: {lang: 0x31f, script: 0x5a, flags: 0x0}, - 209: {lang: 0x3c0, script: 0x5a, flags: 0x0}, - 210: {lang: 0x16, script: 0x5a, flags: 0x0}, - 211: {lang: 0x15e, script: 0x5a, flags: 0x0}, - 212: {lang: 0x1b4, script: 0x5a, flags: 0x0}, - 214: {lang: 0x1b4, script: 0x5, flags: 0x2}, - 216: {lang: 0x13e, script: 0x5a, flags: 0x0}, - 217: {lang: 0x367, script: 0x5a, flags: 0x0}, - 218: {lang: 0x347, script: 0x5a, flags: 0x0}, - 219: {lang: 0x351, script: 0x22, flags: 0x0}, - 225: {lang: 0x3a, script: 0x5, flags: 0x0}, - 226: {lang: 0x13e, script: 0x5a, flags: 0x0}, - 228: {lang: 0x13e, script: 0x5a, flags: 0x0}, - 229: {lang: 0x15e, script: 0x5a, flags: 0x0}, - 230: {lang: 0x486, script: 0x5a, flags: 0x0}, - 231: {lang: 0x153, script: 0x5a, flags: 0x0}, - 232: {lang: 0x3a, script: 0x3, flags: 0x1}, - 233: {lang: 0x3b3, script: 0x5a, flags: 0x0}, - 234: {lang: 0x15e, script: 0x5a, flags: 0x0}, - 236: {lang: 0x13e, script: 0x5a, flags: 0x0}, - 237: {lang: 0x3a, script: 0x5, flags: 0x0}, - 238: {lang: 0x3c0, script: 0x5a, flags: 0x0}, - 240: {lang: 0x3a2, script: 0x5a, flags: 0x0}, - 241: {lang: 0x194, script: 0x5a, flags: 0x0}, - 243: {lang: 0x3a, script: 0x5, flags: 0x0}, - 258: {lang: 0x15e, script: 0x5a, flags: 0x0}, - 260: {lang: 0x3d, script: 0x2, flags: 0x1}, - 261: {lang: 0x432, script: 0x20, flags: 0x0}, - 262: {lang: 0x3f, script: 0x2, flags: 0x1}, - 263: {lang: 0x3e5, script: 0x5a, flags: 0x0}, - 264: {lang: 0x3a, script: 0x5, flags: 0x0}, - 266: {lang: 0x15e, script: 0x5a, flags: 0x0}, - 267: {lang: 0x3a, script: 0x5, flags: 0x0}, - 268: {lang: 0x41, script: 0x2, flags: 0x1}, - 271: {lang: 0x416, script: 0x5a, flags: 0x0}, - 272: {lang: 0x347, script: 0x5a, flags: 0x0}, - 273: {lang: 0x43, script: 0x2, flags: 0x1}, - 275: {lang: 0x1f9, script: 0x5a, flags: 0x0}, - 276: {lang: 0x15e, script: 0x5a, flags: 0x0}, - 277: {lang: 0x429, script: 0x5a, flags: 0x0}, - 278: {lang: 0x367, script: 0x5a, flags: 0x0}, - 280: {lang: 0x3c0, script: 0x5a, flags: 0x0}, - 282: {lang: 0x13e, script: 0x5a, flags: 0x0}, - 284: {lang: 0x45, script: 0x2, flags: 0x1}, - 288: {lang: 0x15e, script: 0x5a, flags: 0x0}, - 289: {lang: 0x15e, script: 0x5a, flags: 0x0}, - 290: {lang: 0x47, script: 0x2, flags: 0x1}, - 291: {lang: 0x49, script: 0x3, flags: 0x1}, - 292: {lang: 0x4c, script: 0x2, flags: 0x1}, - 293: {lang: 0x477, script: 0x5a, flags: 0x0}, - 294: {lang: 0x3c0, script: 0x5a, flags: 0x0}, - 295: {lang: 0x476, script: 0x5a, flags: 0x0}, - 296: {lang: 0x4e, script: 0x2, flags: 0x1}, - 297: {lang: 0x482, script: 0x5a, flags: 0x0}, - 299: {lang: 0x50, script: 0x4, flags: 0x1}, - 301: {lang: 0x4a0, script: 0x5a, flags: 0x0}, - 302: {lang: 0x54, script: 0x2, flags: 0x1}, - 303: {lang: 0x445, script: 0x5a, flags: 0x0}, - 304: {lang: 0x56, script: 0x3, flags: 0x1}, - 305: {lang: 0x445, script: 0x5a, flags: 0x0}, - 309: {lang: 0x512, script: 0x3e, flags: 0x2}, - 310: {lang: 0x13e, script: 0x5a, flags: 0x0}, - 311: {lang: 0x4bc, script: 0x5a, flags: 0x0}, - 312: {lang: 0x1f9, script: 0x5a, flags: 0x0}, - 315: {lang: 0x13e, script: 0x5a, flags: 0x0}, - 318: {lang: 0x4c3, script: 0x5a, flags: 0x0}, - 319: {lang: 0x8a, script: 0x5a, flags: 0x0}, - 320: {lang: 0x15e, script: 0x5a, flags: 0x0}, - 322: {lang: 0x41b, script: 0x5a, flags: 0x0}, - 333: {lang: 0x59, script: 0x2, flags: 0x1}, - 350: {lang: 0x3a, script: 0x5, flags: 0x0}, - 351: {lang: 0x5b, script: 0x2, flags: 0x1}, - 356: {lang: 0x423, script: 0x5a, flags: 0x0}, + 109: {lang: 0x3a, script: 0x5, flags: 0x0}, + 110: {lang: 0x46f, script: 0x2c, flags: 0x0}, + 111: {lang: 0x13e, script: 0x5b, flags: 0x0}, + 112: {lang: 0x12, script: 0x2, flags: 0x1}, + 114: {lang: 0x10d, script: 0x5b, flags: 0x0}, + 115: {lang: 0x151, script: 0x5b, flags: 0x0}, + 116: {lang: 0x1c0, script: 0x22, flags: 0x2}, + 119: {lang: 0x158, script: 0x5b, flags: 0x0}, + 121: {lang: 0x15e, script: 0x5b, flags: 0x0}, + 123: {lang: 0x15e, script: 0x5b, flags: 0x0}, + 124: {lang: 0x14, script: 0x2, flags: 0x1}, + 126: {lang: 0x16, script: 0x3, flags: 0x1}, + 127: {lang: 0x15e, script: 0x5b, flags: 0x0}, + 129: {lang: 0x21, script: 0x5b, flags: 0x0}, + 131: {lang: 0x245, script: 0x5b, flags: 0x0}, + 133: {lang: 0x15e, script: 0x5b, flags: 0x0}, + 134: {lang: 0x15e, script: 0x5b, flags: 0x0}, + 135: {lang: 0x13e, script: 0x5b, flags: 0x0}, + 136: {lang: 0x19, script: 0x2, flags: 0x1}, + 137: {lang: 0x0, script: 0x5b, flags: 0x0}, + 138: {lang: 0x13e, script: 0x5b, flags: 0x0}, + 140: {lang: 0x3c0, script: 0x5b, flags: 0x0}, + 142: {lang: 0x529, script: 0x3c, flags: 0x0}, + 143: {lang: 0x0, script: 0x5b, flags: 0x0}, + 144: {lang: 0x13e, script: 0x5b, flags: 0x0}, + 145: {lang: 0x1d1, script: 0x5b, flags: 0x0}, + 146: {lang: 0x1d4, script: 0x5b, flags: 0x0}, + 147: {lang: 0x1d5, script: 0x5b, flags: 0x0}, + 149: {lang: 0x13e, script: 0x5b, flags: 0x0}, + 150: {lang: 0x1b, script: 0x2, flags: 0x1}, + 152: {lang: 0x1bc, script: 0x3e, flags: 0x0}, + 154: {lang: 0x1d, script: 0x3, flags: 0x1}, + 156: {lang: 0x3a, script: 0x5, flags: 0x0}, + 157: {lang: 0x20, script: 0x2, flags: 0x1}, + 158: {lang: 0x1f8, script: 0x5b, flags: 0x0}, + 159: {lang: 0x1f9, script: 0x5b, flags: 0x0}, + 162: {lang: 0x3a, script: 0x5, flags: 0x0}, + 163: {lang: 0x200, script: 0x49, flags: 0x0}, + 165: {lang: 0x445, script: 0x5b, flags: 0x0}, + 166: {lang: 0x28a, script: 0x20, flags: 0x0}, + 167: {lang: 0x22, script: 0x3, flags: 0x1}, + 169: {lang: 0x25, script: 0x2, flags: 0x1}, + 171: {lang: 0x254, script: 0x54, flags: 0x0}, + 172: {lang: 0x254, script: 0x54, flags: 0x0}, + 173: {lang: 0x3a, script: 0x5, flags: 0x0}, + 175: {lang: 0x3e2, script: 0x20, flags: 0x0}, + 176: {lang: 0x27, script: 0x2, flags: 0x1}, + 177: {lang: 0x3a, script: 0x5, flags: 0x0}, + 179: {lang: 0x10d, script: 0x5b, flags: 0x0}, + 180: {lang: 0x40c, script: 0xd6, flags: 0x0}, + 182: {lang: 0x43b, script: 0x5b, flags: 0x0}, + 183: {lang: 0x2c0, script: 0x5b, flags: 0x0}, + 184: {lang: 0x15e, script: 0x5b, flags: 0x0}, + 185: {lang: 0x2c7, script: 0x5b, flags: 0x0}, + 186: {lang: 0x3a, script: 0x5, flags: 0x0}, + 187: {lang: 0x29, script: 0x2, flags: 0x1}, + 188: {lang: 0x15e, script: 0x5b, flags: 0x0}, + 189: {lang: 0x2b, script: 0x2, flags: 0x1}, + 190: {lang: 0x432, script: 0x5b, flags: 0x0}, + 191: {lang: 0x15e, script: 0x5b, flags: 0x0}, + 192: {lang: 0x2f1, script: 0x5b, flags: 0x0}, + 195: {lang: 0x2d, script: 0x2, flags: 0x1}, + 196: {lang: 0xa0, script: 0x5b, flags: 0x0}, + 197: {lang: 0x2f, script: 0x2, flags: 0x1}, + 198: {lang: 0x31, script: 0x2, flags: 0x1}, + 199: {lang: 0x33, script: 0x2, flags: 0x1}, + 201: {lang: 0x15e, script: 0x5b, flags: 0x0}, + 202: {lang: 0x35, script: 0x2, flags: 0x1}, + 204: {lang: 0x320, script: 0x5b, flags: 0x0}, + 205: {lang: 0x37, script: 0x3, flags: 0x1}, + 206: {lang: 0x128, script: 0xed, flags: 0x0}, + 208: {lang: 0x13e, script: 0x5b, flags: 0x0}, + 209: {lang: 0x31f, script: 0x5b, flags: 0x0}, + 210: {lang: 0x3c0, script: 0x5b, flags: 0x0}, + 211: {lang: 0x16, script: 0x5b, flags: 0x0}, + 212: {lang: 0x15e, script: 0x5b, flags: 0x0}, + 213: {lang: 0x1b4, script: 0x5b, flags: 0x0}, + 215: {lang: 0x1b4, script: 0x5, flags: 0x2}, + 217: {lang: 0x13e, script: 0x5b, flags: 0x0}, + 218: {lang: 0x367, script: 0x5b, flags: 0x0}, + 219: {lang: 0x347, script: 0x5b, flags: 0x0}, + 220: {lang: 0x351, script: 0x22, flags: 0x0}, + 226: {lang: 0x3a, script: 0x5, flags: 0x0}, + 227: {lang: 0x13e, script: 0x5b, flags: 0x0}, + 229: {lang: 0x13e, script: 0x5b, flags: 0x0}, + 230: {lang: 0x15e, script: 0x5b, flags: 0x0}, + 231: {lang: 0x486, script: 0x5b, flags: 0x0}, + 232: {lang: 0x153, script: 0x5b, flags: 0x0}, + 233: {lang: 0x3a, script: 0x3, flags: 0x1}, + 234: {lang: 0x3b3, script: 0x5b, flags: 0x0}, + 235: {lang: 0x15e, script: 0x5b, flags: 0x0}, + 237: {lang: 0x13e, script: 0x5b, flags: 0x0}, + 238: {lang: 0x3a, script: 0x5, flags: 0x0}, + 239: {lang: 0x3c0, script: 0x5b, flags: 0x0}, + 241: {lang: 0x3a2, script: 0x5b, flags: 0x0}, + 242: {lang: 0x194, script: 0x5b, flags: 0x0}, + 244: {lang: 0x3a, script: 0x5, flags: 0x0}, + 259: {lang: 0x15e, script: 0x5b, flags: 0x0}, + 261: {lang: 0x3d, script: 0x2, flags: 0x1}, + 262: {lang: 0x432, script: 0x20, flags: 0x0}, + 263: {lang: 0x3f, script: 0x2, flags: 0x1}, + 264: {lang: 0x3e5, script: 0x5b, flags: 0x0}, + 265: {lang: 0x3a, script: 0x5, flags: 0x0}, + 267: {lang: 0x15e, script: 0x5b, flags: 0x0}, + 268: {lang: 0x3a, script: 0x5, flags: 0x0}, + 269: {lang: 0x41, script: 0x2, flags: 0x1}, + 272: {lang: 0x416, script: 0x5b, flags: 0x0}, + 273: {lang: 0x347, script: 0x5b, flags: 0x0}, + 274: {lang: 0x43, script: 0x2, flags: 0x1}, + 276: {lang: 0x1f9, script: 0x5b, flags: 0x0}, + 277: {lang: 0x15e, script: 0x5b, flags: 0x0}, + 278: {lang: 0x429, script: 0x5b, flags: 0x0}, + 279: {lang: 0x367, script: 0x5b, flags: 0x0}, + 281: {lang: 0x3c0, script: 0x5b, flags: 0x0}, + 283: {lang: 0x13e, script: 0x5b, flags: 0x0}, + 285: {lang: 0x45, script: 0x2, flags: 0x1}, + 289: {lang: 0x15e, script: 0x5b, flags: 0x0}, + 290: {lang: 0x15e, script: 0x5b, flags: 0x0}, + 291: {lang: 0x47, script: 0x2, flags: 0x1}, + 292: {lang: 0x49, script: 0x3, flags: 0x1}, + 293: {lang: 0x4c, script: 0x2, flags: 0x1}, + 294: {lang: 0x477, script: 0x5b, flags: 0x0}, + 295: {lang: 0x3c0, script: 0x5b, flags: 0x0}, + 296: {lang: 0x476, script: 0x5b, flags: 0x0}, + 297: {lang: 0x4e, script: 0x2, flags: 0x1}, + 298: {lang: 0x482, script: 0x5b, flags: 0x0}, + 300: {lang: 0x50, script: 0x4, flags: 0x1}, + 302: {lang: 0x4a0, script: 0x5b, flags: 0x0}, + 303: {lang: 0x54, script: 0x2, flags: 0x1}, + 304: {lang: 0x445, script: 0x5b, flags: 0x0}, + 305: {lang: 0x56, script: 0x3, flags: 0x1}, + 306: {lang: 0x445, script: 0x5b, flags: 0x0}, + 310: {lang: 0x512, script: 0x3e, flags: 0x2}, + 311: {lang: 0x13e, script: 0x5b, flags: 0x0}, + 312: {lang: 0x4bc, script: 0x5b, flags: 0x0}, + 313: {lang: 0x1f9, script: 0x5b, flags: 0x0}, + 316: {lang: 0x13e, script: 0x5b, flags: 0x0}, + 319: {lang: 0x4c3, script: 0x5b, flags: 0x0}, + 320: {lang: 0x8a, script: 0x5b, flags: 0x0}, + 321: {lang: 0x15e, script: 0x5b, flags: 0x0}, + 323: {lang: 0x41b, script: 0x5b, flags: 0x0}, + 334: {lang: 0x59, script: 0x2, flags: 0x1}, + 351: {lang: 0x3a, script: 0x5, flags: 0x0}, + 352: {lang: 0x5b, script: 0x2, flags: 0x1}, + 357: {lang: 0x423, script: 0x5b, flags: 0x0}, } // likelyRegionList holds lists info associated with likelyRegion. // Size: 558 bytes, 93 elements var likelyRegionList = [93]likelyLangScript{ 0: {lang: 0x148, script: 0x5, flags: 0x0}, - 1: {lang: 0x476, script: 0x5a, flags: 0x0}, - 2: {lang: 0x431, script: 0x5a, flags: 0x0}, + 1: {lang: 0x476, script: 0x5b, flags: 0x0}, + 2: {lang: 0x431, script: 0x5b, flags: 0x0}, 3: {lang: 0x2ff, script: 0x20, flags: 0x0}, 4: {lang: 0x1d7, script: 0x8, flags: 0x0}, - 5: {lang: 0x274, script: 0x5a, flags: 0x0}, - 6: {lang: 0xb7, script: 0x5a, flags: 0x0}, + 5: {lang: 0x274, script: 0x5b, flags: 0x0}, + 6: {lang: 0xb7, script: 0x5b, flags: 0x0}, 7: {lang: 0x432, script: 0x20, flags: 0x0}, - 8: {lang: 0x12d, script: 0xec, flags: 0x0}, + 8: {lang: 0x12d, script: 0xef, flags: 0x0}, 9: {lang: 0x351, script: 0x22, flags: 0x0}, 10: {lang: 0x529, script: 0x3b, flags: 0x0}, 11: {lang: 0x4ac, script: 0x5, flags: 0x0}, - 12: {lang: 0x523, script: 0x5a, flags: 0x0}, - 13: {lang: 0x29a, script: 0xeb, flags: 0x0}, + 12: {lang: 0x523, script: 0x5b, flags: 0x0}, + 13: {lang: 0x29a, script: 0xee, flags: 0x0}, 14: {lang: 0x136, script: 0x34, flags: 0x0}, - 15: {lang: 0x48a, script: 0x5a, flags: 0x0}, + 15: {lang: 0x48a, script: 0x5b, flags: 0x0}, 16: {lang: 0x3a, script: 0x5, flags: 0x0}, - 17: {lang: 0x15e, script: 0x5a, flags: 0x0}, + 17: {lang: 0x15e, script: 0x5b, flags: 0x0}, 18: {lang: 0x27, script: 0x2c, flags: 0x0}, - 19: {lang: 0x139, script: 0x5a, flags: 0x0}, + 19: {lang: 0x139, script: 0x5b, flags: 0x0}, 20: {lang: 0x26a, script: 0x5, flags: 0x2}, 21: {lang: 0x512, script: 0x3e, flags: 0x2}, 22: {lang: 0x210, script: 0x2e, flags: 0x0}, 23: {lang: 0x5, script: 0x20, flags: 0x0}, - 24: {lang: 0x274, script: 0x5a, flags: 0x0}, + 24: {lang: 0x274, script: 0x5b, flags: 0x0}, 25: {lang: 0x136, script: 0x34, flags: 0x0}, 26: {lang: 0x2ff, script: 0x20, flags: 0x0}, - 27: {lang: 0x1e1, script: 0x5a, flags: 0x0}, + 27: {lang: 0x1e1, script: 0x5b, flags: 0x0}, 28: {lang: 0x31f, script: 0x5, flags: 0x0}, 29: {lang: 0x1be, script: 0x22, flags: 0x0}, 30: {lang: 0x4b4, script: 0x5, flags: 0x0}, - 31: {lang: 0x236, script: 0x75, flags: 0x0}, + 31: {lang: 0x236, script: 0x76, flags: 0x0}, 32: {lang: 0x148, script: 0x5, flags: 0x0}, - 33: {lang: 0x476, script: 0x5a, flags: 0x0}, - 34: {lang: 0x24a, script: 0x4e, flags: 0x0}, + 33: {lang: 0x476, script: 0x5b, flags: 0x0}, + 34: {lang: 0x24a, script: 0x4f, flags: 0x0}, 35: {lang: 0xe6, script: 0x5, flags: 0x0}, - 36: {lang: 0x226, script: 0xeb, flags: 0x0}, + 36: {lang: 0x226, script: 0xee, flags: 0x0}, 37: {lang: 0x3a, script: 0x5, flags: 0x0}, - 38: {lang: 0x15e, script: 0x5a, flags: 0x0}, - 39: {lang: 0x2b8, script: 0x57, flags: 0x0}, - 40: {lang: 0x226, script: 0xeb, flags: 0x0}, + 38: {lang: 0x15e, script: 0x5b, flags: 0x0}, + 39: {lang: 0x2b8, script: 0x58, flags: 0x0}, + 40: {lang: 0x226, script: 0xee, flags: 0x0}, 41: {lang: 0x3a, script: 0x5, flags: 0x0}, - 42: {lang: 0x15e, script: 0x5a, flags: 0x0}, - 43: {lang: 0x3dc, script: 0x5a, flags: 0x0}, + 42: {lang: 0x15e, script: 0x5b, flags: 0x0}, + 43: {lang: 0x3dc, script: 0x5b, flags: 0x0}, 44: {lang: 0x4ae, script: 0x20, flags: 0x0}, 45: {lang: 0x2ff, script: 0x20, flags: 0x0}, - 46: {lang: 0x431, script: 0x5a, flags: 0x0}, - 47: {lang: 0x331, script: 0x75, flags: 0x0}, - 48: {lang: 0x213, script: 0x5a, flags: 0x0}, + 46: {lang: 0x431, script: 0x5b, flags: 0x0}, + 47: {lang: 0x331, script: 0x76, flags: 0x0}, + 48: {lang: 0x213, script: 0x5b, flags: 0x0}, 49: {lang: 0x30b, script: 0x20, flags: 0x0}, 50: {lang: 0x242, script: 0x5, flags: 0x0}, 51: {lang: 0x529, script: 0x3c, flags: 0x0}, - 52: {lang: 0x3c0, script: 0x5a, flags: 0x0}, + 52: {lang: 0x3c0, script: 0x5b, flags: 0x0}, 53: {lang: 0x3a, script: 0x5, flags: 0x0}, - 54: {lang: 0x15e, script: 0x5a, flags: 0x0}, - 55: {lang: 0x2ed, script: 0x5a, flags: 0x0}, + 54: {lang: 0x15e, script: 0x5b, flags: 0x0}, + 55: {lang: 0x2ed, script: 0x5b, flags: 0x0}, 56: {lang: 0x4b4, script: 0x5, flags: 0x0}, 57: {lang: 0x88, script: 0x22, flags: 0x0}, 58: {lang: 0x4b4, script: 0x5, flags: 0x0}, 59: {lang: 0x4b4, script: 0x5, flags: 0x0}, 60: {lang: 0xbe, script: 0x22, flags: 0x0}, - 61: {lang: 0x3dc, script: 0x5a, flags: 0x0}, + 61: {lang: 0x3dc, script: 0x5b, flags: 0x0}, 62: {lang: 0x7e, script: 0x20, flags: 0x0}, 63: {lang: 0x3e2, script: 0x20, flags: 0x0}, - 64: {lang: 0x267, script: 0x5a, flags: 0x0}, - 65: {lang: 0x444, script: 0x5a, flags: 0x0}, + 64: {lang: 0x267, script: 0x5b, flags: 0x0}, + 65: {lang: 0x444, script: 0x5b, flags: 0x0}, 66: {lang: 0x512, script: 0x3e, flags: 0x0}, - 67: {lang: 0x412, script: 0x5a, flags: 0x0}, + 67: {lang: 0x412, script: 0x5b, flags: 0x0}, 68: {lang: 0x4ae, script: 0x20, flags: 0x0}, 69: {lang: 0x3a, script: 0x5, flags: 0x0}, - 70: {lang: 0x15e, script: 0x5a, flags: 0x0}, - 71: {lang: 0x15e, script: 0x5a, flags: 0x0}, + 70: {lang: 0x15e, script: 0x5b, flags: 0x0}, + 71: {lang: 0x15e, script: 0x5b, flags: 0x0}, 72: {lang: 0x35, script: 0x5, flags: 0x0}, - 73: {lang: 0x46b, script: 0xeb, flags: 0x0}, + 73: {lang: 0x46b, script: 0xee, flags: 0x0}, 74: {lang: 0x2ec, script: 0x5, flags: 0x0}, - 75: {lang: 0x30f, script: 0x75, flags: 0x0}, + 75: {lang: 0x30f, script: 0x76, flags: 0x0}, 76: {lang: 0x467, script: 0x20, flags: 0x0}, 77: {lang: 0x148, script: 0x5, flags: 0x0}, 78: {lang: 0x3a, script: 0x5, flags: 0x0}, - 79: {lang: 0x15e, script: 0x5a, flags: 0x0}, - 80: {lang: 0x48a, script: 0x5a, flags: 0x0}, + 79: {lang: 0x15e, script: 0x5b, flags: 0x0}, + 80: {lang: 0x48a, script: 0x5b, flags: 0x0}, 81: {lang: 0x58, script: 0x5, flags: 0x0}, 82: {lang: 0x219, script: 0x20, flags: 0x0}, 83: {lang: 0x81, script: 0x34, flags: 0x0}, 84: {lang: 0x529, script: 0x3c, flags: 0x0}, - 85: {lang: 0x48c, script: 0x5a, flags: 0x0}, + 85: {lang: 0x48c, script: 0x5b, flags: 0x0}, 86: {lang: 0x4ae, script: 0x20, flags: 0x0}, 87: {lang: 0x512, script: 0x3e, flags: 0x0}, - 88: {lang: 0x3b3, script: 0x5a, flags: 0x0}, - 89: {lang: 0x431, script: 0x5a, flags: 0x0}, + 88: {lang: 0x3b3, script: 0x5b, flags: 0x0}, + 89: {lang: 0x431, script: 0x5b, flags: 0x0}, 90: {lang: 0x432, script: 0x20, flags: 0x0}, - 91: {lang: 0x15e, script: 0x5a, flags: 0x0}, + 91: {lang: 0x15e, script: 0x5b, flags: 0x0}, 92: {lang: 0x446, script: 0x5, flags: 0x0}, } @@ -3298,38 +3320,38 @@ type likelyTag struct { // Size: 198 bytes, 33 elements var likelyRegionGroup = [33]likelyTag{ - 1: {lang: 0x139, region: 0xd6, script: 0x5a}, - 2: {lang: 0x139, region: 0x135, script: 0x5a}, - 3: {lang: 0x3c0, region: 0x41, script: 0x5a}, - 4: {lang: 0x139, region: 0x2f, script: 0x5a}, - 5: {lang: 0x139, region: 0xd6, script: 0x5a}, - 6: {lang: 0x13e, region: 0xcf, script: 0x5a}, - 7: {lang: 0x445, region: 0x12f, script: 0x5a}, - 8: {lang: 0x3a, region: 0x6b, script: 0x5}, - 9: {lang: 0x445, region: 0x4b, script: 0x5a}, - 10: {lang: 0x139, region: 0x161, script: 0x5a}, - 11: {lang: 0x139, region: 0x135, script: 0x5a}, - 12: {lang: 0x139, region: 0x135, script: 0x5a}, - 13: {lang: 0x13e, region: 0x59, script: 0x5a}, + 1: {lang: 0x139, region: 0xd7, script: 0x5b}, + 2: {lang: 0x139, region: 0x136, script: 0x5b}, + 3: {lang: 0x3c0, region: 0x41, script: 0x5b}, + 4: {lang: 0x139, region: 0x2f, script: 0x5b}, + 5: {lang: 0x139, region: 0xd7, script: 0x5b}, + 6: {lang: 0x13e, region: 0xd0, script: 0x5b}, + 7: {lang: 0x445, region: 0x130, script: 0x5b}, + 8: {lang: 0x3a, region: 0x6c, script: 0x5}, + 9: {lang: 0x445, region: 0x4b, script: 0x5b}, + 10: {lang: 0x139, region: 0x162, script: 0x5b}, + 11: {lang: 0x139, region: 0x136, script: 0x5b}, + 12: {lang: 0x139, region: 0x136, script: 0x5b}, + 13: {lang: 0x13e, region: 0x5a, script: 0x5b}, 14: {lang: 0x529, region: 0x53, script: 0x3b}, - 15: {lang: 0x1be, region: 0x99, script: 0x22}, - 16: {lang: 0x1e1, region: 0x95, script: 0x5a}, - 17: {lang: 0x1f9, region: 0x9e, script: 0x5a}, - 18: {lang: 0x139, region: 0x2f, script: 0x5a}, - 19: {lang: 0x139, region: 0xe6, script: 0x5a}, - 20: {lang: 0x139, region: 0x8a, script: 0x5a}, - 21: {lang: 0x41b, region: 0x142, script: 0x5a}, + 15: {lang: 0x1be, region: 0x9a, script: 0x22}, + 16: {lang: 0x1e1, region: 0x96, script: 0x5b}, + 17: {lang: 0x1f9, region: 0x9f, script: 0x5b}, + 18: {lang: 0x139, region: 0x2f, script: 0x5b}, + 19: {lang: 0x139, region: 0xe7, script: 0x5b}, + 20: {lang: 0x139, region: 0x8b, script: 0x5b}, + 21: {lang: 0x41b, region: 0x143, script: 0x5b}, 22: {lang: 0x529, region: 0x53, script: 0x3b}, - 23: {lang: 0x4bc, region: 0x137, script: 0x5a}, - 24: {lang: 0x3a, region: 0x108, script: 0x5}, - 25: {lang: 0x3e2, region: 0x106, script: 0x20}, - 26: {lang: 0x3e2, region: 0x106, script: 0x20}, - 27: {lang: 0x139, region: 0x7b, script: 0x5a}, - 28: {lang: 0x10d, region: 0x60, script: 0x5a}, - 29: {lang: 0x139, region: 0xd6, script: 0x5a}, - 30: {lang: 0x13e, region: 0x1f, script: 0x5a}, - 31: {lang: 0x139, region: 0x9a, script: 0x5a}, - 32: {lang: 0x139, region: 0x7b, script: 0x5a}, + 23: {lang: 0x4bc, region: 0x138, script: 0x5b}, + 24: {lang: 0x3a, region: 0x109, script: 0x5}, + 25: {lang: 0x3e2, region: 0x107, script: 0x20}, + 26: {lang: 0x3e2, region: 0x107, script: 0x20}, + 27: {lang: 0x139, region: 0x7c, script: 0x5b}, + 28: {lang: 0x10d, region: 0x61, script: 0x5b}, + 29: {lang: 0x139, region: 0xd7, script: 0x5b}, + 30: {lang: 0x13e, region: 0x1f, script: 0x5b}, + 31: {lang: 0x139, region: 0x9b, script: 0x5b}, + 32: {lang: 0x139, region: 0x7c, script: 0x5b}, } // Size: 264 bytes, 33 elements @@ -3350,8 +3372,8 @@ var regionContainment = [33]uint64{ // regionInclusion maps region identifiers to sets of regions in regionInclusionBits, // where each set holds all groupings that are directly connected in a region // containment graph. -// Size: 358 bytes, 358 elements -var regionInclusion = [358]uint8{ +// Size: 359 bytes, 359 elements +var regionInclusion = [359]uint8{ // Entry 0 - 3F 0x00, 0x00, 0x01, 0x02, 0x03, 0x04, 0x05, 0x06, 0x07, 0x08, 0x09, 0x0a, 0x0b, 0x0c, 0x0d, 0x0e, @@ -3364,45 +3386,45 @@ var regionInclusion = [358]uint8{ // Entry 40 - 7F 0x26, 0x28, 0x26, 0x25, 0x31, 0x22, 0x32, 0x33, 0x34, 0x30, 0x22, 0x27, 0x27, 0x27, 0x35, 0x2d, - 0x29, 0x28, 0x27, 0x36, 0x28, 0x22, 0x34, 0x23, - 0x21, 0x26, 0x2d, 0x26, 0x22, 0x37, 0x2e, 0x35, - 0x2a, 0x22, 0x2f, 0x38, 0x26, 0x26, 0x21, 0x39, - 0x39, 0x28, 0x38, 0x39, 0x39, 0x2f, 0x3a, 0x2f, - 0x20, 0x21, 0x38, 0x3b, 0x28, 0x3c, 0x2c, 0x21, - 0x2a, 0x35, 0x27, 0x38, 0x26, 0x24, 0x28, 0x2c, + 0x29, 0x28, 0x27, 0x36, 0x28, 0x22, 0x21, 0x34, + 0x23, 0x21, 0x26, 0x2d, 0x26, 0x22, 0x37, 0x2e, + 0x35, 0x2a, 0x22, 0x2f, 0x38, 0x26, 0x26, 0x21, + 0x39, 0x39, 0x28, 0x38, 0x39, 0x39, 0x2f, 0x3a, + 0x2f, 0x20, 0x21, 0x38, 0x3b, 0x28, 0x3c, 0x2c, + 0x21, 0x2a, 0x35, 0x27, 0x38, 0x26, 0x24, 0x28, // Entry 80 - BF - 0x2d, 0x23, 0x30, 0x2d, 0x2d, 0x26, 0x27, 0x3a, - 0x22, 0x34, 0x3c, 0x2d, 0x28, 0x36, 0x22, 0x34, - 0x3a, 0x26, 0x2e, 0x21, 0x39, 0x31, 0x38, 0x24, - 0x2c, 0x25, 0x22, 0x24, 0x25, 0x2c, 0x3a, 0x2c, - 0x26, 0x24, 0x36, 0x21, 0x2f, 0x3d, 0x31, 0x3c, - 0x2f, 0x26, 0x36, 0x36, 0x24, 0x26, 0x3d, 0x31, - 0x24, 0x26, 0x35, 0x25, 0x2d, 0x32, 0x38, 0x2a, - 0x38, 0x39, 0x39, 0x35, 0x33, 0x23, 0x26, 0x2f, + 0x2c, 0x2d, 0x23, 0x30, 0x2d, 0x2d, 0x26, 0x27, + 0x3a, 0x22, 0x34, 0x3c, 0x2d, 0x28, 0x36, 0x22, + 0x34, 0x3a, 0x26, 0x2e, 0x21, 0x39, 0x31, 0x38, + 0x24, 0x2c, 0x25, 0x22, 0x24, 0x25, 0x2c, 0x3a, + 0x2c, 0x26, 0x24, 0x36, 0x21, 0x2f, 0x3d, 0x31, + 0x3c, 0x2f, 0x26, 0x36, 0x36, 0x24, 0x26, 0x3d, + 0x31, 0x24, 0x26, 0x35, 0x25, 0x2d, 0x32, 0x38, + 0x2a, 0x38, 0x39, 0x39, 0x35, 0x33, 0x23, 0x26, // Entry C0 - FF - 0x3c, 0x21, 0x23, 0x2d, 0x31, 0x36, 0x36, 0x3c, - 0x26, 0x2d, 0x26, 0x3a, 0x2f, 0x25, 0x2f, 0x34, - 0x31, 0x2f, 0x32, 0x3b, 0x2d, 0x2b, 0x2d, 0x21, - 0x34, 0x2a, 0x2c, 0x25, 0x21, 0x3c, 0x24, 0x29, - 0x2b, 0x24, 0x34, 0x21, 0x28, 0x29, 0x3b, 0x31, - 0x25, 0x2e, 0x30, 0x29, 0x26, 0x24, 0x3a, 0x21, - 0x3c, 0x28, 0x21, 0x24, 0x21, 0x21, 0x1f, 0x21, + 0x2f, 0x3c, 0x21, 0x23, 0x2d, 0x31, 0x36, 0x36, + 0x3c, 0x26, 0x2d, 0x26, 0x3a, 0x2f, 0x25, 0x2f, + 0x34, 0x31, 0x2f, 0x32, 0x3b, 0x2d, 0x2b, 0x2d, + 0x21, 0x34, 0x2a, 0x2c, 0x25, 0x21, 0x3c, 0x24, + 0x29, 0x2b, 0x24, 0x34, 0x21, 0x28, 0x29, 0x3b, + 0x31, 0x25, 0x2e, 0x30, 0x29, 0x26, 0x24, 0x3a, + 0x21, 0x3c, 0x28, 0x21, 0x24, 0x21, 0x21, 0x1f, 0x21, 0x21, 0x21, 0x21, 0x21, 0x21, 0x21, 0x21, // Entry 100 - 13F - 0x21, 0x21, 0x2f, 0x21, 0x2e, 0x23, 0x33, 0x2f, - 0x24, 0x3b, 0x2f, 0x39, 0x38, 0x31, 0x2d, 0x3a, - 0x2c, 0x2e, 0x2d, 0x23, 0x2d, 0x2f, 0x28, 0x2f, - 0x27, 0x33, 0x34, 0x26, 0x24, 0x32, 0x22, 0x26, - 0x27, 0x22, 0x2d, 0x31, 0x3d, 0x29, 0x31, 0x3d, - 0x39, 0x29, 0x31, 0x24, 0x26, 0x29, 0x36, 0x2f, - 0x33, 0x2f, 0x21, 0x22, 0x21, 0x30, 0x28, 0x3d, - 0x23, 0x26, 0x21, 0x28, 0x26, 0x26, 0x31, 0x3b, + 0x21, 0x21, 0x21, 0x2f, 0x21, 0x2e, 0x23, 0x33, + 0x2f, 0x24, 0x3b, 0x2f, 0x39, 0x38, 0x31, 0x2d, + 0x3a, 0x2c, 0x2e, 0x2d, 0x23, 0x2d, 0x2f, 0x28, + 0x2f, 0x27, 0x33, 0x34, 0x26, 0x24, 0x32, 0x22, + 0x26, 0x27, 0x22, 0x2d, 0x31, 0x3d, 0x29, 0x31, + 0x3d, 0x39, 0x29, 0x31, 0x24, 0x26, 0x29, 0x36, + 0x2f, 0x33, 0x2f, 0x21, 0x22, 0x21, 0x30, 0x28, + 0x3d, 0x23, 0x26, 0x21, 0x28, 0x26, 0x26, 0x31, // Entry 140 - 17F - 0x29, 0x21, 0x29, 0x21, 0x21, 0x21, 0x21, 0x21, - 0x21, 0x21, 0x21, 0x21, 0x21, 0x23, 0x21, 0x21, + 0x3b, 0x29, 0x21, 0x29, 0x21, 0x21, 0x21, 0x21, + 0x21, 0x21, 0x21, 0x21, 0x21, 0x21, 0x23, 0x21, 0x21, 0x21, 0x21, 0x21, 0x21, 0x21, 0x21, 0x21, - 0x21, 0x21, 0x21, 0x21, 0x21, 0x24, 0x24, 0x2f, - 0x23, 0x32, 0x2f, 0x27, 0x2f, 0x21, + 0x21, 0x21, 0x21, 0x21, 0x21, 0x21, 0x24, 0x24, + 0x2f, 0x23, 0x32, 0x2f, 0x27, 0x2f, 0x21, } // regionInclusionBits is an array of bit vectors where every vector represents @@ -3462,11 +3484,11 @@ type parentRel struct { // Size: 414 bytes, 5 elements var parents = [5]parentRel{ - 0: {lang: 0x139, script: 0x0, maxScript: 0x5a, toRegion: 0x1, fromRegion: []uint16{0x1a, 0x25, 0x26, 0x2f, 0x34, 0x36, 0x3d, 0x42, 0x46, 0x48, 0x49, 0x4a, 0x50, 0x52, 0x5c, 0x5d, 0x61, 0x64, 0x6d, 0x73, 0x74, 0x75, 0x7b, 0x7c, 0x7f, 0x80, 0x81, 0x83, 0x8c, 0x8d, 0x96, 0x97, 0x98, 0x99, 0x9a, 0x9f, 0xa0, 0xa4, 0xa7, 0xa9, 0xad, 0xb1, 0xb4, 0xb5, 0xbf, 0xc6, 0xca, 0xcb, 0xcc, 0xce, 0xd0, 0xd2, 0xd5, 0xd6, 0xdd, 0xdf, 0xe0, 0xe6, 0xe7, 0xe8, 0xeb, 0xf0, 0x107, 0x109, 0x10a, 0x10b, 0x10d, 0x10e, 0x112, 0x117, 0x11b, 0x11d, 0x11f, 0x125, 0x129, 0x12c, 0x12d, 0x12f, 0x131, 0x139, 0x13c, 0x13f, 0x142, 0x161, 0x162, 0x164}}, - 1: {lang: 0x139, script: 0x0, maxScript: 0x5a, toRegion: 0x1a, fromRegion: []uint16{0x2e, 0x4e, 0x60, 0x63, 0x72, 0xd9, 0x10c, 0x10f}}, - 2: {lang: 0x13e, script: 0x0, maxScript: 0x5a, toRegion: 0x1f, fromRegion: []uint16{0x2c, 0x3f, 0x41, 0x48, 0x51, 0x54, 0x56, 0x59, 0x65, 0x69, 0x89, 0x8f, 0xcf, 0xd8, 0xe2, 0xe4, 0xec, 0xf1, 0x11a, 0x135, 0x136, 0x13b}}, - 3: {lang: 0x3c0, script: 0x0, maxScript: 0x5a, toRegion: 0xee, fromRegion: []uint16{0x2a, 0x4e, 0x5a, 0x86, 0x8b, 0xb7, 0xc6, 0xd1, 0x118, 0x126}}, - 4: {lang: 0x529, script: 0x3c, maxScript: 0x3c, toRegion: 0x8d, fromRegion: []uint16{0xc6}}, + 0: {lang: 0x139, script: 0x0, maxScript: 0x5b, toRegion: 0x1, fromRegion: []uint16{0x1a, 0x25, 0x26, 0x2f, 0x34, 0x36, 0x3d, 0x42, 0x46, 0x48, 0x49, 0x4a, 0x50, 0x52, 0x5d, 0x5e, 0x62, 0x65, 0x6e, 0x74, 0x75, 0x76, 0x7c, 0x7d, 0x80, 0x81, 0x82, 0x84, 0x8d, 0x8e, 0x97, 0x98, 0x99, 0x9a, 0x9b, 0xa0, 0xa1, 0xa5, 0xa8, 0xaa, 0xae, 0xb2, 0xb5, 0xb6, 0xc0, 0xc7, 0xcb, 0xcc, 0xcd, 0xcf, 0xd1, 0xd3, 0xd6, 0xd7, 0xde, 0xe0, 0xe1, 0xe7, 0xe8, 0xe9, 0xec, 0xf1, 0x108, 0x10a, 0x10b, 0x10c, 0x10e, 0x10f, 0x113, 0x118, 0x11c, 0x11e, 0x120, 0x126, 0x12a, 0x12d, 0x12e, 0x130, 0x132, 0x13a, 0x13d, 0x140, 0x143, 0x162, 0x163, 0x165}}, + 1: {lang: 0x139, script: 0x0, maxScript: 0x5b, toRegion: 0x1a, fromRegion: []uint16{0x2e, 0x4e, 0x61, 0x64, 0x73, 0xda, 0x10d, 0x110}}, + 2: {lang: 0x13e, script: 0x0, maxScript: 0x5b, toRegion: 0x1f, fromRegion: []uint16{0x2c, 0x3f, 0x41, 0x48, 0x51, 0x54, 0x57, 0x5a, 0x66, 0x6a, 0x8a, 0x90, 0xd0, 0xd9, 0xe3, 0xe5, 0xed, 0xf2, 0x11b, 0x136, 0x137, 0x13c}}, + 3: {lang: 0x3c0, script: 0x0, maxScript: 0x5b, toRegion: 0xef, fromRegion: []uint16{0x2a, 0x4e, 0x5b, 0x87, 0x8c, 0xb8, 0xc7, 0xd2, 0x119, 0x127}}, + 4: {lang: 0x529, script: 0x3c, maxScript: 0x3c, toRegion: 0x8e, fromRegion: []uint16{0xc7}}, } -// Total table size 30244 bytes (29KiB); checksum: B6B15F30 +// Total table size 30466 bytes (29KiB); checksum: 7544152B diff --git a/vendor/golang.org/x/text/language/match.go b/vendor/golang.org/x/text/language/match.go index ee45f494..1153baf2 100644 --- a/vendor/golang.org/x/text/language/match.go +++ b/vendor/golang.org/x/text/language/match.go @@ -434,7 +434,7 @@ func newMatcher(supported []Tag, options []MatchOption) *matcher { // (their canonicalization simply substitutes a different language code, but // nothing else), the match confidence is Exact, otherwise it is High. for i, lm := range language.AliasMap { - // If deprecated codes match and there is no fiddling with the script or + // If deprecated codes match and there is no fiddling with the script // or region, we consider it an exact match. conf := Exact if language.AliasTypes[i] != language.Macro { diff --git a/vendor/golang.org/x/text/language/tables.go b/vendor/golang.org/x/text/language/tables.go index 34a732b6..a6573dcb 100644 --- a/vendor/golang.org/x/text/language/tables.go +++ b/vendor/golang.org/x/text/language/tables.go @@ -23,31 +23,31 @@ const ( _419 = 31 _BR = 65 _CA = 73 - _ES = 110 - _GB = 123 - _MD = 188 - _PT = 238 - _UK = 306 - _US = 309 - _ZZ = 357 - _XA = 323 - _XC = 325 - _XK = 333 + _ES = 111 + _GB = 124 + _MD = 189 + _PT = 239 + _UK = 307 + _US = 310 + _ZZ = 358 + _XA = 324 + _XC = 326 + _XK = 334 ) const ( - _Latn = 90 + _Latn = 91 _Hani = 57 _Hans = 59 _Hant = 60 - _Qaaa = 147 - _Qaai = 155 - _Qabx = 196 - _Zinh = 252 - _Zyyy = 257 - _Zzzz = 258 + _Qaaa = 149 + _Qaai = 157 + _Qabx = 198 + _Zinh = 255 + _Zyyy = 260 + _Zzzz = 261 ) -var regionToGroups = []uint8{ // 358 elements +var regionToGroups = []uint8{ // 359 elements // Entry 0 - 3F 0x00, 0x00, 0x00, 0x04, 0x04, 0x00, 0x00, 0x04, 0x00, 0x00, 0x00, 0x00, 0x04, 0x04, 0x04, 0x00, @@ -60,51 +60,51 @@ var regionToGroups = []uint8{ // 358 elements // Entry 40 - 7F 0x04, 0x04, 0x04, 0x00, 0x00, 0x00, 0x00, 0x00, 0x04, 0x04, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x04, 0x00, 0x00, 0x04, 0x00, 0x04, 0x00, - 0x00, 0x04, 0x00, 0x04, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x00, 0x00, 0x00, 0x04, 0x04, 0x00, 0x08, - 0x00, 0x04, 0x00, 0x00, 0x08, 0x00, 0x00, 0x00, - 0x00, 0x00, 0x00, 0x00, 0x04, 0x00, 0x00, 0x00, - 0x00, 0x00, 0x00, 0x00, 0x04, 0x00, 0x04, 0x00, + 0x00, 0x04, 0x00, 0x00, 0x04, 0x00, 0x00, 0x04, + 0x00, 0x00, 0x04, 0x00, 0x04, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x04, 0x04, 0x00, + 0x08, 0x00, 0x04, 0x00, 0x00, 0x08, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x04, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x04, 0x00, 0x04, // Entry 80 - BF - 0x00, 0x00, 0x04, 0x00, 0x00, 0x04, 0x00, 0x00, - 0x00, 0x04, 0x01, 0x00, 0x04, 0x02, 0x00, 0x04, - 0x00, 0x04, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x04, 0x00, 0x00, 0x04, 0x00, + 0x00, 0x00, 0x04, 0x01, 0x00, 0x04, 0x02, 0x00, + 0x04, 0x00, 0x04, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x04, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x04, 0x00, 0x00, 0x00, 0x04, 0x00, 0x00, 0x00, 0x04, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x08, 0x08, 0x00, 0x00, 0x00, 0x04, 0x00, + 0x00, 0x00, 0x04, 0x00, 0x00, 0x00, 0x04, 0x00, + 0x00, 0x00, 0x04, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x08, 0x08, 0x00, 0x00, 0x00, 0x04, // Entry C0 - FF - 0x01, 0x00, 0x00, 0x00, 0x00, 0x00, 0x02, 0x01, - 0x04, 0x08, 0x04, 0x00, 0x00, 0x00, 0x00, 0x04, - 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x01, 0x00, 0x00, 0x00, 0x00, 0x00, 0x02, + 0x01, 0x04, 0x08, 0x04, 0x00, 0x00, 0x00, 0x00, 0x04, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x00, 0x04, 0x00, 0x04, 0x00, 0x00, 0x00, - 0x00, 0x00, 0x04, 0x00, 0x05, 0x00, 0x00, 0x00, 0x00, 0x04, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x04, 0x00, 0x04, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x04, 0x00, 0x05, 0x00, 0x00, + 0x00, 0x00, 0x04, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, // Entry 100 - 13F 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x04, 0x00, - 0x00, 0x00, 0x04, 0x04, 0x00, 0x00, 0x00, 0x04, - 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x08, 0x00, 0x00, 0x00, 0x04, 0x00, 0x00, 0x00, - 0x00, 0x00, 0x00, 0x01, 0x00, 0x05, 0x04, 0x00, - 0x00, 0x04, 0x00, 0x04, 0x04, 0x05, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x04, + 0x00, 0x00, 0x00, 0x04, 0x04, 0x00, 0x00, 0x00, + 0x04, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x08, 0x00, 0x00, 0x00, 0x04, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x01, 0x00, 0x05, 0x04, + 0x00, 0x00, 0x04, 0x00, 0x04, 0x04, 0x05, 0x00, // Entry 140 - 17F 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, -} // Size: 382 bytes + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, +} // Size: 383 bytes var paradigmLocales = [][3]uint16{ // 3 elements - 0: [3]uint16{0x139, 0x0, 0x7b}, + 0: [3]uint16{0x139, 0x0, 0x7c}, 1: [3]uint16{0x13e, 0x0, 0x1f}, - 2: [3]uint16{0x3c0, 0x41, 0xee}, + 2: [3]uint16{0x3c0, 0x41, 0xef}, } // Size: 42 bytes type mutualIntelligibility struct { @@ -249,30 +249,30 @@ var matchLang = []mutualIntelligibility{ // 113 elements // matchScript holds pairs of scriptIDs where readers of one script // can typically also read the other. Each is associated with a confidence. var matchScript = []scriptIntelligibility{ // 26 elements - 0: {wantLang: 0x432, haveLang: 0x432, wantScript: 0x5a, haveScript: 0x20, distance: 0x5}, - 1: {wantLang: 0x432, haveLang: 0x432, wantScript: 0x20, haveScript: 0x5a, distance: 0x5}, - 2: {wantLang: 0x58, haveLang: 0x3e2, wantScript: 0x5a, haveScript: 0x20, distance: 0xa}, - 3: {wantLang: 0xa5, haveLang: 0x139, wantScript: 0xe, haveScript: 0x5a, distance: 0xa}, + 0: {wantLang: 0x432, haveLang: 0x432, wantScript: 0x5b, haveScript: 0x20, distance: 0x5}, + 1: {wantLang: 0x432, haveLang: 0x432, wantScript: 0x20, haveScript: 0x5b, distance: 0x5}, + 2: {wantLang: 0x58, haveLang: 0x3e2, wantScript: 0x5b, haveScript: 0x20, distance: 0xa}, + 3: {wantLang: 0xa5, haveLang: 0x139, wantScript: 0xe, haveScript: 0x5b, distance: 0xa}, 4: {wantLang: 0x1d7, haveLang: 0x3e2, wantScript: 0x8, haveScript: 0x20, distance: 0xa}, - 5: {wantLang: 0x210, haveLang: 0x139, wantScript: 0x2e, haveScript: 0x5a, distance: 0xa}, - 6: {wantLang: 0x24a, haveLang: 0x139, wantScript: 0x4e, haveScript: 0x5a, distance: 0xa}, - 7: {wantLang: 0x251, haveLang: 0x139, wantScript: 0x52, haveScript: 0x5a, distance: 0xa}, - 8: {wantLang: 0x2b8, haveLang: 0x139, wantScript: 0x57, haveScript: 0x5a, distance: 0xa}, - 9: {wantLang: 0x304, haveLang: 0x139, wantScript: 0x6e, haveScript: 0x5a, distance: 0xa}, - 10: {wantLang: 0x331, haveLang: 0x139, wantScript: 0x75, haveScript: 0x5a, distance: 0xa}, - 11: {wantLang: 0x351, haveLang: 0x139, wantScript: 0x22, haveScript: 0x5a, distance: 0xa}, - 12: {wantLang: 0x395, haveLang: 0x139, wantScript: 0x81, haveScript: 0x5a, distance: 0xa}, - 13: {wantLang: 0x39d, haveLang: 0x139, wantScript: 0x36, haveScript: 0x5a, distance: 0xa}, - 14: {wantLang: 0x3be, haveLang: 0x139, wantScript: 0x5, haveScript: 0x5a, distance: 0xa}, - 15: {wantLang: 0x3fa, haveLang: 0x139, wantScript: 0x5, haveScript: 0x5a, distance: 0xa}, - 16: {wantLang: 0x40c, haveLang: 0x139, wantScript: 0xd4, haveScript: 0x5a, distance: 0xa}, - 17: {wantLang: 0x450, haveLang: 0x139, wantScript: 0xe3, haveScript: 0x5a, distance: 0xa}, - 18: {wantLang: 0x461, haveLang: 0x139, wantScript: 0xe6, haveScript: 0x5a, distance: 0xa}, - 19: {wantLang: 0x46f, haveLang: 0x139, wantScript: 0x2c, haveScript: 0x5a, distance: 0xa}, - 20: {wantLang: 0x476, haveLang: 0x3e2, wantScript: 0x5a, haveScript: 0x20, distance: 0xa}, - 21: {wantLang: 0x4b4, haveLang: 0x139, wantScript: 0x5, haveScript: 0x5a, distance: 0xa}, - 22: {wantLang: 0x4bc, haveLang: 0x3e2, wantScript: 0x5a, haveScript: 0x20, distance: 0xa}, - 23: {wantLang: 0x512, haveLang: 0x139, wantScript: 0x3e, haveScript: 0x5a, distance: 0xa}, + 5: {wantLang: 0x210, haveLang: 0x139, wantScript: 0x2e, haveScript: 0x5b, distance: 0xa}, + 6: {wantLang: 0x24a, haveLang: 0x139, wantScript: 0x4f, haveScript: 0x5b, distance: 0xa}, + 7: {wantLang: 0x251, haveLang: 0x139, wantScript: 0x53, haveScript: 0x5b, distance: 0xa}, + 8: {wantLang: 0x2b8, haveLang: 0x139, wantScript: 0x58, haveScript: 0x5b, distance: 0xa}, + 9: {wantLang: 0x304, haveLang: 0x139, wantScript: 0x6f, haveScript: 0x5b, distance: 0xa}, + 10: {wantLang: 0x331, haveLang: 0x139, wantScript: 0x76, haveScript: 0x5b, distance: 0xa}, + 11: {wantLang: 0x351, haveLang: 0x139, wantScript: 0x22, haveScript: 0x5b, distance: 0xa}, + 12: {wantLang: 0x395, haveLang: 0x139, wantScript: 0x83, haveScript: 0x5b, distance: 0xa}, + 13: {wantLang: 0x39d, haveLang: 0x139, wantScript: 0x36, haveScript: 0x5b, distance: 0xa}, + 14: {wantLang: 0x3be, haveLang: 0x139, wantScript: 0x5, haveScript: 0x5b, distance: 0xa}, + 15: {wantLang: 0x3fa, haveLang: 0x139, wantScript: 0x5, haveScript: 0x5b, distance: 0xa}, + 16: {wantLang: 0x40c, haveLang: 0x139, wantScript: 0xd6, haveScript: 0x5b, distance: 0xa}, + 17: {wantLang: 0x450, haveLang: 0x139, wantScript: 0xe6, haveScript: 0x5b, distance: 0xa}, + 18: {wantLang: 0x461, haveLang: 0x139, wantScript: 0xe9, haveScript: 0x5b, distance: 0xa}, + 19: {wantLang: 0x46f, haveLang: 0x139, wantScript: 0x2c, haveScript: 0x5b, distance: 0xa}, + 20: {wantLang: 0x476, haveLang: 0x3e2, wantScript: 0x5b, haveScript: 0x20, distance: 0xa}, + 21: {wantLang: 0x4b4, haveLang: 0x139, wantScript: 0x5, haveScript: 0x5b, distance: 0xa}, + 22: {wantLang: 0x4bc, haveLang: 0x3e2, wantScript: 0x5b, haveScript: 0x20, distance: 0xa}, + 23: {wantLang: 0x512, haveLang: 0x139, wantScript: 0x3e, haveScript: 0x5b, distance: 0xa}, 24: {wantLang: 0x529, haveLang: 0x529, wantScript: 0x3b, haveScript: 0x3c, distance: 0xf}, 25: {wantLang: 0x529, haveLang: 0x529, wantScript: 0x3c, haveScript: 0x3b, distance: 0x13}, } // Size: 232 bytes @@ -295,4 +295,4 @@ var matchRegion = []regionIntelligibility{ // 15 elements 14: {lang: 0x529, script: 0x3c, group: 0x80, distance: 0x5}, } // Size: 114 bytes -// Total table size 1472 bytes (1KiB); checksum: F86C669 +// Total table size 1473 bytes (1KiB); checksum: 7BB90B5C diff --git a/vendor/golang.org/x/text/unicode/bidi/tables13.0.0.go b/vendor/golang.org/x/text/unicode/bidi/tables13.0.0.go index f248effa..ffadb7be 100644 --- a/vendor/golang.org/x/text/unicode/bidi/tables13.0.0.go +++ b/vendor/golang.org/x/text/unicode/bidi/tables13.0.0.go @@ -1,7 +1,7 @@ // Code generated by running "go generate" in golang.org/x/text. DO NOT EDIT. -//go:build go1.16 -// +build go1.16 +//go:build go1.16 && !go1.21 +// +build go1.16,!go1.21 package bidi diff --git a/vendor/golang.org/x/text/unicode/bidi/tables15.0.0.go b/vendor/golang.org/x/text/unicode/bidi/tables15.0.0.go new file mode 100644 index 00000000..92cce580 --- /dev/null +++ b/vendor/golang.org/x/text/unicode/bidi/tables15.0.0.go @@ -0,0 +1,2043 @@ +// Code generated by running "go generate" in golang.org/x/text. DO NOT EDIT. + +//go:build go1.21 +// +build go1.21 + +package bidi + +// UnicodeVersion is the Unicode version from which the tables in this package are derived. +const UnicodeVersion = "15.0.0" + +// xorMasks contains masks to be xor-ed with brackets to get the reverse +// version. +var xorMasks = []int32{ // 8 elements + 0, 1, 6, 7, 3, 15, 29, 63, +} // Size: 56 bytes + +// lookup returns the trie value for the first UTF-8 encoding in s and +// the width in bytes of this encoding. The size will be 0 if s does not +// hold enough bytes to complete the encoding. len(s) must be greater than 0. +func (t *bidiTrie) lookup(s []byte) (v uint8, sz int) { + c0 := s[0] + switch { + case c0 < 0x80: // is ASCII + return bidiValues[c0], 1 + case c0 < 0xC2: + return 0, 1 // Illegal UTF-8: not a starter, not ASCII. + case c0 < 0xE0: // 2-byte UTF-8 + if len(s) < 2 { + return 0, 0 + } + i := bidiIndex[c0] + c1 := s[1] + if c1 < 0x80 || 0xC0 <= c1 { + return 0, 1 // Illegal UTF-8: not a continuation byte. + } + return t.lookupValue(uint32(i), c1), 2 + case c0 < 0xF0: // 3-byte UTF-8 + if len(s) < 3 { + return 0, 0 + } + i := bidiIndex[c0] + c1 := s[1] + if c1 < 0x80 || 0xC0 <= c1 { + return 0, 1 // Illegal UTF-8: not a continuation byte. + } + o := uint32(i)<<6 + uint32(c1) + i = bidiIndex[o] + c2 := s[2] + if c2 < 0x80 || 0xC0 <= c2 { + return 0, 2 // Illegal UTF-8: not a continuation byte. + } + return t.lookupValue(uint32(i), c2), 3 + case c0 < 0xF8: // 4-byte UTF-8 + if len(s) < 4 { + return 0, 0 + } + i := bidiIndex[c0] + c1 := s[1] + if c1 < 0x80 || 0xC0 <= c1 { + return 0, 1 // Illegal UTF-8: not a continuation byte. + } + o := uint32(i)<<6 + uint32(c1) + i = bidiIndex[o] + c2 := s[2] + if c2 < 0x80 || 0xC0 <= c2 { + return 0, 2 // Illegal UTF-8: not a continuation byte. + } + o = uint32(i)<<6 + uint32(c2) + i = bidiIndex[o] + c3 := s[3] + if c3 < 0x80 || 0xC0 <= c3 { + return 0, 3 // Illegal UTF-8: not a continuation byte. + } + return t.lookupValue(uint32(i), c3), 4 + } + // Illegal rune + return 0, 1 +} + +// lookupUnsafe returns the trie value for the first UTF-8 encoding in s. +// s must start with a full and valid UTF-8 encoded rune. +func (t *bidiTrie) lookupUnsafe(s []byte) uint8 { + c0 := s[0] + if c0 < 0x80 { // is ASCII + return bidiValues[c0] + } + i := bidiIndex[c0] + if c0 < 0xE0 { // 2-byte UTF-8 + return t.lookupValue(uint32(i), s[1]) + } + i = bidiIndex[uint32(i)<<6+uint32(s[1])] + if c0 < 0xF0 { // 3-byte UTF-8 + return t.lookupValue(uint32(i), s[2]) + } + i = bidiIndex[uint32(i)<<6+uint32(s[2])] + if c0 < 0xF8 { // 4-byte UTF-8 + return t.lookupValue(uint32(i), s[3]) + } + return 0 +} + +// lookupString returns the trie value for the first UTF-8 encoding in s and +// the width in bytes of this encoding. The size will be 0 if s does not +// hold enough bytes to complete the encoding. len(s) must be greater than 0. +func (t *bidiTrie) lookupString(s string) (v uint8, sz int) { + c0 := s[0] + switch { + case c0 < 0x80: // is ASCII + return bidiValues[c0], 1 + case c0 < 0xC2: + return 0, 1 // Illegal UTF-8: not a starter, not ASCII. + case c0 < 0xE0: // 2-byte UTF-8 + if len(s) < 2 { + return 0, 0 + } + i := bidiIndex[c0] + c1 := s[1] + if c1 < 0x80 || 0xC0 <= c1 { + return 0, 1 // Illegal UTF-8: not a continuation byte. + } + return t.lookupValue(uint32(i), c1), 2 + case c0 < 0xF0: // 3-byte UTF-8 + if len(s) < 3 { + return 0, 0 + } + i := bidiIndex[c0] + c1 := s[1] + if c1 < 0x80 || 0xC0 <= c1 { + return 0, 1 // Illegal UTF-8: not a continuation byte. + } + o := uint32(i)<<6 + uint32(c1) + i = bidiIndex[o] + c2 := s[2] + if c2 < 0x80 || 0xC0 <= c2 { + return 0, 2 // Illegal UTF-8: not a continuation byte. + } + return t.lookupValue(uint32(i), c2), 3 + case c0 < 0xF8: // 4-byte UTF-8 + if len(s) < 4 { + return 0, 0 + } + i := bidiIndex[c0] + c1 := s[1] + if c1 < 0x80 || 0xC0 <= c1 { + return 0, 1 // Illegal UTF-8: not a continuation byte. + } + o := uint32(i)<<6 + uint32(c1) + i = bidiIndex[o] + c2 := s[2] + if c2 < 0x80 || 0xC0 <= c2 { + return 0, 2 // Illegal UTF-8: not a continuation byte. + } + o = uint32(i)<<6 + uint32(c2) + i = bidiIndex[o] + c3 := s[3] + if c3 < 0x80 || 0xC0 <= c3 { + return 0, 3 // Illegal UTF-8: not a continuation byte. + } + return t.lookupValue(uint32(i), c3), 4 + } + // Illegal rune + return 0, 1 +} + +// lookupStringUnsafe returns the trie value for the first UTF-8 encoding in s. +// s must start with a full and valid UTF-8 encoded rune. +func (t *bidiTrie) lookupStringUnsafe(s string) uint8 { + c0 := s[0] + if c0 < 0x80 { // is ASCII + return bidiValues[c0] + } + i := bidiIndex[c0] + if c0 < 0xE0 { // 2-byte UTF-8 + return t.lookupValue(uint32(i), s[1]) + } + i = bidiIndex[uint32(i)<<6+uint32(s[1])] + if c0 < 0xF0 { // 3-byte UTF-8 + return t.lookupValue(uint32(i), s[2]) + } + i = bidiIndex[uint32(i)<<6+uint32(s[2])] + if c0 < 0xF8 { // 4-byte UTF-8 + return t.lookupValue(uint32(i), s[3]) + } + return 0 +} + +// bidiTrie. Total size: 19904 bytes (19.44 KiB). Checksum: b1f201ed2debb6c8. +type bidiTrie struct{} + +func newBidiTrie(i int) *bidiTrie { + return &bidiTrie{} +} + +// lookupValue determines the type of block n and looks up the value for b. +func (t *bidiTrie) lookupValue(n uint32, b byte) uint8 { + switch { + default: + return uint8(bidiValues[n<<6+uint32(b)]) + } +} + +// bidiValues: 259 blocks, 16576 entries, 16576 bytes +// The third block is the zero block. +var bidiValues = [16576]uint8{ + // Block 0x0, offset 0x0 + 0x00: 0x000b, 0x01: 0x000b, 0x02: 0x000b, 0x03: 0x000b, 0x04: 0x000b, 0x05: 0x000b, + 0x06: 0x000b, 0x07: 0x000b, 0x08: 0x000b, 0x09: 0x0008, 0x0a: 0x0007, 0x0b: 0x0008, + 0x0c: 0x0009, 0x0d: 0x0007, 0x0e: 0x000b, 0x0f: 0x000b, 0x10: 0x000b, 0x11: 0x000b, + 0x12: 0x000b, 0x13: 0x000b, 0x14: 0x000b, 0x15: 0x000b, 0x16: 0x000b, 0x17: 0x000b, + 0x18: 0x000b, 0x19: 0x000b, 0x1a: 0x000b, 0x1b: 0x000b, 0x1c: 0x0007, 0x1d: 0x0007, + 0x1e: 0x0007, 0x1f: 0x0008, 0x20: 0x0009, 0x21: 0x000a, 0x22: 0x000a, 0x23: 0x0004, + 0x24: 0x0004, 0x25: 0x0004, 0x26: 0x000a, 0x27: 0x000a, 0x28: 0x003a, 0x29: 0x002a, + 0x2a: 0x000a, 0x2b: 0x0003, 0x2c: 0x0006, 0x2d: 0x0003, 0x2e: 0x0006, 0x2f: 0x0006, + 0x30: 0x0002, 0x31: 0x0002, 0x32: 0x0002, 0x33: 0x0002, 0x34: 0x0002, 0x35: 0x0002, + 0x36: 0x0002, 0x37: 0x0002, 0x38: 0x0002, 0x39: 0x0002, 0x3a: 0x0006, 0x3b: 0x000a, + 0x3c: 0x000a, 0x3d: 0x000a, 0x3e: 0x000a, 0x3f: 0x000a, + // Block 0x1, offset 0x40 + 0x40: 0x000a, + 0x5b: 0x005a, 0x5c: 0x000a, 0x5d: 0x004a, + 0x5e: 0x000a, 0x5f: 0x000a, 0x60: 0x000a, + 0x7b: 0x005a, + 0x7c: 0x000a, 0x7d: 0x004a, 0x7e: 0x000a, 0x7f: 0x000b, + // Block 0x2, offset 0x80 + // Block 0x3, offset 0xc0 + 0xc0: 0x000b, 0xc1: 0x000b, 0xc2: 0x000b, 0xc3: 0x000b, 0xc4: 0x000b, 0xc5: 0x0007, + 0xc6: 0x000b, 0xc7: 0x000b, 0xc8: 0x000b, 0xc9: 0x000b, 0xca: 0x000b, 0xcb: 0x000b, + 0xcc: 0x000b, 0xcd: 0x000b, 0xce: 0x000b, 0xcf: 0x000b, 0xd0: 0x000b, 0xd1: 0x000b, + 0xd2: 0x000b, 0xd3: 0x000b, 0xd4: 0x000b, 0xd5: 0x000b, 0xd6: 0x000b, 0xd7: 0x000b, + 0xd8: 0x000b, 0xd9: 0x000b, 0xda: 0x000b, 0xdb: 0x000b, 0xdc: 0x000b, 0xdd: 0x000b, + 0xde: 0x000b, 0xdf: 0x000b, 0xe0: 0x0006, 0xe1: 0x000a, 0xe2: 0x0004, 0xe3: 0x0004, + 0xe4: 0x0004, 0xe5: 0x0004, 0xe6: 0x000a, 0xe7: 0x000a, 0xe8: 0x000a, 0xe9: 0x000a, + 0xeb: 0x000a, 0xec: 0x000a, 0xed: 0x000b, 0xee: 0x000a, 0xef: 0x000a, + 0xf0: 0x0004, 0xf1: 0x0004, 0xf2: 0x0002, 0xf3: 0x0002, 0xf4: 0x000a, + 0xf6: 0x000a, 0xf7: 0x000a, 0xf8: 0x000a, 0xf9: 0x0002, 0xfb: 0x000a, + 0xfc: 0x000a, 0xfd: 0x000a, 0xfe: 0x000a, 0xff: 0x000a, + // Block 0x4, offset 0x100 + 0x117: 0x000a, + 0x137: 0x000a, + // Block 0x5, offset 0x140 + 0x179: 0x000a, 0x17a: 0x000a, + // Block 0x6, offset 0x180 + 0x182: 0x000a, 0x183: 0x000a, 0x184: 0x000a, 0x185: 0x000a, + 0x186: 0x000a, 0x187: 0x000a, 0x188: 0x000a, 0x189: 0x000a, 0x18a: 0x000a, 0x18b: 0x000a, + 0x18c: 0x000a, 0x18d: 0x000a, 0x18e: 0x000a, 0x18f: 0x000a, + 0x192: 0x000a, 0x193: 0x000a, 0x194: 0x000a, 0x195: 0x000a, 0x196: 0x000a, 0x197: 0x000a, + 0x198: 0x000a, 0x199: 0x000a, 0x19a: 0x000a, 0x19b: 0x000a, 0x19c: 0x000a, 0x19d: 0x000a, + 0x19e: 0x000a, 0x19f: 0x000a, + 0x1a5: 0x000a, 0x1a6: 0x000a, 0x1a7: 0x000a, 0x1a8: 0x000a, 0x1a9: 0x000a, + 0x1aa: 0x000a, 0x1ab: 0x000a, 0x1ac: 0x000a, 0x1ad: 0x000a, 0x1af: 0x000a, + 0x1b0: 0x000a, 0x1b1: 0x000a, 0x1b2: 0x000a, 0x1b3: 0x000a, 0x1b4: 0x000a, 0x1b5: 0x000a, + 0x1b6: 0x000a, 0x1b7: 0x000a, 0x1b8: 0x000a, 0x1b9: 0x000a, 0x1ba: 0x000a, 0x1bb: 0x000a, + 0x1bc: 0x000a, 0x1bd: 0x000a, 0x1be: 0x000a, 0x1bf: 0x000a, + // Block 0x7, offset 0x1c0 + 0x1c0: 0x000c, 0x1c1: 0x000c, 0x1c2: 0x000c, 0x1c3: 0x000c, 0x1c4: 0x000c, 0x1c5: 0x000c, + 0x1c6: 0x000c, 0x1c7: 0x000c, 0x1c8: 0x000c, 0x1c9: 0x000c, 0x1ca: 0x000c, 0x1cb: 0x000c, + 0x1cc: 0x000c, 0x1cd: 0x000c, 0x1ce: 0x000c, 0x1cf: 0x000c, 0x1d0: 0x000c, 0x1d1: 0x000c, + 0x1d2: 0x000c, 0x1d3: 0x000c, 0x1d4: 0x000c, 0x1d5: 0x000c, 0x1d6: 0x000c, 0x1d7: 0x000c, + 0x1d8: 0x000c, 0x1d9: 0x000c, 0x1da: 0x000c, 0x1db: 0x000c, 0x1dc: 0x000c, 0x1dd: 0x000c, + 0x1de: 0x000c, 0x1df: 0x000c, 0x1e0: 0x000c, 0x1e1: 0x000c, 0x1e2: 0x000c, 0x1e3: 0x000c, + 0x1e4: 0x000c, 0x1e5: 0x000c, 0x1e6: 0x000c, 0x1e7: 0x000c, 0x1e8: 0x000c, 0x1e9: 0x000c, + 0x1ea: 0x000c, 0x1eb: 0x000c, 0x1ec: 0x000c, 0x1ed: 0x000c, 0x1ee: 0x000c, 0x1ef: 0x000c, + 0x1f0: 0x000c, 0x1f1: 0x000c, 0x1f2: 0x000c, 0x1f3: 0x000c, 0x1f4: 0x000c, 0x1f5: 0x000c, + 0x1f6: 0x000c, 0x1f7: 0x000c, 0x1f8: 0x000c, 0x1f9: 0x000c, 0x1fa: 0x000c, 0x1fb: 0x000c, + 0x1fc: 0x000c, 0x1fd: 0x000c, 0x1fe: 0x000c, 0x1ff: 0x000c, + // Block 0x8, offset 0x200 + 0x200: 0x000c, 0x201: 0x000c, 0x202: 0x000c, 0x203: 0x000c, 0x204: 0x000c, 0x205: 0x000c, + 0x206: 0x000c, 0x207: 0x000c, 0x208: 0x000c, 0x209: 0x000c, 0x20a: 0x000c, 0x20b: 0x000c, + 0x20c: 0x000c, 0x20d: 0x000c, 0x20e: 0x000c, 0x20f: 0x000c, 0x210: 0x000c, 0x211: 0x000c, + 0x212: 0x000c, 0x213: 0x000c, 0x214: 0x000c, 0x215: 0x000c, 0x216: 0x000c, 0x217: 0x000c, + 0x218: 0x000c, 0x219: 0x000c, 0x21a: 0x000c, 0x21b: 0x000c, 0x21c: 0x000c, 0x21d: 0x000c, + 0x21e: 0x000c, 0x21f: 0x000c, 0x220: 0x000c, 0x221: 0x000c, 0x222: 0x000c, 0x223: 0x000c, + 0x224: 0x000c, 0x225: 0x000c, 0x226: 0x000c, 0x227: 0x000c, 0x228: 0x000c, 0x229: 0x000c, + 0x22a: 0x000c, 0x22b: 0x000c, 0x22c: 0x000c, 0x22d: 0x000c, 0x22e: 0x000c, 0x22f: 0x000c, + 0x234: 0x000a, 0x235: 0x000a, + 0x23e: 0x000a, + // Block 0x9, offset 0x240 + 0x244: 0x000a, 0x245: 0x000a, + 0x247: 0x000a, + // Block 0xa, offset 0x280 + 0x2b6: 0x000a, + // Block 0xb, offset 0x2c0 + 0x2c3: 0x000c, 0x2c4: 0x000c, 0x2c5: 0x000c, + 0x2c6: 0x000c, 0x2c7: 0x000c, 0x2c8: 0x000c, 0x2c9: 0x000c, + // Block 0xc, offset 0x300 + 0x30a: 0x000a, + 0x30d: 0x000a, 0x30e: 0x000a, 0x30f: 0x0004, 0x310: 0x0001, 0x311: 0x000c, + 0x312: 0x000c, 0x313: 0x000c, 0x314: 0x000c, 0x315: 0x000c, 0x316: 0x000c, 0x317: 0x000c, + 0x318: 0x000c, 0x319: 0x000c, 0x31a: 0x000c, 0x31b: 0x000c, 0x31c: 0x000c, 0x31d: 0x000c, + 0x31e: 0x000c, 0x31f: 0x000c, 0x320: 0x000c, 0x321: 0x000c, 0x322: 0x000c, 0x323: 0x000c, + 0x324: 0x000c, 0x325: 0x000c, 0x326: 0x000c, 0x327: 0x000c, 0x328: 0x000c, 0x329: 0x000c, + 0x32a: 0x000c, 0x32b: 0x000c, 0x32c: 0x000c, 0x32d: 0x000c, 0x32e: 0x000c, 0x32f: 0x000c, + 0x330: 0x000c, 0x331: 0x000c, 0x332: 0x000c, 0x333: 0x000c, 0x334: 0x000c, 0x335: 0x000c, + 0x336: 0x000c, 0x337: 0x000c, 0x338: 0x000c, 0x339: 0x000c, 0x33a: 0x000c, 0x33b: 0x000c, + 0x33c: 0x000c, 0x33d: 0x000c, 0x33e: 0x0001, 0x33f: 0x000c, + // Block 0xd, offset 0x340 + 0x340: 0x0001, 0x341: 0x000c, 0x342: 0x000c, 0x343: 0x0001, 0x344: 0x000c, 0x345: 0x000c, + 0x346: 0x0001, 0x347: 0x000c, 0x348: 0x0001, 0x349: 0x0001, 0x34a: 0x0001, 0x34b: 0x0001, + 0x34c: 0x0001, 0x34d: 0x0001, 0x34e: 0x0001, 0x34f: 0x0001, 0x350: 0x0001, 0x351: 0x0001, + 0x352: 0x0001, 0x353: 0x0001, 0x354: 0x0001, 0x355: 0x0001, 0x356: 0x0001, 0x357: 0x0001, + 0x358: 0x0001, 0x359: 0x0001, 0x35a: 0x0001, 0x35b: 0x0001, 0x35c: 0x0001, 0x35d: 0x0001, + 0x35e: 0x0001, 0x35f: 0x0001, 0x360: 0x0001, 0x361: 0x0001, 0x362: 0x0001, 0x363: 0x0001, + 0x364: 0x0001, 0x365: 0x0001, 0x366: 0x0001, 0x367: 0x0001, 0x368: 0x0001, 0x369: 0x0001, + 0x36a: 0x0001, 0x36b: 0x0001, 0x36c: 0x0001, 0x36d: 0x0001, 0x36e: 0x0001, 0x36f: 0x0001, + 0x370: 0x0001, 0x371: 0x0001, 0x372: 0x0001, 0x373: 0x0001, 0x374: 0x0001, 0x375: 0x0001, + 0x376: 0x0001, 0x377: 0x0001, 0x378: 0x0001, 0x379: 0x0001, 0x37a: 0x0001, 0x37b: 0x0001, + 0x37c: 0x0001, 0x37d: 0x0001, 0x37e: 0x0001, 0x37f: 0x0001, + // Block 0xe, offset 0x380 + 0x380: 0x0005, 0x381: 0x0005, 0x382: 0x0005, 0x383: 0x0005, 0x384: 0x0005, 0x385: 0x0005, + 0x386: 0x000a, 0x387: 0x000a, 0x388: 0x000d, 0x389: 0x0004, 0x38a: 0x0004, 0x38b: 0x000d, + 0x38c: 0x0006, 0x38d: 0x000d, 0x38e: 0x000a, 0x38f: 0x000a, 0x390: 0x000c, 0x391: 0x000c, + 0x392: 0x000c, 0x393: 0x000c, 0x394: 0x000c, 0x395: 0x000c, 0x396: 0x000c, 0x397: 0x000c, + 0x398: 0x000c, 0x399: 0x000c, 0x39a: 0x000c, 0x39b: 0x000d, 0x39c: 0x000d, 0x39d: 0x000d, + 0x39e: 0x000d, 0x39f: 0x000d, 0x3a0: 0x000d, 0x3a1: 0x000d, 0x3a2: 0x000d, 0x3a3: 0x000d, + 0x3a4: 0x000d, 0x3a5: 0x000d, 0x3a6: 0x000d, 0x3a7: 0x000d, 0x3a8: 0x000d, 0x3a9: 0x000d, + 0x3aa: 0x000d, 0x3ab: 0x000d, 0x3ac: 0x000d, 0x3ad: 0x000d, 0x3ae: 0x000d, 0x3af: 0x000d, + 0x3b0: 0x000d, 0x3b1: 0x000d, 0x3b2: 0x000d, 0x3b3: 0x000d, 0x3b4: 0x000d, 0x3b5: 0x000d, + 0x3b6: 0x000d, 0x3b7: 0x000d, 0x3b8: 0x000d, 0x3b9: 0x000d, 0x3ba: 0x000d, 0x3bb: 0x000d, + 0x3bc: 0x000d, 0x3bd: 0x000d, 0x3be: 0x000d, 0x3bf: 0x000d, + // Block 0xf, offset 0x3c0 + 0x3c0: 0x000d, 0x3c1: 0x000d, 0x3c2: 0x000d, 0x3c3: 0x000d, 0x3c4: 0x000d, 0x3c5: 0x000d, + 0x3c6: 0x000d, 0x3c7: 0x000d, 0x3c8: 0x000d, 0x3c9: 0x000d, 0x3ca: 0x000d, 0x3cb: 0x000c, + 0x3cc: 0x000c, 0x3cd: 0x000c, 0x3ce: 0x000c, 0x3cf: 0x000c, 0x3d0: 0x000c, 0x3d1: 0x000c, + 0x3d2: 0x000c, 0x3d3: 0x000c, 0x3d4: 0x000c, 0x3d5: 0x000c, 0x3d6: 0x000c, 0x3d7: 0x000c, + 0x3d8: 0x000c, 0x3d9: 0x000c, 0x3da: 0x000c, 0x3db: 0x000c, 0x3dc: 0x000c, 0x3dd: 0x000c, + 0x3de: 0x000c, 0x3df: 0x000c, 0x3e0: 0x0005, 0x3e1: 0x0005, 0x3e2: 0x0005, 0x3e3: 0x0005, + 0x3e4: 0x0005, 0x3e5: 0x0005, 0x3e6: 0x0005, 0x3e7: 0x0005, 0x3e8: 0x0005, 0x3e9: 0x0005, + 0x3ea: 0x0004, 0x3eb: 0x0005, 0x3ec: 0x0005, 0x3ed: 0x000d, 0x3ee: 0x000d, 0x3ef: 0x000d, + 0x3f0: 0x000c, 0x3f1: 0x000d, 0x3f2: 0x000d, 0x3f3: 0x000d, 0x3f4: 0x000d, 0x3f5: 0x000d, + 0x3f6: 0x000d, 0x3f7: 0x000d, 0x3f8: 0x000d, 0x3f9: 0x000d, 0x3fa: 0x000d, 0x3fb: 0x000d, + 0x3fc: 0x000d, 0x3fd: 0x000d, 0x3fe: 0x000d, 0x3ff: 0x000d, + // Block 0x10, offset 0x400 + 0x400: 0x000d, 0x401: 0x000d, 0x402: 0x000d, 0x403: 0x000d, 0x404: 0x000d, 0x405: 0x000d, + 0x406: 0x000d, 0x407: 0x000d, 0x408: 0x000d, 0x409: 0x000d, 0x40a: 0x000d, 0x40b: 0x000d, + 0x40c: 0x000d, 0x40d: 0x000d, 0x40e: 0x000d, 0x40f: 0x000d, 0x410: 0x000d, 0x411: 0x000d, + 0x412: 0x000d, 0x413: 0x000d, 0x414: 0x000d, 0x415: 0x000d, 0x416: 0x000d, 0x417: 0x000d, + 0x418: 0x000d, 0x419: 0x000d, 0x41a: 0x000d, 0x41b: 0x000d, 0x41c: 0x000d, 0x41d: 0x000d, + 0x41e: 0x000d, 0x41f: 0x000d, 0x420: 0x000d, 0x421: 0x000d, 0x422: 0x000d, 0x423: 0x000d, + 0x424: 0x000d, 0x425: 0x000d, 0x426: 0x000d, 0x427: 0x000d, 0x428: 0x000d, 0x429: 0x000d, + 0x42a: 0x000d, 0x42b: 0x000d, 0x42c: 0x000d, 0x42d: 0x000d, 0x42e: 0x000d, 0x42f: 0x000d, + 0x430: 0x000d, 0x431: 0x000d, 0x432: 0x000d, 0x433: 0x000d, 0x434: 0x000d, 0x435: 0x000d, + 0x436: 0x000d, 0x437: 0x000d, 0x438: 0x000d, 0x439: 0x000d, 0x43a: 0x000d, 0x43b: 0x000d, + 0x43c: 0x000d, 0x43d: 0x000d, 0x43e: 0x000d, 0x43f: 0x000d, + // Block 0x11, offset 0x440 + 0x440: 0x000d, 0x441: 0x000d, 0x442: 0x000d, 0x443: 0x000d, 0x444: 0x000d, 0x445: 0x000d, + 0x446: 0x000d, 0x447: 0x000d, 0x448: 0x000d, 0x449: 0x000d, 0x44a: 0x000d, 0x44b: 0x000d, + 0x44c: 0x000d, 0x44d: 0x000d, 0x44e: 0x000d, 0x44f: 0x000d, 0x450: 0x000d, 0x451: 0x000d, + 0x452: 0x000d, 0x453: 0x000d, 0x454: 0x000d, 0x455: 0x000d, 0x456: 0x000c, 0x457: 0x000c, + 0x458: 0x000c, 0x459: 0x000c, 0x45a: 0x000c, 0x45b: 0x000c, 0x45c: 0x000c, 0x45d: 0x0005, + 0x45e: 0x000a, 0x45f: 0x000c, 0x460: 0x000c, 0x461: 0x000c, 0x462: 0x000c, 0x463: 0x000c, + 0x464: 0x000c, 0x465: 0x000d, 0x466: 0x000d, 0x467: 0x000c, 0x468: 0x000c, 0x469: 0x000a, + 0x46a: 0x000c, 0x46b: 0x000c, 0x46c: 0x000c, 0x46d: 0x000c, 0x46e: 0x000d, 0x46f: 0x000d, + 0x470: 0x0002, 0x471: 0x0002, 0x472: 0x0002, 0x473: 0x0002, 0x474: 0x0002, 0x475: 0x0002, + 0x476: 0x0002, 0x477: 0x0002, 0x478: 0x0002, 0x479: 0x0002, 0x47a: 0x000d, 0x47b: 0x000d, + 0x47c: 0x000d, 0x47d: 0x000d, 0x47e: 0x000d, 0x47f: 0x000d, + // Block 0x12, offset 0x480 + 0x480: 0x000d, 0x481: 0x000d, 0x482: 0x000d, 0x483: 0x000d, 0x484: 0x000d, 0x485: 0x000d, + 0x486: 0x000d, 0x487: 0x000d, 0x488: 0x000d, 0x489: 0x000d, 0x48a: 0x000d, 0x48b: 0x000d, + 0x48c: 0x000d, 0x48d: 0x000d, 0x48e: 0x000d, 0x48f: 0x000d, 0x490: 0x000d, 0x491: 0x000c, + 0x492: 0x000d, 0x493: 0x000d, 0x494: 0x000d, 0x495: 0x000d, 0x496: 0x000d, 0x497: 0x000d, + 0x498: 0x000d, 0x499: 0x000d, 0x49a: 0x000d, 0x49b: 0x000d, 0x49c: 0x000d, 0x49d: 0x000d, + 0x49e: 0x000d, 0x49f: 0x000d, 0x4a0: 0x000d, 0x4a1: 0x000d, 0x4a2: 0x000d, 0x4a3: 0x000d, + 0x4a4: 0x000d, 0x4a5: 0x000d, 0x4a6: 0x000d, 0x4a7: 0x000d, 0x4a8: 0x000d, 0x4a9: 0x000d, + 0x4aa: 0x000d, 0x4ab: 0x000d, 0x4ac: 0x000d, 0x4ad: 0x000d, 0x4ae: 0x000d, 0x4af: 0x000d, + 0x4b0: 0x000c, 0x4b1: 0x000c, 0x4b2: 0x000c, 0x4b3: 0x000c, 0x4b4: 0x000c, 0x4b5: 0x000c, + 0x4b6: 0x000c, 0x4b7: 0x000c, 0x4b8: 0x000c, 0x4b9: 0x000c, 0x4ba: 0x000c, 0x4bb: 0x000c, + 0x4bc: 0x000c, 0x4bd: 0x000c, 0x4be: 0x000c, 0x4bf: 0x000c, + // Block 0x13, offset 0x4c0 + 0x4c0: 0x000c, 0x4c1: 0x000c, 0x4c2: 0x000c, 0x4c3: 0x000c, 0x4c4: 0x000c, 0x4c5: 0x000c, + 0x4c6: 0x000c, 0x4c7: 0x000c, 0x4c8: 0x000c, 0x4c9: 0x000c, 0x4ca: 0x000c, 0x4cb: 0x000d, + 0x4cc: 0x000d, 0x4cd: 0x000d, 0x4ce: 0x000d, 0x4cf: 0x000d, 0x4d0: 0x000d, 0x4d1: 0x000d, + 0x4d2: 0x000d, 0x4d3: 0x000d, 0x4d4: 0x000d, 0x4d5: 0x000d, 0x4d6: 0x000d, 0x4d7: 0x000d, + 0x4d8: 0x000d, 0x4d9: 0x000d, 0x4da: 0x000d, 0x4db: 0x000d, 0x4dc: 0x000d, 0x4dd: 0x000d, + 0x4de: 0x000d, 0x4df: 0x000d, 0x4e0: 0x000d, 0x4e1: 0x000d, 0x4e2: 0x000d, 0x4e3: 0x000d, + 0x4e4: 0x000d, 0x4e5: 0x000d, 0x4e6: 0x000d, 0x4e7: 0x000d, 0x4e8: 0x000d, 0x4e9: 0x000d, + 0x4ea: 0x000d, 0x4eb: 0x000d, 0x4ec: 0x000d, 0x4ed: 0x000d, 0x4ee: 0x000d, 0x4ef: 0x000d, + 0x4f0: 0x000d, 0x4f1: 0x000d, 0x4f2: 0x000d, 0x4f3: 0x000d, 0x4f4: 0x000d, 0x4f5: 0x000d, + 0x4f6: 0x000d, 0x4f7: 0x000d, 0x4f8: 0x000d, 0x4f9: 0x000d, 0x4fa: 0x000d, 0x4fb: 0x000d, + 0x4fc: 0x000d, 0x4fd: 0x000d, 0x4fe: 0x000d, 0x4ff: 0x000d, + // Block 0x14, offset 0x500 + 0x500: 0x000d, 0x501: 0x000d, 0x502: 0x000d, 0x503: 0x000d, 0x504: 0x000d, 0x505: 0x000d, + 0x506: 0x000d, 0x507: 0x000d, 0x508: 0x000d, 0x509: 0x000d, 0x50a: 0x000d, 0x50b: 0x000d, + 0x50c: 0x000d, 0x50d: 0x000d, 0x50e: 0x000d, 0x50f: 0x000d, 0x510: 0x000d, 0x511: 0x000d, + 0x512: 0x000d, 0x513: 0x000d, 0x514: 0x000d, 0x515: 0x000d, 0x516: 0x000d, 0x517: 0x000d, + 0x518: 0x000d, 0x519: 0x000d, 0x51a: 0x000d, 0x51b: 0x000d, 0x51c: 0x000d, 0x51d: 0x000d, + 0x51e: 0x000d, 0x51f: 0x000d, 0x520: 0x000d, 0x521: 0x000d, 0x522: 0x000d, 0x523: 0x000d, + 0x524: 0x000d, 0x525: 0x000d, 0x526: 0x000c, 0x527: 0x000c, 0x528: 0x000c, 0x529: 0x000c, + 0x52a: 0x000c, 0x52b: 0x000c, 0x52c: 0x000c, 0x52d: 0x000c, 0x52e: 0x000c, 0x52f: 0x000c, + 0x530: 0x000c, 0x531: 0x000d, 0x532: 0x000d, 0x533: 0x000d, 0x534: 0x000d, 0x535: 0x000d, + 0x536: 0x000d, 0x537: 0x000d, 0x538: 0x000d, 0x539: 0x000d, 0x53a: 0x000d, 0x53b: 0x000d, + 0x53c: 0x000d, 0x53d: 0x000d, 0x53e: 0x000d, 0x53f: 0x000d, + // Block 0x15, offset 0x540 + 0x540: 0x0001, 0x541: 0x0001, 0x542: 0x0001, 0x543: 0x0001, 0x544: 0x0001, 0x545: 0x0001, + 0x546: 0x0001, 0x547: 0x0001, 0x548: 0x0001, 0x549: 0x0001, 0x54a: 0x0001, 0x54b: 0x0001, + 0x54c: 0x0001, 0x54d: 0x0001, 0x54e: 0x0001, 0x54f: 0x0001, 0x550: 0x0001, 0x551: 0x0001, + 0x552: 0x0001, 0x553: 0x0001, 0x554: 0x0001, 0x555: 0x0001, 0x556: 0x0001, 0x557: 0x0001, + 0x558: 0x0001, 0x559: 0x0001, 0x55a: 0x0001, 0x55b: 0x0001, 0x55c: 0x0001, 0x55d: 0x0001, + 0x55e: 0x0001, 0x55f: 0x0001, 0x560: 0x0001, 0x561: 0x0001, 0x562: 0x0001, 0x563: 0x0001, + 0x564: 0x0001, 0x565: 0x0001, 0x566: 0x0001, 0x567: 0x0001, 0x568: 0x0001, 0x569: 0x0001, + 0x56a: 0x0001, 0x56b: 0x000c, 0x56c: 0x000c, 0x56d: 0x000c, 0x56e: 0x000c, 0x56f: 0x000c, + 0x570: 0x000c, 0x571: 0x000c, 0x572: 0x000c, 0x573: 0x000c, 0x574: 0x0001, 0x575: 0x0001, + 0x576: 0x000a, 0x577: 0x000a, 0x578: 0x000a, 0x579: 0x000a, 0x57a: 0x0001, 0x57b: 0x0001, + 0x57c: 0x0001, 0x57d: 0x000c, 0x57e: 0x0001, 0x57f: 0x0001, + // Block 0x16, offset 0x580 + 0x580: 0x0001, 0x581: 0x0001, 0x582: 0x0001, 0x583: 0x0001, 0x584: 0x0001, 0x585: 0x0001, + 0x586: 0x0001, 0x587: 0x0001, 0x588: 0x0001, 0x589: 0x0001, 0x58a: 0x0001, 0x58b: 0x0001, + 0x58c: 0x0001, 0x58d: 0x0001, 0x58e: 0x0001, 0x58f: 0x0001, 0x590: 0x0001, 0x591: 0x0001, + 0x592: 0x0001, 0x593: 0x0001, 0x594: 0x0001, 0x595: 0x0001, 0x596: 0x000c, 0x597: 0x000c, + 0x598: 0x000c, 0x599: 0x000c, 0x59a: 0x0001, 0x59b: 0x000c, 0x59c: 0x000c, 0x59d: 0x000c, + 0x59e: 0x000c, 0x59f: 0x000c, 0x5a0: 0x000c, 0x5a1: 0x000c, 0x5a2: 0x000c, 0x5a3: 0x000c, + 0x5a4: 0x0001, 0x5a5: 0x000c, 0x5a6: 0x000c, 0x5a7: 0x000c, 0x5a8: 0x0001, 0x5a9: 0x000c, + 0x5aa: 0x000c, 0x5ab: 0x000c, 0x5ac: 0x000c, 0x5ad: 0x000c, 0x5ae: 0x0001, 0x5af: 0x0001, + 0x5b0: 0x0001, 0x5b1: 0x0001, 0x5b2: 0x0001, 0x5b3: 0x0001, 0x5b4: 0x0001, 0x5b5: 0x0001, + 0x5b6: 0x0001, 0x5b7: 0x0001, 0x5b8: 0x0001, 0x5b9: 0x0001, 0x5ba: 0x0001, 0x5bb: 0x0001, + 0x5bc: 0x0001, 0x5bd: 0x0001, 0x5be: 0x0001, 0x5bf: 0x0001, + // Block 0x17, offset 0x5c0 + 0x5c0: 0x0001, 0x5c1: 0x0001, 0x5c2: 0x0001, 0x5c3: 0x0001, 0x5c4: 0x0001, 0x5c5: 0x0001, + 0x5c6: 0x0001, 0x5c7: 0x0001, 0x5c8: 0x0001, 0x5c9: 0x0001, 0x5ca: 0x0001, 0x5cb: 0x0001, + 0x5cc: 0x0001, 0x5cd: 0x0001, 0x5ce: 0x0001, 0x5cf: 0x0001, 0x5d0: 0x0001, 0x5d1: 0x0001, + 0x5d2: 0x0001, 0x5d3: 0x0001, 0x5d4: 0x0001, 0x5d5: 0x0001, 0x5d6: 0x0001, 0x5d7: 0x0001, + 0x5d8: 0x0001, 0x5d9: 0x000c, 0x5da: 0x000c, 0x5db: 0x000c, 0x5dc: 0x0001, 0x5dd: 0x0001, + 0x5de: 0x0001, 0x5df: 0x0001, 0x5e0: 0x000d, 0x5e1: 0x000d, 0x5e2: 0x000d, 0x5e3: 0x000d, + 0x5e4: 0x000d, 0x5e5: 0x000d, 0x5e6: 0x000d, 0x5e7: 0x000d, 0x5e8: 0x000d, 0x5e9: 0x000d, + 0x5ea: 0x000d, 0x5eb: 0x0001, 0x5ec: 0x0001, 0x5ed: 0x0001, 0x5ee: 0x0001, 0x5ef: 0x0001, + 0x5f0: 0x000d, 0x5f1: 0x000d, 0x5f2: 0x000d, 0x5f3: 0x000d, 0x5f4: 0x000d, 0x5f5: 0x000d, + 0x5f6: 0x000d, 0x5f7: 0x000d, 0x5f8: 0x000d, 0x5f9: 0x000d, 0x5fa: 0x000d, 0x5fb: 0x000d, + 0x5fc: 0x000d, 0x5fd: 0x000d, 0x5fe: 0x000d, 0x5ff: 0x000d, + // Block 0x18, offset 0x600 + 0x600: 0x000d, 0x601: 0x000d, 0x602: 0x000d, 0x603: 0x000d, 0x604: 0x000d, 0x605: 0x000d, + 0x606: 0x000d, 0x607: 0x000d, 0x608: 0x000d, 0x609: 0x000d, 0x60a: 0x000d, 0x60b: 0x000d, + 0x60c: 0x000d, 0x60d: 0x000d, 0x60e: 0x000d, 0x60f: 0x0001, 0x610: 0x0005, 0x611: 0x0005, + 0x612: 0x0001, 0x613: 0x0001, 0x614: 0x0001, 0x615: 0x0001, 0x616: 0x0001, 0x617: 0x0001, + 0x618: 0x000c, 0x619: 0x000c, 0x61a: 0x000c, 0x61b: 0x000c, 0x61c: 0x000c, 0x61d: 0x000c, + 0x61e: 0x000c, 0x61f: 0x000c, 0x620: 0x000d, 0x621: 0x000d, 0x622: 0x000d, 0x623: 0x000d, + 0x624: 0x000d, 0x625: 0x000d, 0x626: 0x000d, 0x627: 0x000d, 0x628: 0x000d, 0x629: 0x000d, + 0x62a: 0x000d, 0x62b: 0x000d, 0x62c: 0x000d, 0x62d: 0x000d, 0x62e: 0x000d, 0x62f: 0x000d, + 0x630: 0x000d, 0x631: 0x000d, 0x632: 0x000d, 0x633: 0x000d, 0x634: 0x000d, 0x635: 0x000d, + 0x636: 0x000d, 0x637: 0x000d, 0x638: 0x000d, 0x639: 0x000d, 0x63a: 0x000d, 0x63b: 0x000d, + 0x63c: 0x000d, 0x63d: 0x000d, 0x63e: 0x000d, 0x63f: 0x000d, + // Block 0x19, offset 0x640 + 0x640: 0x000d, 0x641: 0x000d, 0x642: 0x000d, 0x643: 0x000d, 0x644: 0x000d, 0x645: 0x000d, + 0x646: 0x000d, 0x647: 0x000d, 0x648: 0x000d, 0x649: 0x000d, 0x64a: 0x000c, 0x64b: 0x000c, + 0x64c: 0x000c, 0x64d: 0x000c, 0x64e: 0x000c, 0x64f: 0x000c, 0x650: 0x000c, 0x651: 0x000c, + 0x652: 0x000c, 0x653: 0x000c, 0x654: 0x000c, 0x655: 0x000c, 0x656: 0x000c, 0x657: 0x000c, + 0x658: 0x000c, 0x659: 0x000c, 0x65a: 0x000c, 0x65b: 0x000c, 0x65c: 0x000c, 0x65d: 0x000c, + 0x65e: 0x000c, 0x65f: 0x000c, 0x660: 0x000c, 0x661: 0x000c, 0x662: 0x0005, 0x663: 0x000c, + 0x664: 0x000c, 0x665: 0x000c, 0x666: 0x000c, 0x667: 0x000c, 0x668: 0x000c, 0x669: 0x000c, + 0x66a: 0x000c, 0x66b: 0x000c, 0x66c: 0x000c, 0x66d: 0x000c, 0x66e: 0x000c, 0x66f: 0x000c, + 0x670: 0x000c, 0x671: 0x000c, 0x672: 0x000c, 0x673: 0x000c, 0x674: 0x000c, 0x675: 0x000c, + 0x676: 0x000c, 0x677: 0x000c, 0x678: 0x000c, 0x679: 0x000c, 0x67a: 0x000c, 0x67b: 0x000c, + 0x67c: 0x000c, 0x67d: 0x000c, 0x67e: 0x000c, 0x67f: 0x000c, + // Block 0x1a, offset 0x680 + 0x680: 0x000c, 0x681: 0x000c, 0x682: 0x000c, + 0x6ba: 0x000c, + 0x6bc: 0x000c, + // Block 0x1b, offset 0x6c0 + 0x6c1: 0x000c, 0x6c2: 0x000c, 0x6c3: 0x000c, 0x6c4: 0x000c, 0x6c5: 0x000c, + 0x6c6: 0x000c, 0x6c7: 0x000c, 0x6c8: 0x000c, + 0x6cd: 0x000c, 0x6d1: 0x000c, + 0x6d2: 0x000c, 0x6d3: 0x000c, 0x6d4: 0x000c, 0x6d5: 0x000c, 0x6d6: 0x000c, 0x6d7: 0x000c, + 0x6e2: 0x000c, 0x6e3: 0x000c, + // Block 0x1c, offset 0x700 + 0x701: 0x000c, + 0x73c: 0x000c, + // Block 0x1d, offset 0x740 + 0x741: 0x000c, 0x742: 0x000c, 0x743: 0x000c, 0x744: 0x000c, + 0x74d: 0x000c, + 0x762: 0x000c, 0x763: 0x000c, + 0x772: 0x0004, 0x773: 0x0004, + 0x77b: 0x0004, + 0x77e: 0x000c, + // Block 0x1e, offset 0x780 + 0x781: 0x000c, 0x782: 0x000c, + 0x7bc: 0x000c, + // Block 0x1f, offset 0x7c0 + 0x7c1: 0x000c, 0x7c2: 0x000c, + 0x7c7: 0x000c, 0x7c8: 0x000c, 0x7cb: 0x000c, + 0x7cc: 0x000c, 0x7cd: 0x000c, 0x7d1: 0x000c, + 0x7f0: 0x000c, 0x7f1: 0x000c, 0x7f5: 0x000c, + // Block 0x20, offset 0x800 + 0x801: 0x000c, 0x802: 0x000c, 0x803: 0x000c, 0x804: 0x000c, 0x805: 0x000c, + 0x807: 0x000c, 0x808: 0x000c, + 0x80d: 0x000c, + 0x822: 0x000c, 0x823: 0x000c, + 0x831: 0x0004, + 0x83a: 0x000c, 0x83b: 0x000c, + 0x83c: 0x000c, 0x83d: 0x000c, 0x83e: 0x000c, 0x83f: 0x000c, + // Block 0x21, offset 0x840 + 0x841: 0x000c, + 0x87c: 0x000c, 0x87f: 0x000c, + // Block 0x22, offset 0x880 + 0x881: 0x000c, 0x882: 0x000c, 0x883: 0x000c, 0x884: 0x000c, + 0x88d: 0x000c, + 0x895: 0x000c, 0x896: 0x000c, + 0x8a2: 0x000c, 0x8a3: 0x000c, + // Block 0x23, offset 0x8c0 + 0x8c2: 0x000c, + // Block 0x24, offset 0x900 + 0x900: 0x000c, + 0x90d: 0x000c, + 0x933: 0x000a, 0x934: 0x000a, 0x935: 0x000a, + 0x936: 0x000a, 0x937: 0x000a, 0x938: 0x000a, 0x939: 0x0004, 0x93a: 0x000a, + // Block 0x25, offset 0x940 + 0x940: 0x000c, 0x944: 0x000c, + 0x97c: 0x000c, 0x97e: 0x000c, 0x97f: 0x000c, + // Block 0x26, offset 0x980 + 0x980: 0x000c, + 0x986: 0x000c, 0x987: 0x000c, 0x988: 0x000c, 0x98a: 0x000c, 0x98b: 0x000c, + 0x98c: 0x000c, 0x98d: 0x000c, + 0x995: 0x000c, 0x996: 0x000c, + 0x9a2: 0x000c, 0x9a3: 0x000c, + 0x9b8: 0x000a, 0x9b9: 0x000a, 0x9ba: 0x000a, 0x9bb: 0x000a, + 0x9bc: 0x000a, 0x9bd: 0x000a, 0x9be: 0x000a, + // Block 0x27, offset 0x9c0 + 0x9cc: 0x000c, 0x9cd: 0x000c, + 0x9e2: 0x000c, 0x9e3: 0x000c, + // Block 0x28, offset 0xa00 + 0xa00: 0x000c, 0xa01: 0x000c, + 0xa3b: 0x000c, + 0xa3c: 0x000c, + // Block 0x29, offset 0xa40 + 0xa41: 0x000c, 0xa42: 0x000c, 0xa43: 0x000c, 0xa44: 0x000c, + 0xa4d: 0x000c, + 0xa62: 0x000c, 0xa63: 0x000c, + // Block 0x2a, offset 0xa80 + 0xa81: 0x000c, + // Block 0x2b, offset 0xac0 + 0xaca: 0x000c, + 0xad2: 0x000c, 0xad3: 0x000c, 0xad4: 0x000c, 0xad6: 0x000c, + // Block 0x2c, offset 0xb00 + 0xb31: 0x000c, 0xb34: 0x000c, 0xb35: 0x000c, + 0xb36: 0x000c, 0xb37: 0x000c, 0xb38: 0x000c, 0xb39: 0x000c, 0xb3a: 0x000c, + 0xb3f: 0x0004, + // Block 0x2d, offset 0xb40 + 0xb47: 0x000c, 0xb48: 0x000c, 0xb49: 0x000c, 0xb4a: 0x000c, 0xb4b: 0x000c, + 0xb4c: 0x000c, 0xb4d: 0x000c, 0xb4e: 0x000c, + // Block 0x2e, offset 0xb80 + 0xbb1: 0x000c, 0xbb4: 0x000c, 0xbb5: 0x000c, + 0xbb6: 0x000c, 0xbb7: 0x000c, 0xbb8: 0x000c, 0xbb9: 0x000c, 0xbba: 0x000c, 0xbbb: 0x000c, + 0xbbc: 0x000c, + // Block 0x2f, offset 0xbc0 + 0xbc8: 0x000c, 0xbc9: 0x000c, 0xbca: 0x000c, 0xbcb: 0x000c, + 0xbcc: 0x000c, 0xbcd: 0x000c, 0xbce: 0x000c, + // Block 0x30, offset 0xc00 + 0xc18: 0x000c, 0xc19: 0x000c, + 0xc35: 0x000c, + 0xc37: 0x000c, 0xc39: 0x000c, 0xc3a: 0x003a, 0xc3b: 0x002a, + 0xc3c: 0x003a, 0xc3d: 0x002a, + // Block 0x31, offset 0xc40 + 0xc71: 0x000c, 0xc72: 0x000c, 0xc73: 0x000c, 0xc74: 0x000c, 0xc75: 0x000c, + 0xc76: 0x000c, 0xc77: 0x000c, 0xc78: 0x000c, 0xc79: 0x000c, 0xc7a: 0x000c, 0xc7b: 0x000c, + 0xc7c: 0x000c, 0xc7d: 0x000c, 0xc7e: 0x000c, + // Block 0x32, offset 0xc80 + 0xc80: 0x000c, 0xc81: 0x000c, 0xc82: 0x000c, 0xc83: 0x000c, 0xc84: 0x000c, + 0xc86: 0x000c, 0xc87: 0x000c, + 0xc8d: 0x000c, 0xc8e: 0x000c, 0xc8f: 0x000c, 0xc90: 0x000c, 0xc91: 0x000c, + 0xc92: 0x000c, 0xc93: 0x000c, 0xc94: 0x000c, 0xc95: 0x000c, 0xc96: 0x000c, 0xc97: 0x000c, + 0xc99: 0x000c, 0xc9a: 0x000c, 0xc9b: 0x000c, 0xc9c: 0x000c, 0xc9d: 0x000c, + 0xc9e: 0x000c, 0xc9f: 0x000c, 0xca0: 0x000c, 0xca1: 0x000c, 0xca2: 0x000c, 0xca3: 0x000c, + 0xca4: 0x000c, 0xca5: 0x000c, 0xca6: 0x000c, 0xca7: 0x000c, 0xca8: 0x000c, 0xca9: 0x000c, + 0xcaa: 0x000c, 0xcab: 0x000c, 0xcac: 0x000c, 0xcad: 0x000c, 0xcae: 0x000c, 0xcaf: 0x000c, + 0xcb0: 0x000c, 0xcb1: 0x000c, 0xcb2: 0x000c, 0xcb3: 0x000c, 0xcb4: 0x000c, 0xcb5: 0x000c, + 0xcb6: 0x000c, 0xcb7: 0x000c, 0xcb8: 0x000c, 0xcb9: 0x000c, 0xcba: 0x000c, 0xcbb: 0x000c, + 0xcbc: 0x000c, + // Block 0x33, offset 0xcc0 + 0xcc6: 0x000c, + // Block 0x34, offset 0xd00 + 0xd2d: 0x000c, 0xd2e: 0x000c, 0xd2f: 0x000c, + 0xd30: 0x000c, 0xd32: 0x000c, 0xd33: 0x000c, 0xd34: 0x000c, 0xd35: 0x000c, + 0xd36: 0x000c, 0xd37: 0x000c, 0xd39: 0x000c, 0xd3a: 0x000c, + 0xd3d: 0x000c, 0xd3e: 0x000c, + // Block 0x35, offset 0xd40 + 0xd58: 0x000c, 0xd59: 0x000c, + 0xd5e: 0x000c, 0xd5f: 0x000c, 0xd60: 0x000c, + 0xd71: 0x000c, 0xd72: 0x000c, 0xd73: 0x000c, 0xd74: 0x000c, + // Block 0x36, offset 0xd80 + 0xd82: 0x000c, 0xd85: 0x000c, + 0xd86: 0x000c, + 0xd8d: 0x000c, + 0xd9d: 0x000c, + // Block 0x37, offset 0xdc0 + 0xddd: 0x000c, + 0xdde: 0x000c, 0xddf: 0x000c, + // Block 0x38, offset 0xe00 + 0xe10: 0x000a, 0xe11: 0x000a, + 0xe12: 0x000a, 0xe13: 0x000a, 0xe14: 0x000a, 0xe15: 0x000a, 0xe16: 0x000a, 0xe17: 0x000a, + 0xe18: 0x000a, 0xe19: 0x000a, + // Block 0x39, offset 0xe40 + 0xe40: 0x000a, + // Block 0x3a, offset 0xe80 + 0xe80: 0x0009, + 0xe9b: 0x007a, 0xe9c: 0x006a, + // Block 0x3b, offset 0xec0 + 0xed2: 0x000c, 0xed3: 0x000c, 0xed4: 0x000c, + 0xef2: 0x000c, 0xef3: 0x000c, + // Block 0x3c, offset 0xf00 + 0xf12: 0x000c, 0xf13: 0x000c, + 0xf32: 0x000c, 0xf33: 0x000c, + // Block 0x3d, offset 0xf40 + 0xf74: 0x000c, 0xf75: 0x000c, + 0xf77: 0x000c, 0xf78: 0x000c, 0xf79: 0x000c, 0xf7a: 0x000c, 0xf7b: 0x000c, + 0xf7c: 0x000c, 0xf7d: 0x000c, + // Block 0x3e, offset 0xf80 + 0xf86: 0x000c, 0xf89: 0x000c, 0xf8a: 0x000c, 0xf8b: 0x000c, + 0xf8c: 0x000c, 0xf8d: 0x000c, 0xf8e: 0x000c, 0xf8f: 0x000c, 0xf90: 0x000c, 0xf91: 0x000c, + 0xf92: 0x000c, 0xf93: 0x000c, + 0xf9b: 0x0004, 0xf9d: 0x000c, + 0xfb0: 0x000a, 0xfb1: 0x000a, 0xfb2: 0x000a, 0xfb3: 0x000a, 0xfb4: 0x000a, 0xfb5: 0x000a, + 0xfb6: 0x000a, 0xfb7: 0x000a, 0xfb8: 0x000a, 0xfb9: 0x000a, + // Block 0x3f, offset 0xfc0 + 0xfc0: 0x000a, 0xfc1: 0x000a, 0xfc2: 0x000a, 0xfc3: 0x000a, 0xfc4: 0x000a, 0xfc5: 0x000a, + 0xfc6: 0x000a, 0xfc7: 0x000a, 0xfc8: 0x000a, 0xfc9: 0x000a, 0xfca: 0x000a, 0xfcb: 0x000c, + 0xfcc: 0x000c, 0xfcd: 0x000c, 0xfce: 0x000b, 0xfcf: 0x000c, + // Block 0x40, offset 0x1000 + 0x1005: 0x000c, + 0x1006: 0x000c, + 0x1029: 0x000c, + // Block 0x41, offset 0x1040 + 0x1060: 0x000c, 0x1061: 0x000c, 0x1062: 0x000c, + 0x1067: 0x000c, 0x1068: 0x000c, + 0x1072: 0x000c, + 0x1079: 0x000c, 0x107a: 0x000c, 0x107b: 0x000c, + // Block 0x42, offset 0x1080 + 0x1080: 0x000a, 0x1084: 0x000a, 0x1085: 0x000a, + // Block 0x43, offset 0x10c0 + 0x10de: 0x000a, 0x10df: 0x000a, 0x10e0: 0x000a, 0x10e1: 0x000a, 0x10e2: 0x000a, 0x10e3: 0x000a, + 0x10e4: 0x000a, 0x10e5: 0x000a, 0x10e6: 0x000a, 0x10e7: 0x000a, 0x10e8: 0x000a, 0x10e9: 0x000a, + 0x10ea: 0x000a, 0x10eb: 0x000a, 0x10ec: 0x000a, 0x10ed: 0x000a, 0x10ee: 0x000a, 0x10ef: 0x000a, + 0x10f0: 0x000a, 0x10f1: 0x000a, 0x10f2: 0x000a, 0x10f3: 0x000a, 0x10f4: 0x000a, 0x10f5: 0x000a, + 0x10f6: 0x000a, 0x10f7: 0x000a, 0x10f8: 0x000a, 0x10f9: 0x000a, 0x10fa: 0x000a, 0x10fb: 0x000a, + 0x10fc: 0x000a, 0x10fd: 0x000a, 0x10fe: 0x000a, 0x10ff: 0x000a, + // Block 0x44, offset 0x1100 + 0x1117: 0x000c, + 0x1118: 0x000c, 0x111b: 0x000c, + // Block 0x45, offset 0x1140 + 0x1156: 0x000c, + 0x1158: 0x000c, 0x1159: 0x000c, 0x115a: 0x000c, 0x115b: 0x000c, 0x115c: 0x000c, 0x115d: 0x000c, + 0x115e: 0x000c, 0x1160: 0x000c, 0x1162: 0x000c, + 0x1165: 0x000c, 0x1166: 0x000c, 0x1167: 0x000c, 0x1168: 0x000c, 0x1169: 0x000c, + 0x116a: 0x000c, 0x116b: 0x000c, 0x116c: 0x000c, + 0x1173: 0x000c, 0x1174: 0x000c, 0x1175: 0x000c, + 0x1176: 0x000c, 0x1177: 0x000c, 0x1178: 0x000c, 0x1179: 0x000c, 0x117a: 0x000c, 0x117b: 0x000c, + 0x117c: 0x000c, 0x117f: 0x000c, + // Block 0x46, offset 0x1180 + 0x11b0: 0x000c, 0x11b1: 0x000c, 0x11b2: 0x000c, 0x11b3: 0x000c, 0x11b4: 0x000c, 0x11b5: 0x000c, + 0x11b6: 0x000c, 0x11b7: 0x000c, 0x11b8: 0x000c, 0x11b9: 0x000c, 0x11ba: 0x000c, 0x11bb: 0x000c, + 0x11bc: 0x000c, 0x11bd: 0x000c, 0x11be: 0x000c, 0x11bf: 0x000c, + // Block 0x47, offset 0x11c0 + 0x11c0: 0x000c, 0x11c1: 0x000c, 0x11c2: 0x000c, 0x11c3: 0x000c, 0x11c4: 0x000c, 0x11c5: 0x000c, + 0x11c6: 0x000c, 0x11c7: 0x000c, 0x11c8: 0x000c, 0x11c9: 0x000c, 0x11ca: 0x000c, 0x11cb: 0x000c, + 0x11cc: 0x000c, 0x11cd: 0x000c, 0x11ce: 0x000c, + // Block 0x48, offset 0x1200 + 0x1200: 0x000c, 0x1201: 0x000c, 0x1202: 0x000c, 0x1203: 0x000c, + 0x1234: 0x000c, + 0x1236: 0x000c, 0x1237: 0x000c, 0x1238: 0x000c, 0x1239: 0x000c, 0x123a: 0x000c, + 0x123c: 0x000c, + // Block 0x49, offset 0x1240 + 0x1242: 0x000c, + 0x126b: 0x000c, 0x126c: 0x000c, 0x126d: 0x000c, 0x126e: 0x000c, 0x126f: 0x000c, + 0x1270: 0x000c, 0x1271: 0x000c, 0x1272: 0x000c, 0x1273: 0x000c, + // Block 0x4a, offset 0x1280 + 0x1280: 0x000c, 0x1281: 0x000c, + 0x12a2: 0x000c, 0x12a3: 0x000c, + 0x12a4: 0x000c, 0x12a5: 0x000c, 0x12a8: 0x000c, 0x12a9: 0x000c, + 0x12ab: 0x000c, 0x12ac: 0x000c, 0x12ad: 0x000c, + // Block 0x4b, offset 0x12c0 + 0x12e6: 0x000c, 0x12e8: 0x000c, 0x12e9: 0x000c, + 0x12ed: 0x000c, 0x12ef: 0x000c, + 0x12f0: 0x000c, 0x12f1: 0x000c, + // Block 0x4c, offset 0x1300 + 0x132c: 0x000c, 0x132d: 0x000c, 0x132e: 0x000c, 0x132f: 0x000c, + 0x1330: 0x000c, 0x1331: 0x000c, 0x1332: 0x000c, 0x1333: 0x000c, + 0x1336: 0x000c, 0x1337: 0x000c, + // Block 0x4d, offset 0x1340 + 0x1350: 0x000c, 0x1351: 0x000c, + 0x1352: 0x000c, 0x1354: 0x000c, 0x1355: 0x000c, 0x1356: 0x000c, 0x1357: 0x000c, + 0x1358: 0x000c, 0x1359: 0x000c, 0x135a: 0x000c, 0x135b: 0x000c, 0x135c: 0x000c, 0x135d: 0x000c, + 0x135e: 0x000c, 0x135f: 0x000c, 0x1360: 0x000c, 0x1362: 0x000c, 0x1363: 0x000c, + 0x1364: 0x000c, 0x1365: 0x000c, 0x1366: 0x000c, 0x1367: 0x000c, 0x1368: 0x000c, + 0x136d: 0x000c, + 0x1374: 0x000c, + 0x1378: 0x000c, 0x1379: 0x000c, + // Block 0x4e, offset 0x1380 + 0x13bd: 0x000a, 0x13bf: 0x000a, + // Block 0x4f, offset 0x13c0 + 0x13c0: 0x000a, 0x13c1: 0x000a, + 0x13cd: 0x000a, 0x13ce: 0x000a, 0x13cf: 0x000a, + 0x13dd: 0x000a, + 0x13de: 0x000a, 0x13df: 0x000a, + 0x13ed: 0x000a, 0x13ee: 0x000a, 0x13ef: 0x000a, + 0x13fd: 0x000a, 0x13fe: 0x000a, + // Block 0x50, offset 0x1400 + 0x1400: 0x0009, 0x1401: 0x0009, 0x1402: 0x0009, 0x1403: 0x0009, 0x1404: 0x0009, 0x1405: 0x0009, + 0x1406: 0x0009, 0x1407: 0x0009, 0x1408: 0x0009, 0x1409: 0x0009, 0x140a: 0x0009, 0x140b: 0x000b, + 0x140c: 0x000b, 0x140d: 0x000b, 0x140f: 0x0001, 0x1410: 0x000a, 0x1411: 0x000a, + 0x1412: 0x000a, 0x1413: 0x000a, 0x1414: 0x000a, 0x1415: 0x000a, 0x1416: 0x000a, 0x1417: 0x000a, + 0x1418: 0x000a, 0x1419: 0x000a, 0x141a: 0x000a, 0x141b: 0x000a, 0x141c: 0x000a, 0x141d: 0x000a, + 0x141e: 0x000a, 0x141f: 0x000a, 0x1420: 0x000a, 0x1421: 0x000a, 0x1422: 0x000a, 0x1423: 0x000a, + 0x1424: 0x000a, 0x1425: 0x000a, 0x1426: 0x000a, 0x1427: 0x000a, 0x1428: 0x0009, 0x1429: 0x0007, + 0x142a: 0x000e, 0x142b: 0x000e, 0x142c: 0x000e, 0x142d: 0x000e, 0x142e: 0x000e, 0x142f: 0x0006, + 0x1430: 0x0004, 0x1431: 0x0004, 0x1432: 0x0004, 0x1433: 0x0004, 0x1434: 0x0004, 0x1435: 0x000a, + 0x1436: 0x000a, 0x1437: 0x000a, 0x1438: 0x000a, 0x1439: 0x000a, 0x143a: 0x000a, 0x143b: 0x000a, + 0x143c: 0x000a, 0x143d: 0x000a, 0x143e: 0x000a, 0x143f: 0x000a, + // Block 0x51, offset 0x1440 + 0x1440: 0x000a, 0x1441: 0x000a, 0x1442: 0x000a, 0x1443: 0x000a, 0x1444: 0x0006, 0x1445: 0x009a, + 0x1446: 0x008a, 0x1447: 0x000a, 0x1448: 0x000a, 0x1449: 0x000a, 0x144a: 0x000a, 0x144b: 0x000a, + 0x144c: 0x000a, 0x144d: 0x000a, 0x144e: 0x000a, 0x144f: 0x000a, 0x1450: 0x000a, 0x1451: 0x000a, + 0x1452: 0x000a, 0x1453: 0x000a, 0x1454: 0x000a, 0x1455: 0x000a, 0x1456: 0x000a, 0x1457: 0x000a, + 0x1458: 0x000a, 0x1459: 0x000a, 0x145a: 0x000a, 0x145b: 0x000a, 0x145c: 0x000a, 0x145d: 0x000a, + 0x145e: 0x000a, 0x145f: 0x0009, 0x1460: 0x000b, 0x1461: 0x000b, 0x1462: 0x000b, 0x1463: 0x000b, + 0x1464: 0x000b, 0x1465: 0x000b, 0x1466: 0x000e, 0x1467: 0x000e, 0x1468: 0x000e, 0x1469: 0x000e, + 0x146a: 0x000b, 0x146b: 0x000b, 0x146c: 0x000b, 0x146d: 0x000b, 0x146e: 0x000b, 0x146f: 0x000b, + 0x1470: 0x0002, 0x1474: 0x0002, 0x1475: 0x0002, + 0x1476: 0x0002, 0x1477: 0x0002, 0x1478: 0x0002, 0x1479: 0x0002, 0x147a: 0x0003, 0x147b: 0x0003, + 0x147c: 0x000a, 0x147d: 0x009a, 0x147e: 0x008a, + // Block 0x52, offset 0x1480 + 0x1480: 0x0002, 0x1481: 0x0002, 0x1482: 0x0002, 0x1483: 0x0002, 0x1484: 0x0002, 0x1485: 0x0002, + 0x1486: 0x0002, 0x1487: 0x0002, 0x1488: 0x0002, 0x1489: 0x0002, 0x148a: 0x0003, 0x148b: 0x0003, + 0x148c: 0x000a, 0x148d: 0x009a, 0x148e: 0x008a, + 0x14a0: 0x0004, 0x14a1: 0x0004, 0x14a2: 0x0004, 0x14a3: 0x0004, + 0x14a4: 0x0004, 0x14a5: 0x0004, 0x14a6: 0x0004, 0x14a7: 0x0004, 0x14a8: 0x0004, 0x14a9: 0x0004, + 0x14aa: 0x0004, 0x14ab: 0x0004, 0x14ac: 0x0004, 0x14ad: 0x0004, 0x14ae: 0x0004, 0x14af: 0x0004, + 0x14b0: 0x0004, 0x14b1: 0x0004, 0x14b2: 0x0004, 0x14b3: 0x0004, 0x14b4: 0x0004, 0x14b5: 0x0004, + 0x14b6: 0x0004, 0x14b7: 0x0004, 0x14b8: 0x0004, 0x14b9: 0x0004, 0x14ba: 0x0004, 0x14bb: 0x0004, + 0x14bc: 0x0004, 0x14bd: 0x0004, 0x14be: 0x0004, 0x14bf: 0x0004, + // Block 0x53, offset 0x14c0 + 0x14c0: 0x0004, 0x14c1: 0x0004, 0x14c2: 0x0004, 0x14c3: 0x0004, 0x14c4: 0x0004, 0x14c5: 0x0004, + 0x14c6: 0x0004, 0x14c7: 0x0004, 0x14c8: 0x0004, 0x14c9: 0x0004, 0x14ca: 0x0004, 0x14cb: 0x0004, + 0x14cc: 0x0004, 0x14cd: 0x0004, 0x14ce: 0x0004, 0x14cf: 0x0004, 0x14d0: 0x000c, 0x14d1: 0x000c, + 0x14d2: 0x000c, 0x14d3: 0x000c, 0x14d4: 0x000c, 0x14d5: 0x000c, 0x14d6: 0x000c, 0x14d7: 0x000c, + 0x14d8: 0x000c, 0x14d9: 0x000c, 0x14da: 0x000c, 0x14db: 0x000c, 0x14dc: 0x000c, 0x14dd: 0x000c, + 0x14de: 0x000c, 0x14df: 0x000c, 0x14e0: 0x000c, 0x14e1: 0x000c, 0x14e2: 0x000c, 0x14e3: 0x000c, + 0x14e4: 0x000c, 0x14e5: 0x000c, 0x14e6: 0x000c, 0x14e7: 0x000c, 0x14e8: 0x000c, 0x14e9: 0x000c, + 0x14ea: 0x000c, 0x14eb: 0x000c, 0x14ec: 0x000c, 0x14ed: 0x000c, 0x14ee: 0x000c, 0x14ef: 0x000c, + 0x14f0: 0x000c, + // Block 0x54, offset 0x1500 + 0x1500: 0x000a, 0x1501: 0x000a, 0x1503: 0x000a, 0x1504: 0x000a, 0x1505: 0x000a, + 0x1506: 0x000a, 0x1508: 0x000a, 0x1509: 0x000a, + 0x1514: 0x000a, 0x1516: 0x000a, 0x1517: 0x000a, + 0x1518: 0x000a, + 0x151e: 0x000a, 0x151f: 0x000a, 0x1520: 0x000a, 0x1521: 0x000a, 0x1522: 0x000a, 0x1523: 0x000a, + 0x1525: 0x000a, 0x1527: 0x000a, 0x1529: 0x000a, + 0x152e: 0x0004, + 0x153a: 0x000a, 0x153b: 0x000a, + // Block 0x55, offset 0x1540 + 0x1540: 0x000a, 0x1541: 0x000a, 0x1542: 0x000a, 0x1543: 0x000a, 0x1544: 0x000a, + 0x154a: 0x000a, 0x154b: 0x000a, + 0x154c: 0x000a, 0x154d: 0x000a, 0x1550: 0x000a, 0x1551: 0x000a, + 0x1552: 0x000a, 0x1553: 0x000a, 0x1554: 0x000a, 0x1555: 0x000a, 0x1556: 0x000a, 0x1557: 0x000a, + 0x1558: 0x000a, 0x1559: 0x000a, 0x155a: 0x000a, 0x155b: 0x000a, 0x155c: 0x000a, 0x155d: 0x000a, + 0x155e: 0x000a, 0x155f: 0x000a, + // Block 0x56, offset 0x1580 + 0x1589: 0x000a, 0x158a: 0x000a, 0x158b: 0x000a, + 0x1590: 0x000a, 0x1591: 0x000a, + 0x1592: 0x000a, 0x1593: 0x000a, 0x1594: 0x000a, 0x1595: 0x000a, 0x1596: 0x000a, 0x1597: 0x000a, + 0x1598: 0x000a, 0x1599: 0x000a, 0x159a: 0x000a, 0x159b: 0x000a, 0x159c: 0x000a, 0x159d: 0x000a, + 0x159e: 0x000a, 0x159f: 0x000a, 0x15a0: 0x000a, 0x15a1: 0x000a, 0x15a2: 0x000a, 0x15a3: 0x000a, + 0x15a4: 0x000a, 0x15a5: 0x000a, 0x15a6: 0x000a, 0x15a7: 0x000a, 0x15a8: 0x000a, 0x15a9: 0x000a, + 0x15aa: 0x000a, 0x15ab: 0x000a, 0x15ac: 0x000a, 0x15ad: 0x000a, 0x15ae: 0x000a, 0x15af: 0x000a, + 0x15b0: 0x000a, 0x15b1: 0x000a, 0x15b2: 0x000a, 0x15b3: 0x000a, 0x15b4: 0x000a, 0x15b5: 0x000a, + 0x15b6: 0x000a, 0x15b7: 0x000a, 0x15b8: 0x000a, 0x15b9: 0x000a, 0x15ba: 0x000a, 0x15bb: 0x000a, + 0x15bc: 0x000a, 0x15bd: 0x000a, 0x15be: 0x000a, 0x15bf: 0x000a, + // Block 0x57, offset 0x15c0 + 0x15c0: 0x000a, 0x15c1: 0x000a, 0x15c2: 0x000a, 0x15c3: 0x000a, 0x15c4: 0x000a, 0x15c5: 0x000a, + 0x15c6: 0x000a, 0x15c7: 0x000a, 0x15c8: 0x000a, 0x15c9: 0x000a, 0x15ca: 0x000a, 0x15cb: 0x000a, + 0x15cc: 0x000a, 0x15cd: 0x000a, 0x15ce: 0x000a, 0x15cf: 0x000a, 0x15d0: 0x000a, 0x15d1: 0x000a, + 0x15d2: 0x000a, 0x15d3: 0x000a, 0x15d4: 0x000a, 0x15d5: 0x000a, 0x15d6: 0x000a, 0x15d7: 0x000a, + 0x15d8: 0x000a, 0x15d9: 0x000a, 0x15da: 0x000a, 0x15db: 0x000a, 0x15dc: 0x000a, 0x15dd: 0x000a, + 0x15de: 0x000a, 0x15df: 0x000a, 0x15e0: 0x000a, 0x15e1: 0x000a, 0x15e2: 0x000a, 0x15e3: 0x000a, + 0x15e4: 0x000a, 0x15e5: 0x000a, 0x15e6: 0x000a, 0x15e7: 0x000a, 0x15e8: 0x000a, 0x15e9: 0x000a, + 0x15ea: 0x000a, 0x15eb: 0x000a, 0x15ec: 0x000a, 0x15ed: 0x000a, 0x15ee: 0x000a, 0x15ef: 0x000a, + 0x15f0: 0x000a, 0x15f1: 0x000a, 0x15f2: 0x000a, 0x15f3: 0x000a, 0x15f4: 0x000a, 0x15f5: 0x000a, + 0x15f6: 0x000a, 0x15f7: 0x000a, 0x15f8: 0x000a, 0x15f9: 0x000a, 0x15fa: 0x000a, 0x15fb: 0x000a, + 0x15fc: 0x000a, 0x15fd: 0x000a, 0x15fe: 0x000a, 0x15ff: 0x000a, + // Block 0x58, offset 0x1600 + 0x1600: 0x000a, 0x1601: 0x000a, 0x1602: 0x000a, 0x1603: 0x000a, 0x1604: 0x000a, 0x1605: 0x000a, + 0x1606: 0x000a, 0x1607: 0x000a, 0x1608: 0x000a, 0x1609: 0x000a, 0x160a: 0x000a, 0x160b: 0x000a, + 0x160c: 0x000a, 0x160d: 0x000a, 0x160e: 0x000a, 0x160f: 0x000a, 0x1610: 0x000a, 0x1611: 0x000a, + 0x1612: 0x0003, 0x1613: 0x0004, 0x1614: 0x000a, 0x1615: 0x000a, 0x1616: 0x000a, 0x1617: 0x000a, + 0x1618: 0x000a, 0x1619: 0x000a, 0x161a: 0x000a, 0x161b: 0x000a, 0x161c: 0x000a, 0x161d: 0x000a, + 0x161e: 0x000a, 0x161f: 0x000a, 0x1620: 0x000a, 0x1621: 0x000a, 0x1622: 0x000a, 0x1623: 0x000a, + 0x1624: 0x000a, 0x1625: 0x000a, 0x1626: 0x000a, 0x1627: 0x000a, 0x1628: 0x000a, 0x1629: 0x000a, + 0x162a: 0x000a, 0x162b: 0x000a, 0x162c: 0x000a, 0x162d: 0x000a, 0x162e: 0x000a, 0x162f: 0x000a, + 0x1630: 0x000a, 0x1631: 0x000a, 0x1632: 0x000a, 0x1633: 0x000a, 0x1634: 0x000a, 0x1635: 0x000a, + 0x1636: 0x000a, 0x1637: 0x000a, 0x1638: 0x000a, 0x1639: 0x000a, 0x163a: 0x000a, 0x163b: 0x000a, + 0x163c: 0x000a, 0x163d: 0x000a, 0x163e: 0x000a, 0x163f: 0x000a, + // Block 0x59, offset 0x1640 + 0x1640: 0x000a, 0x1641: 0x000a, 0x1642: 0x000a, 0x1643: 0x000a, 0x1644: 0x000a, 0x1645: 0x000a, + 0x1646: 0x000a, 0x1647: 0x000a, 0x1648: 0x003a, 0x1649: 0x002a, 0x164a: 0x003a, 0x164b: 0x002a, + 0x164c: 0x000a, 0x164d: 0x000a, 0x164e: 0x000a, 0x164f: 0x000a, 0x1650: 0x000a, 0x1651: 0x000a, + 0x1652: 0x000a, 0x1653: 0x000a, 0x1654: 0x000a, 0x1655: 0x000a, 0x1656: 0x000a, 0x1657: 0x000a, + 0x1658: 0x000a, 0x1659: 0x000a, 0x165a: 0x000a, 0x165b: 0x000a, 0x165c: 0x000a, 0x165d: 0x000a, + 0x165e: 0x000a, 0x165f: 0x000a, 0x1660: 0x000a, 0x1661: 0x000a, 0x1662: 0x000a, 0x1663: 0x000a, + 0x1664: 0x000a, 0x1665: 0x000a, 0x1666: 0x000a, 0x1667: 0x000a, 0x1668: 0x000a, 0x1669: 0x009a, + 0x166a: 0x008a, 0x166b: 0x000a, 0x166c: 0x000a, 0x166d: 0x000a, 0x166e: 0x000a, 0x166f: 0x000a, + 0x1670: 0x000a, 0x1671: 0x000a, 0x1672: 0x000a, 0x1673: 0x000a, 0x1674: 0x000a, 0x1675: 0x000a, + // Block 0x5a, offset 0x1680 + 0x16bb: 0x000a, + 0x16bc: 0x000a, 0x16bd: 0x000a, 0x16be: 0x000a, 0x16bf: 0x000a, + // Block 0x5b, offset 0x16c0 + 0x16c0: 0x000a, 0x16c1: 0x000a, 0x16c2: 0x000a, 0x16c3: 0x000a, 0x16c4: 0x000a, 0x16c5: 0x000a, + 0x16c6: 0x000a, 0x16c7: 0x000a, 0x16c8: 0x000a, 0x16c9: 0x000a, 0x16ca: 0x000a, 0x16cb: 0x000a, + 0x16cc: 0x000a, 0x16cd: 0x000a, 0x16ce: 0x000a, 0x16cf: 0x000a, 0x16d0: 0x000a, 0x16d1: 0x000a, + 0x16d2: 0x000a, 0x16d3: 0x000a, 0x16d4: 0x000a, 0x16d6: 0x000a, 0x16d7: 0x000a, + 0x16d8: 0x000a, 0x16d9: 0x000a, 0x16da: 0x000a, 0x16db: 0x000a, 0x16dc: 0x000a, 0x16dd: 0x000a, + 0x16de: 0x000a, 0x16df: 0x000a, 0x16e0: 0x000a, 0x16e1: 0x000a, 0x16e2: 0x000a, 0x16e3: 0x000a, + 0x16e4: 0x000a, 0x16e5: 0x000a, 0x16e6: 0x000a, 0x16e7: 0x000a, 0x16e8: 0x000a, 0x16e9: 0x000a, + 0x16ea: 0x000a, 0x16eb: 0x000a, 0x16ec: 0x000a, 0x16ed: 0x000a, 0x16ee: 0x000a, 0x16ef: 0x000a, + 0x16f0: 0x000a, 0x16f1: 0x000a, 0x16f2: 0x000a, 0x16f3: 0x000a, 0x16f4: 0x000a, 0x16f5: 0x000a, + 0x16f6: 0x000a, 0x16f7: 0x000a, 0x16f8: 0x000a, 0x16f9: 0x000a, 0x16fa: 0x000a, 0x16fb: 0x000a, + 0x16fc: 0x000a, 0x16fd: 0x000a, 0x16fe: 0x000a, 0x16ff: 0x000a, + // Block 0x5c, offset 0x1700 + 0x1700: 0x000a, 0x1701: 0x000a, 0x1702: 0x000a, 0x1703: 0x000a, 0x1704: 0x000a, 0x1705: 0x000a, + 0x1706: 0x000a, 0x1707: 0x000a, 0x1708: 0x000a, 0x1709: 0x000a, 0x170a: 0x000a, 0x170b: 0x000a, + 0x170c: 0x000a, 0x170d: 0x000a, 0x170e: 0x000a, 0x170f: 0x000a, 0x1710: 0x000a, 0x1711: 0x000a, + 0x1712: 0x000a, 0x1713: 0x000a, 0x1714: 0x000a, 0x1715: 0x000a, 0x1716: 0x000a, 0x1717: 0x000a, + 0x1718: 0x000a, 0x1719: 0x000a, 0x171a: 0x000a, 0x171b: 0x000a, 0x171c: 0x000a, 0x171d: 0x000a, + 0x171e: 0x000a, 0x171f: 0x000a, 0x1720: 0x000a, 0x1721: 0x000a, 0x1722: 0x000a, 0x1723: 0x000a, + 0x1724: 0x000a, 0x1725: 0x000a, 0x1726: 0x000a, + // Block 0x5d, offset 0x1740 + 0x1740: 0x000a, 0x1741: 0x000a, 0x1742: 0x000a, 0x1743: 0x000a, 0x1744: 0x000a, 0x1745: 0x000a, + 0x1746: 0x000a, 0x1747: 0x000a, 0x1748: 0x000a, 0x1749: 0x000a, 0x174a: 0x000a, + 0x1760: 0x000a, 0x1761: 0x000a, 0x1762: 0x000a, 0x1763: 0x000a, + 0x1764: 0x000a, 0x1765: 0x000a, 0x1766: 0x000a, 0x1767: 0x000a, 0x1768: 0x000a, 0x1769: 0x000a, + 0x176a: 0x000a, 0x176b: 0x000a, 0x176c: 0x000a, 0x176d: 0x000a, 0x176e: 0x000a, 0x176f: 0x000a, + 0x1770: 0x000a, 0x1771: 0x000a, 0x1772: 0x000a, 0x1773: 0x000a, 0x1774: 0x000a, 0x1775: 0x000a, + 0x1776: 0x000a, 0x1777: 0x000a, 0x1778: 0x000a, 0x1779: 0x000a, 0x177a: 0x000a, 0x177b: 0x000a, + 0x177c: 0x000a, 0x177d: 0x000a, 0x177e: 0x000a, 0x177f: 0x000a, + // Block 0x5e, offset 0x1780 + 0x1780: 0x000a, 0x1781: 0x000a, 0x1782: 0x000a, 0x1783: 0x000a, 0x1784: 0x000a, 0x1785: 0x000a, + 0x1786: 0x000a, 0x1787: 0x000a, 0x1788: 0x0002, 0x1789: 0x0002, 0x178a: 0x0002, 0x178b: 0x0002, + 0x178c: 0x0002, 0x178d: 0x0002, 0x178e: 0x0002, 0x178f: 0x0002, 0x1790: 0x0002, 0x1791: 0x0002, + 0x1792: 0x0002, 0x1793: 0x0002, 0x1794: 0x0002, 0x1795: 0x0002, 0x1796: 0x0002, 0x1797: 0x0002, + 0x1798: 0x0002, 0x1799: 0x0002, 0x179a: 0x0002, 0x179b: 0x0002, + // Block 0x5f, offset 0x17c0 + 0x17ea: 0x000a, 0x17eb: 0x000a, 0x17ec: 0x000a, 0x17ed: 0x000a, 0x17ee: 0x000a, 0x17ef: 0x000a, + 0x17f0: 0x000a, 0x17f1: 0x000a, 0x17f2: 0x000a, 0x17f3: 0x000a, 0x17f4: 0x000a, 0x17f5: 0x000a, + 0x17f6: 0x000a, 0x17f7: 0x000a, 0x17f8: 0x000a, 0x17f9: 0x000a, 0x17fa: 0x000a, 0x17fb: 0x000a, + 0x17fc: 0x000a, 0x17fd: 0x000a, 0x17fe: 0x000a, 0x17ff: 0x000a, + // Block 0x60, offset 0x1800 + 0x1800: 0x000a, 0x1801: 0x000a, 0x1802: 0x000a, 0x1803: 0x000a, 0x1804: 0x000a, 0x1805: 0x000a, + 0x1806: 0x000a, 0x1807: 0x000a, 0x1808: 0x000a, 0x1809: 0x000a, 0x180a: 0x000a, 0x180b: 0x000a, + 0x180c: 0x000a, 0x180d: 0x000a, 0x180e: 0x000a, 0x180f: 0x000a, 0x1810: 0x000a, 0x1811: 0x000a, + 0x1812: 0x000a, 0x1813: 0x000a, 0x1814: 0x000a, 0x1815: 0x000a, 0x1816: 0x000a, 0x1817: 0x000a, + 0x1818: 0x000a, 0x1819: 0x000a, 0x181a: 0x000a, 0x181b: 0x000a, 0x181c: 0x000a, 0x181d: 0x000a, + 0x181e: 0x000a, 0x181f: 0x000a, 0x1820: 0x000a, 0x1821: 0x000a, 0x1822: 0x000a, 0x1823: 0x000a, + 0x1824: 0x000a, 0x1825: 0x000a, 0x1826: 0x000a, 0x1827: 0x000a, 0x1828: 0x000a, 0x1829: 0x000a, + 0x182a: 0x000a, 0x182b: 0x000a, 0x182d: 0x000a, 0x182e: 0x000a, 0x182f: 0x000a, + 0x1830: 0x000a, 0x1831: 0x000a, 0x1832: 0x000a, 0x1833: 0x000a, 0x1834: 0x000a, 0x1835: 0x000a, + 0x1836: 0x000a, 0x1837: 0x000a, 0x1838: 0x000a, 0x1839: 0x000a, 0x183a: 0x000a, 0x183b: 0x000a, + 0x183c: 0x000a, 0x183d: 0x000a, 0x183e: 0x000a, 0x183f: 0x000a, + // Block 0x61, offset 0x1840 + 0x1840: 0x000a, 0x1841: 0x000a, 0x1842: 0x000a, 0x1843: 0x000a, 0x1844: 0x000a, 0x1845: 0x000a, + 0x1846: 0x000a, 0x1847: 0x000a, 0x1848: 0x000a, 0x1849: 0x000a, 0x184a: 0x000a, 0x184b: 0x000a, + 0x184c: 0x000a, 0x184d: 0x000a, 0x184e: 0x000a, 0x184f: 0x000a, 0x1850: 0x000a, 0x1851: 0x000a, + 0x1852: 0x000a, 0x1853: 0x000a, 0x1854: 0x000a, 0x1855: 0x000a, 0x1856: 0x000a, 0x1857: 0x000a, + 0x1858: 0x000a, 0x1859: 0x000a, 0x185a: 0x000a, 0x185b: 0x000a, 0x185c: 0x000a, 0x185d: 0x000a, + 0x185e: 0x000a, 0x185f: 0x000a, 0x1860: 0x000a, 0x1861: 0x000a, 0x1862: 0x000a, 0x1863: 0x000a, + 0x1864: 0x000a, 0x1865: 0x000a, 0x1866: 0x000a, 0x1867: 0x000a, 0x1868: 0x003a, 0x1869: 0x002a, + 0x186a: 0x003a, 0x186b: 0x002a, 0x186c: 0x003a, 0x186d: 0x002a, 0x186e: 0x003a, 0x186f: 0x002a, + 0x1870: 0x003a, 0x1871: 0x002a, 0x1872: 0x003a, 0x1873: 0x002a, 0x1874: 0x003a, 0x1875: 0x002a, + 0x1876: 0x000a, 0x1877: 0x000a, 0x1878: 0x000a, 0x1879: 0x000a, 0x187a: 0x000a, 0x187b: 0x000a, + 0x187c: 0x000a, 0x187d: 0x000a, 0x187e: 0x000a, 0x187f: 0x000a, + // Block 0x62, offset 0x1880 + 0x1880: 0x000a, 0x1881: 0x000a, 0x1882: 0x000a, 0x1883: 0x000a, 0x1884: 0x000a, 0x1885: 0x009a, + 0x1886: 0x008a, 0x1887: 0x000a, 0x1888: 0x000a, 0x1889: 0x000a, 0x188a: 0x000a, 0x188b: 0x000a, + 0x188c: 0x000a, 0x188d: 0x000a, 0x188e: 0x000a, 0x188f: 0x000a, 0x1890: 0x000a, 0x1891: 0x000a, + 0x1892: 0x000a, 0x1893: 0x000a, 0x1894: 0x000a, 0x1895: 0x000a, 0x1896: 0x000a, 0x1897: 0x000a, + 0x1898: 0x000a, 0x1899: 0x000a, 0x189a: 0x000a, 0x189b: 0x000a, 0x189c: 0x000a, 0x189d: 0x000a, + 0x189e: 0x000a, 0x189f: 0x000a, 0x18a0: 0x000a, 0x18a1: 0x000a, 0x18a2: 0x000a, 0x18a3: 0x000a, + 0x18a4: 0x000a, 0x18a5: 0x000a, 0x18a6: 0x003a, 0x18a7: 0x002a, 0x18a8: 0x003a, 0x18a9: 0x002a, + 0x18aa: 0x003a, 0x18ab: 0x002a, 0x18ac: 0x003a, 0x18ad: 0x002a, 0x18ae: 0x003a, 0x18af: 0x002a, + 0x18b0: 0x000a, 0x18b1: 0x000a, 0x18b2: 0x000a, 0x18b3: 0x000a, 0x18b4: 0x000a, 0x18b5: 0x000a, + 0x18b6: 0x000a, 0x18b7: 0x000a, 0x18b8: 0x000a, 0x18b9: 0x000a, 0x18ba: 0x000a, 0x18bb: 0x000a, + 0x18bc: 0x000a, 0x18bd: 0x000a, 0x18be: 0x000a, 0x18bf: 0x000a, + // Block 0x63, offset 0x18c0 + 0x18c0: 0x000a, 0x18c1: 0x000a, 0x18c2: 0x000a, 0x18c3: 0x007a, 0x18c4: 0x006a, 0x18c5: 0x009a, + 0x18c6: 0x008a, 0x18c7: 0x00ba, 0x18c8: 0x00aa, 0x18c9: 0x009a, 0x18ca: 0x008a, 0x18cb: 0x007a, + 0x18cc: 0x006a, 0x18cd: 0x00da, 0x18ce: 0x002a, 0x18cf: 0x003a, 0x18d0: 0x00ca, 0x18d1: 0x009a, + 0x18d2: 0x008a, 0x18d3: 0x007a, 0x18d4: 0x006a, 0x18d5: 0x009a, 0x18d6: 0x008a, 0x18d7: 0x00ba, + 0x18d8: 0x00aa, 0x18d9: 0x000a, 0x18da: 0x000a, 0x18db: 0x000a, 0x18dc: 0x000a, 0x18dd: 0x000a, + 0x18de: 0x000a, 0x18df: 0x000a, 0x18e0: 0x000a, 0x18e1: 0x000a, 0x18e2: 0x000a, 0x18e3: 0x000a, + 0x18e4: 0x000a, 0x18e5: 0x000a, 0x18e6: 0x000a, 0x18e7: 0x000a, 0x18e8: 0x000a, 0x18e9: 0x000a, + 0x18ea: 0x000a, 0x18eb: 0x000a, 0x18ec: 0x000a, 0x18ed: 0x000a, 0x18ee: 0x000a, 0x18ef: 0x000a, + 0x18f0: 0x000a, 0x18f1: 0x000a, 0x18f2: 0x000a, 0x18f3: 0x000a, 0x18f4: 0x000a, 0x18f5: 0x000a, + 0x18f6: 0x000a, 0x18f7: 0x000a, 0x18f8: 0x000a, 0x18f9: 0x000a, 0x18fa: 0x000a, 0x18fb: 0x000a, + 0x18fc: 0x000a, 0x18fd: 0x000a, 0x18fe: 0x000a, 0x18ff: 0x000a, + // Block 0x64, offset 0x1900 + 0x1900: 0x000a, 0x1901: 0x000a, 0x1902: 0x000a, 0x1903: 0x000a, 0x1904: 0x000a, 0x1905: 0x000a, + 0x1906: 0x000a, 0x1907: 0x000a, 0x1908: 0x000a, 0x1909: 0x000a, 0x190a: 0x000a, 0x190b: 0x000a, + 0x190c: 0x000a, 0x190d: 0x000a, 0x190e: 0x000a, 0x190f: 0x000a, 0x1910: 0x000a, 0x1911: 0x000a, + 0x1912: 0x000a, 0x1913: 0x000a, 0x1914: 0x000a, 0x1915: 0x000a, 0x1916: 0x000a, 0x1917: 0x000a, + 0x1918: 0x003a, 0x1919: 0x002a, 0x191a: 0x003a, 0x191b: 0x002a, 0x191c: 0x000a, 0x191d: 0x000a, + 0x191e: 0x000a, 0x191f: 0x000a, 0x1920: 0x000a, 0x1921: 0x000a, 0x1922: 0x000a, 0x1923: 0x000a, + 0x1924: 0x000a, 0x1925: 0x000a, 0x1926: 0x000a, 0x1927: 0x000a, 0x1928: 0x000a, 0x1929: 0x000a, + 0x192a: 0x000a, 0x192b: 0x000a, 0x192c: 0x000a, 0x192d: 0x000a, 0x192e: 0x000a, 0x192f: 0x000a, + 0x1930: 0x000a, 0x1931: 0x000a, 0x1932: 0x000a, 0x1933: 0x000a, 0x1934: 0x000a, 0x1935: 0x000a, + 0x1936: 0x000a, 0x1937: 0x000a, 0x1938: 0x000a, 0x1939: 0x000a, 0x193a: 0x000a, 0x193b: 0x000a, + 0x193c: 0x003a, 0x193d: 0x002a, 0x193e: 0x000a, 0x193f: 0x000a, + // Block 0x65, offset 0x1940 + 0x1940: 0x000a, 0x1941: 0x000a, 0x1942: 0x000a, 0x1943: 0x000a, 0x1944: 0x000a, 0x1945: 0x000a, + 0x1946: 0x000a, 0x1947: 0x000a, 0x1948: 0x000a, 0x1949: 0x000a, 0x194a: 0x000a, 0x194b: 0x000a, + 0x194c: 0x000a, 0x194d: 0x000a, 0x194e: 0x000a, 0x194f: 0x000a, 0x1950: 0x000a, 0x1951: 0x000a, + 0x1952: 0x000a, 0x1953: 0x000a, 0x1954: 0x000a, 0x1955: 0x000a, 0x1956: 0x000a, 0x1957: 0x000a, + 0x1958: 0x000a, 0x1959: 0x000a, 0x195a: 0x000a, 0x195b: 0x000a, 0x195c: 0x000a, 0x195d: 0x000a, + 0x195e: 0x000a, 0x195f: 0x000a, 0x1960: 0x000a, 0x1961: 0x000a, 0x1962: 0x000a, 0x1963: 0x000a, + 0x1964: 0x000a, 0x1965: 0x000a, 0x1966: 0x000a, 0x1967: 0x000a, 0x1968: 0x000a, 0x1969: 0x000a, + 0x196a: 0x000a, 0x196b: 0x000a, 0x196c: 0x000a, 0x196d: 0x000a, 0x196e: 0x000a, 0x196f: 0x000a, + 0x1970: 0x000a, 0x1971: 0x000a, 0x1972: 0x000a, 0x1973: 0x000a, + 0x1976: 0x000a, 0x1977: 0x000a, 0x1978: 0x000a, 0x1979: 0x000a, 0x197a: 0x000a, 0x197b: 0x000a, + 0x197c: 0x000a, 0x197d: 0x000a, 0x197e: 0x000a, 0x197f: 0x000a, + // Block 0x66, offset 0x1980 + 0x1980: 0x000a, 0x1981: 0x000a, 0x1982: 0x000a, 0x1983: 0x000a, 0x1984: 0x000a, 0x1985: 0x000a, + 0x1986: 0x000a, 0x1987: 0x000a, 0x1988: 0x000a, 0x1989: 0x000a, 0x198a: 0x000a, 0x198b: 0x000a, + 0x198c: 0x000a, 0x198d: 0x000a, 0x198e: 0x000a, 0x198f: 0x000a, 0x1990: 0x000a, 0x1991: 0x000a, + 0x1992: 0x000a, 0x1993: 0x000a, 0x1994: 0x000a, 0x1995: 0x000a, 0x1997: 0x000a, + 0x1998: 0x000a, 0x1999: 0x000a, 0x199a: 0x000a, 0x199b: 0x000a, 0x199c: 0x000a, 0x199d: 0x000a, + 0x199e: 0x000a, 0x199f: 0x000a, 0x19a0: 0x000a, 0x19a1: 0x000a, 0x19a2: 0x000a, 0x19a3: 0x000a, + 0x19a4: 0x000a, 0x19a5: 0x000a, 0x19a6: 0x000a, 0x19a7: 0x000a, 0x19a8: 0x000a, 0x19a9: 0x000a, + 0x19aa: 0x000a, 0x19ab: 0x000a, 0x19ac: 0x000a, 0x19ad: 0x000a, 0x19ae: 0x000a, 0x19af: 0x000a, + 0x19b0: 0x000a, 0x19b1: 0x000a, 0x19b2: 0x000a, 0x19b3: 0x000a, 0x19b4: 0x000a, 0x19b5: 0x000a, + 0x19b6: 0x000a, 0x19b7: 0x000a, 0x19b8: 0x000a, 0x19b9: 0x000a, 0x19ba: 0x000a, 0x19bb: 0x000a, + 0x19bc: 0x000a, 0x19bd: 0x000a, 0x19be: 0x000a, 0x19bf: 0x000a, + // Block 0x67, offset 0x19c0 + 0x19e5: 0x000a, 0x19e6: 0x000a, 0x19e7: 0x000a, 0x19e8: 0x000a, 0x19e9: 0x000a, + 0x19ea: 0x000a, 0x19ef: 0x000c, + 0x19f0: 0x000c, 0x19f1: 0x000c, + 0x19f9: 0x000a, 0x19fa: 0x000a, 0x19fb: 0x000a, + 0x19fc: 0x000a, 0x19fd: 0x000a, 0x19fe: 0x000a, 0x19ff: 0x000a, + // Block 0x68, offset 0x1a00 + 0x1a3f: 0x000c, + // Block 0x69, offset 0x1a40 + 0x1a60: 0x000c, 0x1a61: 0x000c, 0x1a62: 0x000c, 0x1a63: 0x000c, + 0x1a64: 0x000c, 0x1a65: 0x000c, 0x1a66: 0x000c, 0x1a67: 0x000c, 0x1a68: 0x000c, 0x1a69: 0x000c, + 0x1a6a: 0x000c, 0x1a6b: 0x000c, 0x1a6c: 0x000c, 0x1a6d: 0x000c, 0x1a6e: 0x000c, 0x1a6f: 0x000c, + 0x1a70: 0x000c, 0x1a71: 0x000c, 0x1a72: 0x000c, 0x1a73: 0x000c, 0x1a74: 0x000c, 0x1a75: 0x000c, + 0x1a76: 0x000c, 0x1a77: 0x000c, 0x1a78: 0x000c, 0x1a79: 0x000c, 0x1a7a: 0x000c, 0x1a7b: 0x000c, + 0x1a7c: 0x000c, 0x1a7d: 0x000c, 0x1a7e: 0x000c, 0x1a7f: 0x000c, + // Block 0x6a, offset 0x1a80 + 0x1a80: 0x000a, 0x1a81: 0x000a, 0x1a82: 0x000a, 0x1a83: 0x000a, 0x1a84: 0x000a, 0x1a85: 0x000a, + 0x1a86: 0x000a, 0x1a87: 0x000a, 0x1a88: 0x000a, 0x1a89: 0x000a, 0x1a8a: 0x000a, 0x1a8b: 0x000a, + 0x1a8c: 0x000a, 0x1a8d: 0x000a, 0x1a8e: 0x000a, 0x1a8f: 0x000a, 0x1a90: 0x000a, 0x1a91: 0x000a, + 0x1a92: 0x000a, 0x1a93: 0x000a, 0x1a94: 0x000a, 0x1a95: 0x000a, 0x1a96: 0x000a, 0x1a97: 0x000a, + 0x1a98: 0x000a, 0x1a99: 0x000a, 0x1a9a: 0x000a, 0x1a9b: 0x000a, 0x1a9c: 0x000a, 0x1a9d: 0x000a, + 0x1a9e: 0x000a, 0x1a9f: 0x000a, 0x1aa0: 0x000a, 0x1aa1: 0x000a, 0x1aa2: 0x003a, 0x1aa3: 0x002a, + 0x1aa4: 0x003a, 0x1aa5: 0x002a, 0x1aa6: 0x003a, 0x1aa7: 0x002a, 0x1aa8: 0x003a, 0x1aa9: 0x002a, + 0x1aaa: 0x000a, 0x1aab: 0x000a, 0x1aac: 0x000a, 0x1aad: 0x000a, 0x1aae: 0x000a, 0x1aaf: 0x000a, + 0x1ab0: 0x000a, 0x1ab1: 0x000a, 0x1ab2: 0x000a, 0x1ab3: 0x000a, 0x1ab4: 0x000a, 0x1ab5: 0x000a, + 0x1ab6: 0x000a, 0x1ab7: 0x000a, 0x1ab8: 0x000a, 0x1ab9: 0x000a, 0x1aba: 0x000a, 0x1abb: 0x000a, + 0x1abc: 0x000a, 0x1abd: 0x000a, 0x1abe: 0x000a, 0x1abf: 0x000a, + // Block 0x6b, offset 0x1ac0 + 0x1ac0: 0x000a, 0x1ac1: 0x000a, 0x1ac2: 0x000a, 0x1ac3: 0x000a, 0x1ac4: 0x000a, 0x1ac5: 0x000a, + 0x1ac6: 0x000a, 0x1ac7: 0x000a, 0x1ac8: 0x000a, 0x1ac9: 0x000a, 0x1aca: 0x000a, 0x1acb: 0x000a, + 0x1acc: 0x000a, 0x1acd: 0x000a, 0x1ace: 0x000a, 0x1acf: 0x000a, 0x1ad0: 0x000a, 0x1ad1: 0x000a, + 0x1ad2: 0x000a, 0x1ad3: 0x000a, 0x1ad4: 0x000a, 0x1ad5: 0x009a, 0x1ad6: 0x008a, 0x1ad7: 0x00ba, + 0x1ad8: 0x00aa, 0x1ad9: 0x009a, 0x1ada: 0x008a, 0x1adb: 0x007a, 0x1adc: 0x006a, 0x1add: 0x000a, + // Block 0x6c, offset 0x1b00 + 0x1b00: 0x000a, 0x1b01: 0x000a, 0x1b02: 0x000a, 0x1b03: 0x000a, 0x1b04: 0x000a, 0x1b05: 0x000a, + 0x1b06: 0x000a, 0x1b07: 0x000a, 0x1b08: 0x000a, 0x1b09: 0x000a, 0x1b0a: 0x000a, 0x1b0b: 0x000a, + 0x1b0c: 0x000a, 0x1b0d: 0x000a, 0x1b0e: 0x000a, 0x1b0f: 0x000a, 0x1b10: 0x000a, 0x1b11: 0x000a, + 0x1b12: 0x000a, 0x1b13: 0x000a, 0x1b14: 0x000a, 0x1b15: 0x000a, 0x1b16: 0x000a, 0x1b17: 0x000a, + 0x1b18: 0x000a, 0x1b19: 0x000a, 0x1b1b: 0x000a, 0x1b1c: 0x000a, 0x1b1d: 0x000a, + 0x1b1e: 0x000a, 0x1b1f: 0x000a, 0x1b20: 0x000a, 0x1b21: 0x000a, 0x1b22: 0x000a, 0x1b23: 0x000a, + 0x1b24: 0x000a, 0x1b25: 0x000a, 0x1b26: 0x000a, 0x1b27: 0x000a, 0x1b28: 0x000a, 0x1b29: 0x000a, + 0x1b2a: 0x000a, 0x1b2b: 0x000a, 0x1b2c: 0x000a, 0x1b2d: 0x000a, 0x1b2e: 0x000a, 0x1b2f: 0x000a, + 0x1b30: 0x000a, 0x1b31: 0x000a, 0x1b32: 0x000a, 0x1b33: 0x000a, 0x1b34: 0x000a, 0x1b35: 0x000a, + 0x1b36: 0x000a, 0x1b37: 0x000a, 0x1b38: 0x000a, 0x1b39: 0x000a, 0x1b3a: 0x000a, 0x1b3b: 0x000a, + 0x1b3c: 0x000a, 0x1b3d: 0x000a, 0x1b3e: 0x000a, 0x1b3f: 0x000a, + // Block 0x6d, offset 0x1b40 + 0x1b40: 0x000a, 0x1b41: 0x000a, 0x1b42: 0x000a, 0x1b43: 0x000a, 0x1b44: 0x000a, 0x1b45: 0x000a, + 0x1b46: 0x000a, 0x1b47: 0x000a, 0x1b48: 0x000a, 0x1b49: 0x000a, 0x1b4a: 0x000a, 0x1b4b: 0x000a, + 0x1b4c: 0x000a, 0x1b4d: 0x000a, 0x1b4e: 0x000a, 0x1b4f: 0x000a, 0x1b50: 0x000a, 0x1b51: 0x000a, + 0x1b52: 0x000a, 0x1b53: 0x000a, 0x1b54: 0x000a, 0x1b55: 0x000a, 0x1b56: 0x000a, 0x1b57: 0x000a, + 0x1b58: 0x000a, 0x1b59: 0x000a, 0x1b5a: 0x000a, 0x1b5b: 0x000a, 0x1b5c: 0x000a, 0x1b5d: 0x000a, + 0x1b5e: 0x000a, 0x1b5f: 0x000a, 0x1b60: 0x000a, 0x1b61: 0x000a, 0x1b62: 0x000a, 0x1b63: 0x000a, + 0x1b64: 0x000a, 0x1b65: 0x000a, 0x1b66: 0x000a, 0x1b67: 0x000a, 0x1b68: 0x000a, 0x1b69: 0x000a, + 0x1b6a: 0x000a, 0x1b6b: 0x000a, 0x1b6c: 0x000a, 0x1b6d: 0x000a, 0x1b6e: 0x000a, 0x1b6f: 0x000a, + 0x1b70: 0x000a, 0x1b71: 0x000a, 0x1b72: 0x000a, 0x1b73: 0x000a, + // Block 0x6e, offset 0x1b80 + 0x1b80: 0x000a, 0x1b81: 0x000a, 0x1b82: 0x000a, 0x1b83: 0x000a, 0x1b84: 0x000a, 0x1b85: 0x000a, + 0x1b86: 0x000a, 0x1b87: 0x000a, 0x1b88: 0x000a, 0x1b89: 0x000a, 0x1b8a: 0x000a, 0x1b8b: 0x000a, + 0x1b8c: 0x000a, 0x1b8d: 0x000a, 0x1b8e: 0x000a, 0x1b8f: 0x000a, 0x1b90: 0x000a, 0x1b91: 0x000a, + 0x1b92: 0x000a, 0x1b93: 0x000a, 0x1b94: 0x000a, 0x1b95: 0x000a, + 0x1bb0: 0x000a, 0x1bb1: 0x000a, 0x1bb2: 0x000a, 0x1bb3: 0x000a, 0x1bb4: 0x000a, 0x1bb5: 0x000a, + 0x1bb6: 0x000a, 0x1bb7: 0x000a, 0x1bb8: 0x000a, 0x1bb9: 0x000a, 0x1bba: 0x000a, 0x1bbb: 0x000a, + // Block 0x6f, offset 0x1bc0 + 0x1bc0: 0x0009, 0x1bc1: 0x000a, 0x1bc2: 0x000a, 0x1bc3: 0x000a, 0x1bc4: 0x000a, + 0x1bc8: 0x003a, 0x1bc9: 0x002a, 0x1bca: 0x003a, 0x1bcb: 0x002a, + 0x1bcc: 0x003a, 0x1bcd: 0x002a, 0x1bce: 0x003a, 0x1bcf: 0x002a, 0x1bd0: 0x003a, 0x1bd1: 0x002a, + 0x1bd2: 0x000a, 0x1bd3: 0x000a, 0x1bd4: 0x003a, 0x1bd5: 0x002a, 0x1bd6: 0x003a, 0x1bd7: 0x002a, + 0x1bd8: 0x003a, 0x1bd9: 0x002a, 0x1bda: 0x003a, 0x1bdb: 0x002a, 0x1bdc: 0x000a, 0x1bdd: 0x000a, + 0x1bde: 0x000a, 0x1bdf: 0x000a, 0x1be0: 0x000a, + 0x1bea: 0x000c, 0x1beb: 0x000c, 0x1bec: 0x000c, 0x1bed: 0x000c, + 0x1bf0: 0x000a, + 0x1bf6: 0x000a, 0x1bf7: 0x000a, + 0x1bfd: 0x000a, 0x1bfe: 0x000a, 0x1bff: 0x000a, + // Block 0x70, offset 0x1c00 + 0x1c19: 0x000c, 0x1c1a: 0x000c, 0x1c1b: 0x000a, 0x1c1c: 0x000a, + 0x1c20: 0x000a, + // Block 0x71, offset 0x1c40 + 0x1c7b: 0x000a, + // Block 0x72, offset 0x1c80 + 0x1c80: 0x000a, 0x1c81: 0x000a, 0x1c82: 0x000a, 0x1c83: 0x000a, 0x1c84: 0x000a, 0x1c85: 0x000a, + 0x1c86: 0x000a, 0x1c87: 0x000a, 0x1c88: 0x000a, 0x1c89: 0x000a, 0x1c8a: 0x000a, 0x1c8b: 0x000a, + 0x1c8c: 0x000a, 0x1c8d: 0x000a, 0x1c8e: 0x000a, 0x1c8f: 0x000a, 0x1c90: 0x000a, 0x1c91: 0x000a, + 0x1c92: 0x000a, 0x1c93: 0x000a, 0x1c94: 0x000a, 0x1c95: 0x000a, 0x1c96: 0x000a, 0x1c97: 0x000a, + 0x1c98: 0x000a, 0x1c99: 0x000a, 0x1c9a: 0x000a, 0x1c9b: 0x000a, 0x1c9c: 0x000a, 0x1c9d: 0x000a, + 0x1c9e: 0x000a, 0x1c9f: 0x000a, 0x1ca0: 0x000a, 0x1ca1: 0x000a, 0x1ca2: 0x000a, 0x1ca3: 0x000a, + // Block 0x73, offset 0x1cc0 + 0x1cdd: 0x000a, + 0x1cde: 0x000a, + // Block 0x74, offset 0x1d00 + 0x1d10: 0x000a, 0x1d11: 0x000a, + 0x1d12: 0x000a, 0x1d13: 0x000a, 0x1d14: 0x000a, 0x1d15: 0x000a, 0x1d16: 0x000a, 0x1d17: 0x000a, + 0x1d18: 0x000a, 0x1d19: 0x000a, 0x1d1a: 0x000a, 0x1d1b: 0x000a, 0x1d1c: 0x000a, 0x1d1d: 0x000a, + 0x1d1e: 0x000a, 0x1d1f: 0x000a, + 0x1d3c: 0x000a, 0x1d3d: 0x000a, 0x1d3e: 0x000a, + // Block 0x75, offset 0x1d40 + 0x1d71: 0x000a, 0x1d72: 0x000a, 0x1d73: 0x000a, 0x1d74: 0x000a, 0x1d75: 0x000a, + 0x1d76: 0x000a, 0x1d77: 0x000a, 0x1d78: 0x000a, 0x1d79: 0x000a, 0x1d7a: 0x000a, 0x1d7b: 0x000a, + 0x1d7c: 0x000a, 0x1d7d: 0x000a, 0x1d7e: 0x000a, 0x1d7f: 0x000a, + // Block 0x76, offset 0x1d80 + 0x1d8c: 0x000a, 0x1d8d: 0x000a, 0x1d8e: 0x000a, 0x1d8f: 0x000a, + // Block 0x77, offset 0x1dc0 + 0x1df7: 0x000a, 0x1df8: 0x000a, 0x1df9: 0x000a, 0x1dfa: 0x000a, + // Block 0x78, offset 0x1e00 + 0x1e1e: 0x000a, 0x1e1f: 0x000a, + 0x1e3f: 0x000a, + // Block 0x79, offset 0x1e40 + 0x1e50: 0x000a, 0x1e51: 0x000a, + 0x1e52: 0x000a, 0x1e53: 0x000a, 0x1e54: 0x000a, 0x1e55: 0x000a, 0x1e56: 0x000a, 0x1e57: 0x000a, + 0x1e58: 0x000a, 0x1e59: 0x000a, 0x1e5a: 0x000a, 0x1e5b: 0x000a, 0x1e5c: 0x000a, 0x1e5d: 0x000a, + 0x1e5e: 0x000a, 0x1e5f: 0x000a, 0x1e60: 0x000a, 0x1e61: 0x000a, 0x1e62: 0x000a, 0x1e63: 0x000a, + 0x1e64: 0x000a, 0x1e65: 0x000a, 0x1e66: 0x000a, 0x1e67: 0x000a, 0x1e68: 0x000a, 0x1e69: 0x000a, + 0x1e6a: 0x000a, 0x1e6b: 0x000a, 0x1e6c: 0x000a, 0x1e6d: 0x000a, 0x1e6e: 0x000a, 0x1e6f: 0x000a, + 0x1e70: 0x000a, 0x1e71: 0x000a, 0x1e72: 0x000a, 0x1e73: 0x000a, 0x1e74: 0x000a, 0x1e75: 0x000a, + 0x1e76: 0x000a, 0x1e77: 0x000a, 0x1e78: 0x000a, 0x1e79: 0x000a, 0x1e7a: 0x000a, 0x1e7b: 0x000a, + 0x1e7c: 0x000a, 0x1e7d: 0x000a, 0x1e7e: 0x000a, 0x1e7f: 0x000a, + // Block 0x7a, offset 0x1e80 + 0x1e80: 0x000a, 0x1e81: 0x000a, 0x1e82: 0x000a, 0x1e83: 0x000a, 0x1e84: 0x000a, 0x1e85: 0x000a, + 0x1e86: 0x000a, + // Block 0x7b, offset 0x1ec0 + 0x1ecd: 0x000a, 0x1ece: 0x000a, 0x1ecf: 0x000a, + // Block 0x7c, offset 0x1f00 + 0x1f2f: 0x000c, + 0x1f30: 0x000c, 0x1f31: 0x000c, 0x1f32: 0x000c, 0x1f33: 0x000a, 0x1f34: 0x000c, 0x1f35: 0x000c, + 0x1f36: 0x000c, 0x1f37: 0x000c, 0x1f38: 0x000c, 0x1f39: 0x000c, 0x1f3a: 0x000c, 0x1f3b: 0x000c, + 0x1f3c: 0x000c, 0x1f3d: 0x000c, 0x1f3e: 0x000a, 0x1f3f: 0x000a, + // Block 0x7d, offset 0x1f40 + 0x1f5e: 0x000c, 0x1f5f: 0x000c, + // Block 0x7e, offset 0x1f80 + 0x1fb0: 0x000c, 0x1fb1: 0x000c, + // Block 0x7f, offset 0x1fc0 + 0x1fc0: 0x000a, 0x1fc1: 0x000a, 0x1fc2: 0x000a, 0x1fc3: 0x000a, 0x1fc4: 0x000a, 0x1fc5: 0x000a, + 0x1fc6: 0x000a, 0x1fc7: 0x000a, 0x1fc8: 0x000a, 0x1fc9: 0x000a, 0x1fca: 0x000a, 0x1fcb: 0x000a, + 0x1fcc: 0x000a, 0x1fcd: 0x000a, 0x1fce: 0x000a, 0x1fcf: 0x000a, 0x1fd0: 0x000a, 0x1fd1: 0x000a, + 0x1fd2: 0x000a, 0x1fd3: 0x000a, 0x1fd4: 0x000a, 0x1fd5: 0x000a, 0x1fd6: 0x000a, 0x1fd7: 0x000a, + 0x1fd8: 0x000a, 0x1fd9: 0x000a, 0x1fda: 0x000a, 0x1fdb: 0x000a, 0x1fdc: 0x000a, 0x1fdd: 0x000a, + 0x1fde: 0x000a, 0x1fdf: 0x000a, 0x1fe0: 0x000a, 0x1fe1: 0x000a, + // Block 0x80, offset 0x2000 + 0x2008: 0x000a, + // Block 0x81, offset 0x2040 + 0x2042: 0x000c, + 0x2046: 0x000c, 0x204b: 0x000c, + 0x2065: 0x000c, 0x2066: 0x000c, 0x2068: 0x000a, 0x2069: 0x000a, + 0x206a: 0x000a, 0x206b: 0x000a, 0x206c: 0x000c, + 0x2078: 0x0004, 0x2079: 0x0004, + // Block 0x82, offset 0x2080 + 0x20b4: 0x000a, 0x20b5: 0x000a, + 0x20b6: 0x000a, 0x20b7: 0x000a, + // Block 0x83, offset 0x20c0 + 0x20c4: 0x000c, 0x20c5: 0x000c, + 0x20e0: 0x000c, 0x20e1: 0x000c, 0x20e2: 0x000c, 0x20e3: 0x000c, + 0x20e4: 0x000c, 0x20e5: 0x000c, 0x20e6: 0x000c, 0x20e7: 0x000c, 0x20e8: 0x000c, 0x20e9: 0x000c, + 0x20ea: 0x000c, 0x20eb: 0x000c, 0x20ec: 0x000c, 0x20ed: 0x000c, 0x20ee: 0x000c, 0x20ef: 0x000c, + 0x20f0: 0x000c, 0x20f1: 0x000c, + 0x20ff: 0x000c, + // Block 0x84, offset 0x2100 + 0x2126: 0x000c, 0x2127: 0x000c, 0x2128: 0x000c, 0x2129: 0x000c, + 0x212a: 0x000c, 0x212b: 0x000c, 0x212c: 0x000c, 0x212d: 0x000c, + // Block 0x85, offset 0x2140 + 0x2147: 0x000c, 0x2148: 0x000c, 0x2149: 0x000c, 0x214a: 0x000c, 0x214b: 0x000c, + 0x214c: 0x000c, 0x214d: 0x000c, 0x214e: 0x000c, 0x214f: 0x000c, 0x2150: 0x000c, 0x2151: 0x000c, + // Block 0x86, offset 0x2180 + 0x2180: 0x000c, 0x2181: 0x000c, 0x2182: 0x000c, + 0x21b3: 0x000c, + 0x21b6: 0x000c, 0x21b7: 0x000c, 0x21b8: 0x000c, 0x21b9: 0x000c, + 0x21bc: 0x000c, 0x21bd: 0x000c, + // Block 0x87, offset 0x21c0 + 0x21e5: 0x000c, + // Block 0x88, offset 0x2200 + 0x2229: 0x000c, + 0x222a: 0x000c, 0x222b: 0x000c, 0x222c: 0x000c, 0x222d: 0x000c, 0x222e: 0x000c, + 0x2231: 0x000c, 0x2232: 0x000c, 0x2235: 0x000c, + 0x2236: 0x000c, + // Block 0x89, offset 0x2240 + 0x2243: 0x000c, + 0x224c: 0x000c, + 0x227c: 0x000c, + // Block 0x8a, offset 0x2280 + 0x22b0: 0x000c, 0x22b2: 0x000c, 0x22b3: 0x000c, 0x22b4: 0x000c, + 0x22b7: 0x000c, 0x22b8: 0x000c, + 0x22be: 0x000c, 0x22bf: 0x000c, + // Block 0x8b, offset 0x22c0 + 0x22c1: 0x000c, + 0x22ec: 0x000c, 0x22ed: 0x000c, + 0x22f6: 0x000c, + // Block 0x8c, offset 0x2300 + 0x232a: 0x000a, 0x232b: 0x000a, + // Block 0x8d, offset 0x2340 + 0x2365: 0x000c, 0x2368: 0x000c, + 0x236d: 0x000c, + // Block 0x8e, offset 0x2380 + 0x239d: 0x0001, + 0x239e: 0x000c, 0x239f: 0x0001, 0x23a0: 0x0001, 0x23a1: 0x0001, 0x23a2: 0x0001, 0x23a3: 0x0001, + 0x23a4: 0x0001, 0x23a5: 0x0001, 0x23a6: 0x0001, 0x23a7: 0x0001, 0x23a8: 0x0001, 0x23a9: 0x0003, + 0x23aa: 0x0001, 0x23ab: 0x0001, 0x23ac: 0x0001, 0x23ad: 0x0001, 0x23ae: 0x0001, 0x23af: 0x0001, + 0x23b0: 0x0001, 0x23b1: 0x0001, 0x23b2: 0x0001, 0x23b3: 0x0001, 0x23b4: 0x0001, 0x23b5: 0x0001, + 0x23b6: 0x0001, 0x23b7: 0x0001, 0x23b8: 0x0001, 0x23b9: 0x0001, 0x23ba: 0x0001, 0x23bb: 0x0001, + 0x23bc: 0x0001, 0x23bd: 0x0001, 0x23be: 0x0001, 0x23bf: 0x0001, + // Block 0x8f, offset 0x23c0 + 0x23c0: 0x0001, 0x23c1: 0x0001, 0x23c2: 0x0001, 0x23c3: 0x0001, 0x23c4: 0x0001, 0x23c5: 0x0001, + 0x23c6: 0x0001, 0x23c7: 0x0001, 0x23c8: 0x0001, 0x23c9: 0x0001, 0x23ca: 0x0001, 0x23cb: 0x0001, + 0x23cc: 0x0001, 0x23cd: 0x0001, 0x23ce: 0x0001, 0x23cf: 0x0001, 0x23d0: 0x000d, 0x23d1: 0x000d, + 0x23d2: 0x000d, 0x23d3: 0x000d, 0x23d4: 0x000d, 0x23d5: 0x000d, 0x23d6: 0x000d, 0x23d7: 0x000d, + 0x23d8: 0x000d, 0x23d9: 0x000d, 0x23da: 0x000d, 0x23db: 0x000d, 0x23dc: 0x000d, 0x23dd: 0x000d, + 0x23de: 0x000d, 0x23df: 0x000d, 0x23e0: 0x000d, 0x23e1: 0x000d, 0x23e2: 0x000d, 0x23e3: 0x000d, + 0x23e4: 0x000d, 0x23e5: 0x000d, 0x23e6: 0x000d, 0x23e7: 0x000d, 0x23e8: 0x000d, 0x23e9: 0x000d, + 0x23ea: 0x000d, 0x23eb: 0x000d, 0x23ec: 0x000d, 0x23ed: 0x000d, 0x23ee: 0x000d, 0x23ef: 0x000d, + 0x23f0: 0x000d, 0x23f1: 0x000d, 0x23f2: 0x000d, 0x23f3: 0x000d, 0x23f4: 0x000d, 0x23f5: 0x000d, + 0x23f6: 0x000d, 0x23f7: 0x000d, 0x23f8: 0x000d, 0x23f9: 0x000d, 0x23fa: 0x000d, 0x23fb: 0x000d, + 0x23fc: 0x000d, 0x23fd: 0x000d, 0x23fe: 0x000d, 0x23ff: 0x000d, + // Block 0x90, offset 0x2400 + 0x2400: 0x000d, 0x2401: 0x000d, 0x2402: 0x000d, 0x2403: 0x000d, 0x2404: 0x000d, 0x2405: 0x000d, + 0x2406: 0x000d, 0x2407: 0x000d, 0x2408: 0x000d, 0x2409: 0x000d, 0x240a: 0x000d, 0x240b: 0x000d, + 0x240c: 0x000d, 0x240d: 0x000d, 0x240e: 0x000d, 0x240f: 0x000d, 0x2410: 0x000d, 0x2411: 0x000d, + 0x2412: 0x000d, 0x2413: 0x000d, 0x2414: 0x000d, 0x2415: 0x000d, 0x2416: 0x000d, 0x2417: 0x000d, + 0x2418: 0x000d, 0x2419: 0x000d, 0x241a: 0x000d, 0x241b: 0x000d, 0x241c: 0x000d, 0x241d: 0x000d, + 0x241e: 0x000d, 0x241f: 0x000d, 0x2420: 0x000d, 0x2421: 0x000d, 0x2422: 0x000d, 0x2423: 0x000d, + 0x2424: 0x000d, 0x2425: 0x000d, 0x2426: 0x000d, 0x2427: 0x000d, 0x2428: 0x000d, 0x2429: 0x000d, + 0x242a: 0x000d, 0x242b: 0x000d, 0x242c: 0x000d, 0x242d: 0x000d, 0x242e: 0x000d, 0x242f: 0x000d, + 0x2430: 0x000d, 0x2431: 0x000d, 0x2432: 0x000d, 0x2433: 0x000d, 0x2434: 0x000d, 0x2435: 0x000d, + 0x2436: 0x000d, 0x2437: 0x000d, 0x2438: 0x000d, 0x2439: 0x000d, 0x243a: 0x000d, 0x243b: 0x000d, + 0x243c: 0x000d, 0x243d: 0x000d, 0x243e: 0x000a, 0x243f: 0x000a, + // Block 0x91, offset 0x2440 + 0x2440: 0x000a, 0x2441: 0x000a, 0x2442: 0x000a, 0x2443: 0x000a, 0x2444: 0x000a, 0x2445: 0x000a, + 0x2446: 0x000a, 0x2447: 0x000a, 0x2448: 0x000a, 0x2449: 0x000a, 0x244a: 0x000a, 0x244b: 0x000a, + 0x244c: 0x000a, 0x244d: 0x000a, 0x244e: 0x000a, 0x244f: 0x000a, 0x2450: 0x000d, 0x2451: 0x000d, + 0x2452: 0x000d, 0x2453: 0x000d, 0x2454: 0x000d, 0x2455: 0x000d, 0x2456: 0x000d, 0x2457: 0x000d, + 0x2458: 0x000d, 0x2459: 0x000d, 0x245a: 0x000d, 0x245b: 0x000d, 0x245c: 0x000d, 0x245d: 0x000d, + 0x245e: 0x000d, 0x245f: 0x000d, 0x2460: 0x000d, 0x2461: 0x000d, 0x2462: 0x000d, 0x2463: 0x000d, + 0x2464: 0x000d, 0x2465: 0x000d, 0x2466: 0x000d, 0x2467: 0x000d, 0x2468: 0x000d, 0x2469: 0x000d, + 0x246a: 0x000d, 0x246b: 0x000d, 0x246c: 0x000d, 0x246d: 0x000d, 0x246e: 0x000d, 0x246f: 0x000d, + 0x2470: 0x000d, 0x2471: 0x000d, 0x2472: 0x000d, 0x2473: 0x000d, 0x2474: 0x000d, 0x2475: 0x000d, + 0x2476: 0x000d, 0x2477: 0x000d, 0x2478: 0x000d, 0x2479: 0x000d, 0x247a: 0x000d, 0x247b: 0x000d, + 0x247c: 0x000d, 0x247d: 0x000d, 0x247e: 0x000d, 0x247f: 0x000d, + // Block 0x92, offset 0x2480 + 0x2480: 0x000d, 0x2481: 0x000d, 0x2482: 0x000d, 0x2483: 0x000d, 0x2484: 0x000d, 0x2485: 0x000d, + 0x2486: 0x000d, 0x2487: 0x000d, 0x2488: 0x000d, 0x2489: 0x000d, 0x248a: 0x000d, 0x248b: 0x000d, + 0x248c: 0x000d, 0x248d: 0x000d, 0x248e: 0x000d, 0x248f: 0x000a, 0x2490: 0x000b, 0x2491: 0x000b, + 0x2492: 0x000b, 0x2493: 0x000b, 0x2494: 0x000b, 0x2495: 0x000b, 0x2496: 0x000b, 0x2497: 0x000b, + 0x2498: 0x000b, 0x2499: 0x000b, 0x249a: 0x000b, 0x249b: 0x000b, 0x249c: 0x000b, 0x249d: 0x000b, + 0x249e: 0x000b, 0x249f: 0x000b, 0x24a0: 0x000b, 0x24a1: 0x000b, 0x24a2: 0x000b, 0x24a3: 0x000b, + 0x24a4: 0x000b, 0x24a5: 0x000b, 0x24a6: 0x000b, 0x24a7: 0x000b, 0x24a8: 0x000b, 0x24a9: 0x000b, + 0x24aa: 0x000b, 0x24ab: 0x000b, 0x24ac: 0x000b, 0x24ad: 0x000b, 0x24ae: 0x000b, 0x24af: 0x000b, + 0x24b0: 0x000d, 0x24b1: 0x000d, 0x24b2: 0x000d, 0x24b3: 0x000d, 0x24b4: 0x000d, 0x24b5: 0x000d, + 0x24b6: 0x000d, 0x24b7: 0x000d, 0x24b8: 0x000d, 0x24b9: 0x000d, 0x24ba: 0x000d, 0x24bb: 0x000d, + 0x24bc: 0x000d, 0x24bd: 0x000a, 0x24be: 0x000a, 0x24bf: 0x000a, + // Block 0x93, offset 0x24c0 + 0x24c0: 0x000c, 0x24c1: 0x000c, 0x24c2: 0x000c, 0x24c3: 0x000c, 0x24c4: 0x000c, 0x24c5: 0x000c, + 0x24c6: 0x000c, 0x24c7: 0x000c, 0x24c8: 0x000c, 0x24c9: 0x000c, 0x24ca: 0x000c, 0x24cb: 0x000c, + 0x24cc: 0x000c, 0x24cd: 0x000c, 0x24ce: 0x000c, 0x24cf: 0x000c, 0x24d0: 0x000a, 0x24d1: 0x000a, + 0x24d2: 0x000a, 0x24d3: 0x000a, 0x24d4: 0x000a, 0x24d5: 0x000a, 0x24d6: 0x000a, 0x24d7: 0x000a, + 0x24d8: 0x000a, 0x24d9: 0x000a, + 0x24e0: 0x000c, 0x24e1: 0x000c, 0x24e2: 0x000c, 0x24e3: 0x000c, + 0x24e4: 0x000c, 0x24e5: 0x000c, 0x24e6: 0x000c, 0x24e7: 0x000c, 0x24e8: 0x000c, 0x24e9: 0x000c, + 0x24ea: 0x000c, 0x24eb: 0x000c, 0x24ec: 0x000c, 0x24ed: 0x000c, 0x24ee: 0x000c, 0x24ef: 0x000c, + 0x24f0: 0x000a, 0x24f1: 0x000a, 0x24f2: 0x000a, 0x24f3: 0x000a, 0x24f4: 0x000a, 0x24f5: 0x000a, + 0x24f6: 0x000a, 0x24f7: 0x000a, 0x24f8: 0x000a, 0x24f9: 0x000a, 0x24fa: 0x000a, 0x24fb: 0x000a, + 0x24fc: 0x000a, 0x24fd: 0x000a, 0x24fe: 0x000a, 0x24ff: 0x000a, + // Block 0x94, offset 0x2500 + 0x2500: 0x000a, 0x2501: 0x000a, 0x2502: 0x000a, 0x2503: 0x000a, 0x2504: 0x000a, 0x2505: 0x000a, + 0x2506: 0x000a, 0x2507: 0x000a, 0x2508: 0x000a, 0x2509: 0x000a, 0x250a: 0x000a, 0x250b: 0x000a, + 0x250c: 0x000a, 0x250d: 0x000a, 0x250e: 0x000a, 0x250f: 0x000a, 0x2510: 0x0006, 0x2511: 0x000a, + 0x2512: 0x0006, 0x2514: 0x000a, 0x2515: 0x0006, 0x2516: 0x000a, 0x2517: 0x000a, + 0x2518: 0x000a, 0x2519: 0x009a, 0x251a: 0x008a, 0x251b: 0x007a, 0x251c: 0x006a, 0x251d: 0x009a, + 0x251e: 0x008a, 0x251f: 0x0004, 0x2520: 0x000a, 0x2521: 0x000a, 0x2522: 0x0003, 0x2523: 0x0003, + 0x2524: 0x000a, 0x2525: 0x000a, 0x2526: 0x000a, 0x2528: 0x000a, 0x2529: 0x0004, + 0x252a: 0x0004, 0x252b: 0x000a, + 0x2530: 0x000d, 0x2531: 0x000d, 0x2532: 0x000d, 0x2533: 0x000d, 0x2534: 0x000d, 0x2535: 0x000d, + 0x2536: 0x000d, 0x2537: 0x000d, 0x2538: 0x000d, 0x2539: 0x000d, 0x253a: 0x000d, 0x253b: 0x000d, + 0x253c: 0x000d, 0x253d: 0x000d, 0x253e: 0x000d, 0x253f: 0x000d, + // Block 0x95, offset 0x2540 + 0x2540: 0x000d, 0x2541: 0x000d, 0x2542: 0x000d, 0x2543: 0x000d, 0x2544: 0x000d, 0x2545: 0x000d, + 0x2546: 0x000d, 0x2547: 0x000d, 0x2548: 0x000d, 0x2549: 0x000d, 0x254a: 0x000d, 0x254b: 0x000d, + 0x254c: 0x000d, 0x254d: 0x000d, 0x254e: 0x000d, 0x254f: 0x000d, 0x2550: 0x000d, 0x2551: 0x000d, + 0x2552: 0x000d, 0x2553: 0x000d, 0x2554: 0x000d, 0x2555: 0x000d, 0x2556: 0x000d, 0x2557: 0x000d, + 0x2558: 0x000d, 0x2559: 0x000d, 0x255a: 0x000d, 0x255b: 0x000d, 0x255c: 0x000d, 0x255d: 0x000d, + 0x255e: 0x000d, 0x255f: 0x000d, 0x2560: 0x000d, 0x2561: 0x000d, 0x2562: 0x000d, 0x2563: 0x000d, + 0x2564: 0x000d, 0x2565: 0x000d, 0x2566: 0x000d, 0x2567: 0x000d, 0x2568: 0x000d, 0x2569: 0x000d, + 0x256a: 0x000d, 0x256b: 0x000d, 0x256c: 0x000d, 0x256d: 0x000d, 0x256e: 0x000d, 0x256f: 0x000d, + 0x2570: 0x000d, 0x2571: 0x000d, 0x2572: 0x000d, 0x2573: 0x000d, 0x2574: 0x000d, 0x2575: 0x000d, + 0x2576: 0x000d, 0x2577: 0x000d, 0x2578: 0x000d, 0x2579: 0x000d, 0x257a: 0x000d, 0x257b: 0x000d, + 0x257c: 0x000d, 0x257d: 0x000d, 0x257e: 0x000d, 0x257f: 0x000b, + // Block 0x96, offset 0x2580 + 0x2581: 0x000a, 0x2582: 0x000a, 0x2583: 0x0004, 0x2584: 0x0004, 0x2585: 0x0004, + 0x2586: 0x000a, 0x2587: 0x000a, 0x2588: 0x003a, 0x2589: 0x002a, 0x258a: 0x000a, 0x258b: 0x0003, + 0x258c: 0x0006, 0x258d: 0x0003, 0x258e: 0x0006, 0x258f: 0x0006, 0x2590: 0x0002, 0x2591: 0x0002, + 0x2592: 0x0002, 0x2593: 0x0002, 0x2594: 0x0002, 0x2595: 0x0002, 0x2596: 0x0002, 0x2597: 0x0002, + 0x2598: 0x0002, 0x2599: 0x0002, 0x259a: 0x0006, 0x259b: 0x000a, 0x259c: 0x000a, 0x259d: 0x000a, + 0x259e: 0x000a, 0x259f: 0x000a, 0x25a0: 0x000a, + 0x25bb: 0x005a, + 0x25bc: 0x000a, 0x25bd: 0x004a, 0x25be: 0x000a, 0x25bf: 0x000a, + // Block 0x97, offset 0x25c0 + 0x25c0: 0x000a, + 0x25db: 0x005a, 0x25dc: 0x000a, 0x25dd: 0x004a, + 0x25de: 0x000a, 0x25df: 0x00fa, 0x25e0: 0x00ea, 0x25e1: 0x000a, 0x25e2: 0x003a, 0x25e3: 0x002a, + 0x25e4: 0x000a, 0x25e5: 0x000a, + // Block 0x98, offset 0x2600 + 0x2620: 0x0004, 0x2621: 0x0004, 0x2622: 0x000a, 0x2623: 0x000a, + 0x2624: 0x000a, 0x2625: 0x0004, 0x2626: 0x0004, 0x2628: 0x000a, 0x2629: 0x000a, + 0x262a: 0x000a, 0x262b: 0x000a, 0x262c: 0x000a, 0x262d: 0x000a, 0x262e: 0x000a, + 0x2630: 0x000b, 0x2631: 0x000b, 0x2632: 0x000b, 0x2633: 0x000b, 0x2634: 0x000b, 0x2635: 0x000b, + 0x2636: 0x000b, 0x2637: 0x000b, 0x2638: 0x000b, 0x2639: 0x000a, 0x263a: 0x000a, 0x263b: 0x000a, + 0x263c: 0x000a, 0x263d: 0x000a, 0x263e: 0x000b, 0x263f: 0x000b, + // Block 0x99, offset 0x2640 + 0x2641: 0x000a, + // Block 0x9a, offset 0x2680 + 0x2680: 0x000a, 0x2681: 0x000a, 0x2682: 0x000a, 0x2683: 0x000a, 0x2684: 0x000a, 0x2685: 0x000a, + 0x2686: 0x000a, 0x2687: 0x000a, 0x2688: 0x000a, 0x2689: 0x000a, 0x268a: 0x000a, 0x268b: 0x000a, + 0x268c: 0x000a, 0x2690: 0x000a, 0x2691: 0x000a, + 0x2692: 0x000a, 0x2693: 0x000a, 0x2694: 0x000a, 0x2695: 0x000a, 0x2696: 0x000a, 0x2697: 0x000a, + 0x2698: 0x000a, 0x2699: 0x000a, 0x269a: 0x000a, 0x269b: 0x000a, 0x269c: 0x000a, + 0x26a0: 0x000a, + // Block 0x9b, offset 0x26c0 + 0x26fd: 0x000c, + // Block 0x9c, offset 0x2700 + 0x2720: 0x000c, 0x2721: 0x0002, 0x2722: 0x0002, 0x2723: 0x0002, + 0x2724: 0x0002, 0x2725: 0x0002, 0x2726: 0x0002, 0x2727: 0x0002, 0x2728: 0x0002, 0x2729: 0x0002, + 0x272a: 0x0002, 0x272b: 0x0002, 0x272c: 0x0002, 0x272d: 0x0002, 0x272e: 0x0002, 0x272f: 0x0002, + 0x2730: 0x0002, 0x2731: 0x0002, 0x2732: 0x0002, 0x2733: 0x0002, 0x2734: 0x0002, 0x2735: 0x0002, + 0x2736: 0x0002, 0x2737: 0x0002, 0x2738: 0x0002, 0x2739: 0x0002, 0x273a: 0x0002, 0x273b: 0x0002, + // Block 0x9d, offset 0x2740 + 0x2776: 0x000c, 0x2777: 0x000c, 0x2778: 0x000c, 0x2779: 0x000c, 0x277a: 0x000c, + // Block 0x9e, offset 0x2780 + 0x2780: 0x0001, 0x2781: 0x0001, 0x2782: 0x0001, 0x2783: 0x0001, 0x2784: 0x0001, 0x2785: 0x0001, + 0x2786: 0x0001, 0x2787: 0x0001, 0x2788: 0x0001, 0x2789: 0x0001, 0x278a: 0x0001, 0x278b: 0x0001, + 0x278c: 0x0001, 0x278d: 0x0001, 0x278e: 0x0001, 0x278f: 0x0001, 0x2790: 0x0001, 0x2791: 0x0001, + 0x2792: 0x0001, 0x2793: 0x0001, 0x2794: 0x0001, 0x2795: 0x0001, 0x2796: 0x0001, 0x2797: 0x0001, + 0x2798: 0x0001, 0x2799: 0x0001, 0x279a: 0x0001, 0x279b: 0x0001, 0x279c: 0x0001, 0x279d: 0x0001, + 0x279e: 0x0001, 0x279f: 0x0001, 0x27a0: 0x0001, 0x27a1: 0x0001, 0x27a2: 0x0001, 0x27a3: 0x0001, + 0x27a4: 0x0001, 0x27a5: 0x0001, 0x27a6: 0x0001, 0x27a7: 0x0001, 0x27a8: 0x0001, 0x27a9: 0x0001, + 0x27aa: 0x0001, 0x27ab: 0x0001, 0x27ac: 0x0001, 0x27ad: 0x0001, 0x27ae: 0x0001, 0x27af: 0x0001, + 0x27b0: 0x0001, 0x27b1: 0x0001, 0x27b2: 0x0001, 0x27b3: 0x0001, 0x27b4: 0x0001, 0x27b5: 0x0001, + 0x27b6: 0x0001, 0x27b7: 0x0001, 0x27b8: 0x0001, 0x27b9: 0x0001, 0x27ba: 0x0001, 0x27bb: 0x0001, + 0x27bc: 0x0001, 0x27bd: 0x0001, 0x27be: 0x0001, 0x27bf: 0x0001, + // Block 0x9f, offset 0x27c0 + 0x27c0: 0x0001, 0x27c1: 0x0001, 0x27c2: 0x0001, 0x27c3: 0x0001, 0x27c4: 0x0001, 0x27c5: 0x0001, + 0x27c6: 0x0001, 0x27c7: 0x0001, 0x27c8: 0x0001, 0x27c9: 0x0001, 0x27ca: 0x0001, 0x27cb: 0x0001, + 0x27cc: 0x0001, 0x27cd: 0x0001, 0x27ce: 0x0001, 0x27cf: 0x0001, 0x27d0: 0x0001, 0x27d1: 0x0001, + 0x27d2: 0x0001, 0x27d3: 0x0001, 0x27d4: 0x0001, 0x27d5: 0x0001, 0x27d6: 0x0001, 0x27d7: 0x0001, + 0x27d8: 0x0001, 0x27d9: 0x0001, 0x27da: 0x0001, 0x27db: 0x0001, 0x27dc: 0x0001, 0x27dd: 0x0001, + 0x27de: 0x0001, 0x27df: 0x000a, 0x27e0: 0x0001, 0x27e1: 0x0001, 0x27e2: 0x0001, 0x27e3: 0x0001, + 0x27e4: 0x0001, 0x27e5: 0x0001, 0x27e6: 0x0001, 0x27e7: 0x0001, 0x27e8: 0x0001, 0x27e9: 0x0001, + 0x27ea: 0x0001, 0x27eb: 0x0001, 0x27ec: 0x0001, 0x27ed: 0x0001, 0x27ee: 0x0001, 0x27ef: 0x0001, + 0x27f0: 0x0001, 0x27f1: 0x0001, 0x27f2: 0x0001, 0x27f3: 0x0001, 0x27f4: 0x0001, 0x27f5: 0x0001, + 0x27f6: 0x0001, 0x27f7: 0x0001, 0x27f8: 0x0001, 0x27f9: 0x0001, 0x27fa: 0x0001, 0x27fb: 0x0001, + 0x27fc: 0x0001, 0x27fd: 0x0001, 0x27fe: 0x0001, 0x27ff: 0x0001, + // Block 0xa0, offset 0x2800 + 0x2800: 0x0001, 0x2801: 0x000c, 0x2802: 0x000c, 0x2803: 0x000c, 0x2804: 0x0001, 0x2805: 0x000c, + 0x2806: 0x000c, 0x2807: 0x0001, 0x2808: 0x0001, 0x2809: 0x0001, 0x280a: 0x0001, 0x280b: 0x0001, + 0x280c: 0x000c, 0x280d: 0x000c, 0x280e: 0x000c, 0x280f: 0x000c, 0x2810: 0x0001, 0x2811: 0x0001, + 0x2812: 0x0001, 0x2813: 0x0001, 0x2814: 0x0001, 0x2815: 0x0001, 0x2816: 0x0001, 0x2817: 0x0001, + 0x2818: 0x0001, 0x2819: 0x0001, 0x281a: 0x0001, 0x281b: 0x0001, 0x281c: 0x0001, 0x281d: 0x0001, + 0x281e: 0x0001, 0x281f: 0x0001, 0x2820: 0x0001, 0x2821: 0x0001, 0x2822: 0x0001, 0x2823: 0x0001, + 0x2824: 0x0001, 0x2825: 0x0001, 0x2826: 0x0001, 0x2827: 0x0001, 0x2828: 0x0001, 0x2829: 0x0001, + 0x282a: 0x0001, 0x282b: 0x0001, 0x282c: 0x0001, 0x282d: 0x0001, 0x282e: 0x0001, 0x282f: 0x0001, + 0x2830: 0x0001, 0x2831: 0x0001, 0x2832: 0x0001, 0x2833: 0x0001, 0x2834: 0x0001, 0x2835: 0x0001, + 0x2836: 0x0001, 0x2837: 0x0001, 0x2838: 0x000c, 0x2839: 0x000c, 0x283a: 0x000c, 0x283b: 0x0001, + 0x283c: 0x0001, 0x283d: 0x0001, 0x283e: 0x0001, 0x283f: 0x000c, + // Block 0xa1, offset 0x2840 + 0x2840: 0x0001, 0x2841: 0x0001, 0x2842: 0x0001, 0x2843: 0x0001, 0x2844: 0x0001, 0x2845: 0x0001, + 0x2846: 0x0001, 0x2847: 0x0001, 0x2848: 0x0001, 0x2849: 0x0001, 0x284a: 0x0001, 0x284b: 0x0001, + 0x284c: 0x0001, 0x284d: 0x0001, 0x284e: 0x0001, 0x284f: 0x0001, 0x2850: 0x0001, 0x2851: 0x0001, + 0x2852: 0x0001, 0x2853: 0x0001, 0x2854: 0x0001, 0x2855: 0x0001, 0x2856: 0x0001, 0x2857: 0x0001, + 0x2858: 0x0001, 0x2859: 0x0001, 0x285a: 0x0001, 0x285b: 0x0001, 0x285c: 0x0001, 0x285d: 0x0001, + 0x285e: 0x0001, 0x285f: 0x0001, 0x2860: 0x0001, 0x2861: 0x0001, 0x2862: 0x0001, 0x2863: 0x0001, + 0x2864: 0x0001, 0x2865: 0x000c, 0x2866: 0x000c, 0x2867: 0x0001, 0x2868: 0x0001, 0x2869: 0x0001, + 0x286a: 0x0001, 0x286b: 0x0001, 0x286c: 0x0001, 0x286d: 0x0001, 0x286e: 0x0001, 0x286f: 0x0001, + 0x2870: 0x0001, 0x2871: 0x0001, 0x2872: 0x0001, 0x2873: 0x0001, 0x2874: 0x0001, 0x2875: 0x0001, + 0x2876: 0x0001, 0x2877: 0x0001, 0x2878: 0x0001, 0x2879: 0x0001, 0x287a: 0x0001, 0x287b: 0x0001, + 0x287c: 0x0001, 0x287d: 0x0001, 0x287e: 0x0001, 0x287f: 0x0001, + // Block 0xa2, offset 0x2880 + 0x2880: 0x0001, 0x2881: 0x0001, 0x2882: 0x0001, 0x2883: 0x0001, 0x2884: 0x0001, 0x2885: 0x0001, + 0x2886: 0x0001, 0x2887: 0x0001, 0x2888: 0x0001, 0x2889: 0x0001, 0x288a: 0x0001, 0x288b: 0x0001, + 0x288c: 0x0001, 0x288d: 0x0001, 0x288e: 0x0001, 0x288f: 0x0001, 0x2890: 0x0001, 0x2891: 0x0001, + 0x2892: 0x0001, 0x2893: 0x0001, 0x2894: 0x0001, 0x2895: 0x0001, 0x2896: 0x0001, 0x2897: 0x0001, + 0x2898: 0x0001, 0x2899: 0x0001, 0x289a: 0x0001, 0x289b: 0x0001, 0x289c: 0x0001, 0x289d: 0x0001, + 0x289e: 0x0001, 0x289f: 0x0001, 0x28a0: 0x0001, 0x28a1: 0x0001, 0x28a2: 0x0001, 0x28a3: 0x0001, + 0x28a4: 0x0001, 0x28a5: 0x0001, 0x28a6: 0x0001, 0x28a7: 0x0001, 0x28a8: 0x0001, 0x28a9: 0x0001, + 0x28aa: 0x0001, 0x28ab: 0x0001, 0x28ac: 0x0001, 0x28ad: 0x0001, 0x28ae: 0x0001, 0x28af: 0x0001, + 0x28b0: 0x0001, 0x28b1: 0x0001, 0x28b2: 0x0001, 0x28b3: 0x0001, 0x28b4: 0x0001, 0x28b5: 0x0001, + 0x28b6: 0x0001, 0x28b7: 0x0001, 0x28b8: 0x0001, 0x28b9: 0x000a, 0x28ba: 0x000a, 0x28bb: 0x000a, + 0x28bc: 0x000a, 0x28bd: 0x000a, 0x28be: 0x000a, 0x28bf: 0x000a, + // Block 0xa3, offset 0x28c0 + 0x28c0: 0x000d, 0x28c1: 0x000d, 0x28c2: 0x000d, 0x28c3: 0x000d, 0x28c4: 0x000d, 0x28c5: 0x000d, + 0x28c6: 0x000d, 0x28c7: 0x000d, 0x28c8: 0x000d, 0x28c9: 0x000d, 0x28ca: 0x000d, 0x28cb: 0x000d, + 0x28cc: 0x000d, 0x28cd: 0x000d, 0x28ce: 0x000d, 0x28cf: 0x000d, 0x28d0: 0x000d, 0x28d1: 0x000d, + 0x28d2: 0x000d, 0x28d3: 0x000d, 0x28d4: 0x000d, 0x28d5: 0x000d, 0x28d6: 0x000d, 0x28d7: 0x000d, + 0x28d8: 0x000d, 0x28d9: 0x000d, 0x28da: 0x000d, 0x28db: 0x000d, 0x28dc: 0x000d, 0x28dd: 0x000d, + 0x28de: 0x000d, 0x28df: 0x000d, 0x28e0: 0x000d, 0x28e1: 0x000d, 0x28e2: 0x000d, 0x28e3: 0x000d, + 0x28e4: 0x000c, 0x28e5: 0x000c, 0x28e6: 0x000c, 0x28e7: 0x000c, 0x28e8: 0x0001, 0x28e9: 0x0001, + 0x28ea: 0x0001, 0x28eb: 0x0001, 0x28ec: 0x0001, 0x28ed: 0x0001, 0x28ee: 0x0001, 0x28ef: 0x0001, + 0x28f0: 0x0005, 0x28f1: 0x0005, 0x28f2: 0x0005, 0x28f3: 0x0005, 0x28f4: 0x0005, 0x28f5: 0x0005, + 0x28f6: 0x0005, 0x28f7: 0x0005, 0x28f8: 0x0005, 0x28f9: 0x0005, 0x28fa: 0x0001, 0x28fb: 0x0001, + 0x28fc: 0x0001, 0x28fd: 0x0001, 0x28fe: 0x0001, 0x28ff: 0x0001, + // Block 0xa4, offset 0x2900 + 0x2900: 0x0001, 0x2901: 0x0001, 0x2902: 0x0001, 0x2903: 0x0001, 0x2904: 0x0001, 0x2905: 0x0001, + 0x2906: 0x0001, 0x2907: 0x0001, 0x2908: 0x0001, 0x2909: 0x0001, 0x290a: 0x0001, 0x290b: 0x0001, + 0x290c: 0x0001, 0x290d: 0x0001, 0x290e: 0x0001, 0x290f: 0x0001, 0x2910: 0x0001, 0x2911: 0x0001, + 0x2912: 0x0001, 0x2913: 0x0001, 0x2914: 0x0001, 0x2915: 0x0001, 0x2916: 0x0001, 0x2917: 0x0001, + 0x2918: 0x0001, 0x2919: 0x0001, 0x291a: 0x0001, 0x291b: 0x0001, 0x291c: 0x0001, 0x291d: 0x0001, + 0x291e: 0x0001, 0x291f: 0x0001, 0x2920: 0x0005, 0x2921: 0x0005, 0x2922: 0x0005, 0x2923: 0x0005, + 0x2924: 0x0005, 0x2925: 0x0005, 0x2926: 0x0005, 0x2927: 0x0005, 0x2928: 0x0005, 0x2929: 0x0005, + 0x292a: 0x0005, 0x292b: 0x0005, 0x292c: 0x0005, 0x292d: 0x0005, 0x292e: 0x0005, 0x292f: 0x0005, + 0x2930: 0x0005, 0x2931: 0x0005, 0x2932: 0x0005, 0x2933: 0x0005, 0x2934: 0x0005, 0x2935: 0x0005, + 0x2936: 0x0005, 0x2937: 0x0005, 0x2938: 0x0005, 0x2939: 0x0005, 0x293a: 0x0005, 0x293b: 0x0005, + 0x293c: 0x0005, 0x293d: 0x0005, 0x293e: 0x0005, 0x293f: 0x0001, + // Block 0xa5, offset 0x2940 + 0x2940: 0x0001, 0x2941: 0x0001, 0x2942: 0x0001, 0x2943: 0x0001, 0x2944: 0x0001, 0x2945: 0x0001, + 0x2946: 0x0001, 0x2947: 0x0001, 0x2948: 0x0001, 0x2949: 0x0001, 0x294a: 0x0001, 0x294b: 0x0001, + 0x294c: 0x0001, 0x294d: 0x0001, 0x294e: 0x0001, 0x294f: 0x0001, 0x2950: 0x0001, 0x2951: 0x0001, + 0x2952: 0x0001, 0x2953: 0x0001, 0x2954: 0x0001, 0x2955: 0x0001, 0x2956: 0x0001, 0x2957: 0x0001, + 0x2958: 0x0001, 0x2959: 0x0001, 0x295a: 0x0001, 0x295b: 0x0001, 0x295c: 0x0001, 0x295d: 0x0001, + 0x295e: 0x0001, 0x295f: 0x0001, 0x2960: 0x0001, 0x2961: 0x0001, 0x2962: 0x0001, 0x2963: 0x0001, + 0x2964: 0x0001, 0x2965: 0x0001, 0x2966: 0x0001, 0x2967: 0x0001, 0x2968: 0x0001, 0x2969: 0x0001, + 0x296a: 0x0001, 0x296b: 0x000c, 0x296c: 0x000c, 0x296d: 0x0001, 0x296e: 0x0001, 0x296f: 0x0001, + 0x2970: 0x0001, 0x2971: 0x0001, 0x2972: 0x0001, 0x2973: 0x0001, 0x2974: 0x0001, 0x2975: 0x0001, + 0x2976: 0x0001, 0x2977: 0x0001, 0x2978: 0x0001, 0x2979: 0x0001, 0x297a: 0x0001, 0x297b: 0x0001, + 0x297c: 0x0001, 0x297d: 0x0001, 0x297e: 0x0001, 0x297f: 0x0001, + // Block 0xa6, offset 0x2980 + 0x2980: 0x0001, 0x2981: 0x0001, 0x2982: 0x0001, 0x2983: 0x0001, 0x2984: 0x0001, 0x2985: 0x0001, + 0x2986: 0x0001, 0x2987: 0x0001, 0x2988: 0x0001, 0x2989: 0x0001, 0x298a: 0x0001, 0x298b: 0x0001, + 0x298c: 0x0001, 0x298d: 0x0001, 0x298e: 0x0001, 0x298f: 0x0001, 0x2990: 0x0001, 0x2991: 0x0001, + 0x2992: 0x0001, 0x2993: 0x0001, 0x2994: 0x0001, 0x2995: 0x0001, 0x2996: 0x0001, 0x2997: 0x0001, + 0x2998: 0x0001, 0x2999: 0x0001, 0x299a: 0x0001, 0x299b: 0x0001, 0x299c: 0x0001, 0x299d: 0x0001, + 0x299e: 0x0001, 0x299f: 0x0001, 0x29a0: 0x0001, 0x29a1: 0x0001, 0x29a2: 0x0001, 0x29a3: 0x0001, + 0x29a4: 0x0001, 0x29a5: 0x0001, 0x29a6: 0x0001, 0x29a7: 0x0001, 0x29a8: 0x0001, 0x29a9: 0x0001, + 0x29aa: 0x0001, 0x29ab: 0x0001, 0x29ac: 0x0001, 0x29ad: 0x0001, 0x29ae: 0x0001, 0x29af: 0x0001, + 0x29b0: 0x0001, 0x29b1: 0x0001, 0x29b2: 0x0001, 0x29b3: 0x0001, 0x29b4: 0x0001, 0x29b5: 0x0001, + 0x29b6: 0x0001, 0x29b7: 0x0001, 0x29b8: 0x0001, 0x29b9: 0x0001, 0x29ba: 0x0001, 0x29bb: 0x0001, + 0x29bc: 0x0001, 0x29bd: 0x000c, 0x29be: 0x000c, 0x29bf: 0x000c, + // Block 0xa7, offset 0x29c0 + 0x29c0: 0x0001, 0x29c1: 0x0001, 0x29c2: 0x0001, 0x29c3: 0x0001, 0x29c4: 0x0001, 0x29c5: 0x0001, + 0x29c6: 0x0001, 0x29c7: 0x0001, 0x29c8: 0x0001, 0x29c9: 0x0001, 0x29ca: 0x0001, 0x29cb: 0x0001, + 0x29cc: 0x0001, 0x29cd: 0x0001, 0x29ce: 0x0001, 0x29cf: 0x0001, 0x29d0: 0x0001, 0x29d1: 0x0001, + 0x29d2: 0x0001, 0x29d3: 0x0001, 0x29d4: 0x0001, 0x29d5: 0x0001, 0x29d6: 0x0001, 0x29d7: 0x0001, + 0x29d8: 0x0001, 0x29d9: 0x0001, 0x29da: 0x0001, 0x29db: 0x0001, 0x29dc: 0x0001, 0x29dd: 0x0001, + 0x29de: 0x0001, 0x29df: 0x0001, 0x29e0: 0x0001, 0x29e1: 0x0001, 0x29e2: 0x0001, 0x29e3: 0x0001, + 0x29e4: 0x0001, 0x29e5: 0x0001, 0x29e6: 0x0001, 0x29e7: 0x0001, 0x29e8: 0x0001, 0x29e9: 0x0001, + 0x29ea: 0x0001, 0x29eb: 0x0001, 0x29ec: 0x0001, 0x29ed: 0x0001, 0x29ee: 0x0001, 0x29ef: 0x0001, + 0x29f0: 0x000d, 0x29f1: 0x000d, 0x29f2: 0x000d, 0x29f3: 0x000d, 0x29f4: 0x000d, 0x29f5: 0x000d, + 0x29f6: 0x000d, 0x29f7: 0x000d, 0x29f8: 0x000d, 0x29f9: 0x000d, 0x29fa: 0x000d, 0x29fb: 0x000d, + 0x29fc: 0x000d, 0x29fd: 0x000d, 0x29fe: 0x000d, 0x29ff: 0x000d, + // Block 0xa8, offset 0x2a00 + 0x2a00: 0x000d, 0x2a01: 0x000d, 0x2a02: 0x000d, 0x2a03: 0x000d, 0x2a04: 0x000d, 0x2a05: 0x000d, + 0x2a06: 0x000c, 0x2a07: 0x000c, 0x2a08: 0x000c, 0x2a09: 0x000c, 0x2a0a: 0x000c, 0x2a0b: 0x000c, + 0x2a0c: 0x000c, 0x2a0d: 0x000c, 0x2a0e: 0x000c, 0x2a0f: 0x000c, 0x2a10: 0x000c, 0x2a11: 0x000d, + 0x2a12: 0x000d, 0x2a13: 0x000d, 0x2a14: 0x000d, 0x2a15: 0x000d, 0x2a16: 0x000d, 0x2a17: 0x000d, + 0x2a18: 0x000d, 0x2a19: 0x000d, 0x2a1a: 0x0001, 0x2a1b: 0x0001, 0x2a1c: 0x0001, 0x2a1d: 0x0001, + 0x2a1e: 0x0001, 0x2a1f: 0x0001, 0x2a20: 0x0001, 0x2a21: 0x0001, 0x2a22: 0x0001, 0x2a23: 0x0001, + 0x2a24: 0x0001, 0x2a25: 0x0001, 0x2a26: 0x0001, 0x2a27: 0x0001, 0x2a28: 0x0001, 0x2a29: 0x0001, + 0x2a2a: 0x0001, 0x2a2b: 0x0001, 0x2a2c: 0x0001, 0x2a2d: 0x0001, 0x2a2e: 0x0001, 0x2a2f: 0x0001, + 0x2a30: 0x0001, 0x2a31: 0x0001, 0x2a32: 0x0001, 0x2a33: 0x0001, 0x2a34: 0x0001, 0x2a35: 0x0001, + 0x2a36: 0x0001, 0x2a37: 0x0001, 0x2a38: 0x0001, 0x2a39: 0x0001, 0x2a3a: 0x0001, 0x2a3b: 0x0001, + 0x2a3c: 0x0001, 0x2a3d: 0x0001, 0x2a3e: 0x0001, 0x2a3f: 0x0001, + // Block 0xa9, offset 0x2a40 + 0x2a40: 0x0001, 0x2a41: 0x0001, 0x2a42: 0x000c, 0x2a43: 0x000c, 0x2a44: 0x000c, 0x2a45: 0x000c, + 0x2a46: 0x0001, 0x2a47: 0x0001, 0x2a48: 0x0001, 0x2a49: 0x0001, 0x2a4a: 0x0001, 0x2a4b: 0x0001, + 0x2a4c: 0x0001, 0x2a4d: 0x0001, 0x2a4e: 0x0001, 0x2a4f: 0x0001, 0x2a50: 0x0001, 0x2a51: 0x0001, + 0x2a52: 0x0001, 0x2a53: 0x0001, 0x2a54: 0x0001, 0x2a55: 0x0001, 0x2a56: 0x0001, 0x2a57: 0x0001, + 0x2a58: 0x0001, 0x2a59: 0x0001, 0x2a5a: 0x0001, 0x2a5b: 0x0001, 0x2a5c: 0x0001, 0x2a5d: 0x0001, + 0x2a5e: 0x0001, 0x2a5f: 0x0001, 0x2a60: 0x0001, 0x2a61: 0x0001, 0x2a62: 0x0001, 0x2a63: 0x0001, + 0x2a64: 0x0001, 0x2a65: 0x0001, 0x2a66: 0x0001, 0x2a67: 0x0001, 0x2a68: 0x0001, 0x2a69: 0x0001, + 0x2a6a: 0x0001, 0x2a6b: 0x0001, 0x2a6c: 0x0001, 0x2a6d: 0x0001, 0x2a6e: 0x0001, 0x2a6f: 0x0001, + 0x2a70: 0x0001, 0x2a71: 0x0001, 0x2a72: 0x0001, 0x2a73: 0x0001, 0x2a74: 0x0001, 0x2a75: 0x0001, + 0x2a76: 0x0001, 0x2a77: 0x0001, 0x2a78: 0x0001, 0x2a79: 0x0001, 0x2a7a: 0x0001, 0x2a7b: 0x0001, + 0x2a7c: 0x0001, 0x2a7d: 0x0001, 0x2a7e: 0x0001, 0x2a7f: 0x0001, + // Block 0xaa, offset 0x2a80 + 0x2a81: 0x000c, + 0x2ab8: 0x000c, 0x2ab9: 0x000c, 0x2aba: 0x000c, 0x2abb: 0x000c, + 0x2abc: 0x000c, 0x2abd: 0x000c, 0x2abe: 0x000c, 0x2abf: 0x000c, + // Block 0xab, offset 0x2ac0 + 0x2ac0: 0x000c, 0x2ac1: 0x000c, 0x2ac2: 0x000c, 0x2ac3: 0x000c, 0x2ac4: 0x000c, 0x2ac5: 0x000c, + 0x2ac6: 0x000c, + 0x2ad2: 0x000a, 0x2ad3: 0x000a, 0x2ad4: 0x000a, 0x2ad5: 0x000a, 0x2ad6: 0x000a, 0x2ad7: 0x000a, + 0x2ad8: 0x000a, 0x2ad9: 0x000a, 0x2ada: 0x000a, 0x2adb: 0x000a, 0x2adc: 0x000a, 0x2add: 0x000a, + 0x2ade: 0x000a, 0x2adf: 0x000a, 0x2ae0: 0x000a, 0x2ae1: 0x000a, 0x2ae2: 0x000a, 0x2ae3: 0x000a, + 0x2ae4: 0x000a, 0x2ae5: 0x000a, + 0x2af0: 0x000c, 0x2af3: 0x000c, 0x2af4: 0x000c, + 0x2aff: 0x000c, + // Block 0xac, offset 0x2b00 + 0x2b00: 0x000c, 0x2b01: 0x000c, + 0x2b33: 0x000c, 0x2b34: 0x000c, 0x2b35: 0x000c, + 0x2b36: 0x000c, 0x2b39: 0x000c, 0x2b3a: 0x000c, + // Block 0xad, offset 0x2b40 + 0x2b40: 0x000c, 0x2b41: 0x000c, 0x2b42: 0x000c, + 0x2b67: 0x000c, 0x2b68: 0x000c, 0x2b69: 0x000c, + 0x2b6a: 0x000c, 0x2b6b: 0x000c, 0x2b6d: 0x000c, 0x2b6e: 0x000c, 0x2b6f: 0x000c, + 0x2b70: 0x000c, 0x2b71: 0x000c, 0x2b72: 0x000c, 0x2b73: 0x000c, 0x2b74: 0x000c, + // Block 0xae, offset 0x2b80 + 0x2bb3: 0x000c, + // Block 0xaf, offset 0x2bc0 + 0x2bc0: 0x000c, 0x2bc1: 0x000c, + 0x2bf6: 0x000c, 0x2bf7: 0x000c, 0x2bf8: 0x000c, 0x2bf9: 0x000c, 0x2bfa: 0x000c, 0x2bfb: 0x000c, + 0x2bfc: 0x000c, 0x2bfd: 0x000c, 0x2bfe: 0x000c, + // Block 0xb0, offset 0x2c00 + 0x2c09: 0x000c, 0x2c0a: 0x000c, 0x2c0b: 0x000c, + 0x2c0c: 0x000c, 0x2c0f: 0x000c, + // Block 0xb1, offset 0x2c40 + 0x2c6f: 0x000c, + 0x2c70: 0x000c, 0x2c71: 0x000c, 0x2c74: 0x000c, + 0x2c76: 0x000c, 0x2c77: 0x000c, + 0x2c7e: 0x000c, + // Block 0xb2, offset 0x2c80 + 0x2c9f: 0x000c, 0x2ca3: 0x000c, + 0x2ca4: 0x000c, 0x2ca5: 0x000c, 0x2ca6: 0x000c, 0x2ca7: 0x000c, 0x2ca8: 0x000c, 0x2ca9: 0x000c, + 0x2caa: 0x000c, + // Block 0xb3, offset 0x2cc0 + 0x2cc0: 0x000c, + 0x2ce6: 0x000c, 0x2ce7: 0x000c, 0x2ce8: 0x000c, 0x2ce9: 0x000c, + 0x2cea: 0x000c, 0x2ceb: 0x000c, 0x2cec: 0x000c, + 0x2cf0: 0x000c, 0x2cf1: 0x000c, 0x2cf2: 0x000c, 0x2cf3: 0x000c, 0x2cf4: 0x000c, + // Block 0xb4, offset 0x2d00 + 0x2d38: 0x000c, 0x2d39: 0x000c, 0x2d3a: 0x000c, 0x2d3b: 0x000c, + 0x2d3c: 0x000c, 0x2d3d: 0x000c, 0x2d3e: 0x000c, 0x2d3f: 0x000c, + // Block 0xb5, offset 0x2d40 + 0x2d42: 0x000c, 0x2d43: 0x000c, 0x2d44: 0x000c, + 0x2d46: 0x000c, + 0x2d5e: 0x000c, + // Block 0xb6, offset 0x2d80 + 0x2db3: 0x000c, 0x2db4: 0x000c, 0x2db5: 0x000c, + 0x2db6: 0x000c, 0x2db7: 0x000c, 0x2db8: 0x000c, 0x2dba: 0x000c, + 0x2dbf: 0x000c, + // Block 0xb7, offset 0x2dc0 + 0x2dc0: 0x000c, 0x2dc2: 0x000c, 0x2dc3: 0x000c, + // Block 0xb8, offset 0x2e00 + 0x2e32: 0x000c, 0x2e33: 0x000c, 0x2e34: 0x000c, 0x2e35: 0x000c, + 0x2e3c: 0x000c, 0x2e3d: 0x000c, 0x2e3f: 0x000c, + // Block 0xb9, offset 0x2e40 + 0x2e40: 0x000c, + 0x2e5c: 0x000c, 0x2e5d: 0x000c, + // Block 0xba, offset 0x2e80 + 0x2eb3: 0x000c, 0x2eb4: 0x000c, 0x2eb5: 0x000c, + 0x2eb6: 0x000c, 0x2eb7: 0x000c, 0x2eb8: 0x000c, 0x2eb9: 0x000c, 0x2eba: 0x000c, + 0x2ebd: 0x000c, 0x2ebf: 0x000c, + // Block 0xbb, offset 0x2ec0 + 0x2ec0: 0x000c, + 0x2ee0: 0x000a, 0x2ee1: 0x000a, 0x2ee2: 0x000a, 0x2ee3: 0x000a, + 0x2ee4: 0x000a, 0x2ee5: 0x000a, 0x2ee6: 0x000a, 0x2ee7: 0x000a, 0x2ee8: 0x000a, 0x2ee9: 0x000a, + 0x2eea: 0x000a, 0x2eeb: 0x000a, 0x2eec: 0x000a, + // Block 0xbc, offset 0x2f00 + 0x2f2b: 0x000c, 0x2f2d: 0x000c, + 0x2f30: 0x000c, 0x2f31: 0x000c, 0x2f32: 0x000c, 0x2f33: 0x000c, 0x2f34: 0x000c, 0x2f35: 0x000c, + 0x2f37: 0x000c, + // Block 0xbd, offset 0x2f40 + 0x2f5d: 0x000c, + 0x2f5e: 0x000c, 0x2f5f: 0x000c, 0x2f62: 0x000c, 0x2f63: 0x000c, + 0x2f64: 0x000c, 0x2f65: 0x000c, 0x2f67: 0x000c, 0x2f68: 0x000c, 0x2f69: 0x000c, + 0x2f6a: 0x000c, 0x2f6b: 0x000c, + // Block 0xbe, offset 0x2f80 + 0x2faf: 0x000c, + 0x2fb0: 0x000c, 0x2fb1: 0x000c, 0x2fb2: 0x000c, 0x2fb3: 0x000c, 0x2fb4: 0x000c, 0x2fb5: 0x000c, + 0x2fb6: 0x000c, 0x2fb7: 0x000c, 0x2fb9: 0x000c, 0x2fba: 0x000c, + // Block 0xbf, offset 0x2fc0 + 0x2ffb: 0x000c, + 0x2ffc: 0x000c, 0x2ffe: 0x000c, + // Block 0xc0, offset 0x3000 + 0x3003: 0x000c, + // Block 0xc1, offset 0x3040 + 0x3054: 0x000c, 0x3055: 0x000c, 0x3056: 0x000c, 0x3057: 0x000c, + 0x305a: 0x000c, 0x305b: 0x000c, + 0x3060: 0x000c, + // Block 0xc2, offset 0x3080 + 0x3081: 0x000c, 0x3082: 0x000c, 0x3083: 0x000c, 0x3084: 0x000c, 0x3085: 0x000c, + 0x3086: 0x000c, 0x3089: 0x000c, 0x308a: 0x000c, + 0x30b3: 0x000c, 0x30b4: 0x000c, 0x30b5: 0x000c, + 0x30b6: 0x000c, 0x30b7: 0x000c, 0x30b8: 0x000c, 0x30bb: 0x000c, + 0x30bc: 0x000c, 0x30bd: 0x000c, 0x30be: 0x000c, + // Block 0xc3, offset 0x30c0 + 0x30c7: 0x000c, + 0x30d1: 0x000c, + 0x30d2: 0x000c, 0x30d3: 0x000c, 0x30d4: 0x000c, 0x30d5: 0x000c, 0x30d6: 0x000c, + 0x30d9: 0x000c, 0x30da: 0x000c, 0x30db: 0x000c, + // Block 0xc4, offset 0x3100 + 0x310a: 0x000c, 0x310b: 0x000c, + 0x310c: 0x000c, 0x310d: 0x000c, 0x310e: 0x000c, 0x310f: 0x000c, 0x3110: 0x000c, 0x3111: 0x000c, + 0x3112: 0x000c, 0x3113: 0x000c, 0x3114: 0x000c, 0x3115: 0x000c, 0x3116: 0x000c, + 0x3118: 0x000c, 0x3119: 0x000c, + // Block 0xc5, offset 0x3140 + 0x3170: 0x000c, 0x3171: 0x000c, 0x3172: 0x000c, 0x3173: 0x000c, 0x3174: 0x000c, 0x3175: 0x000c, + 0x3176: 0x000c, 0x3178: 0x000c, 0x3179: 0x000c, 0x317a: 0x000c, 0x317b: 0x000c, + 0x317c: 0x000c, 0x317d: 0x000c, + // Block 0xc6, offset 0x3180 + 0x3192: 0x000c, 0x3193: 0x000c, 0x3194: 0x000c, 0x3195: 0x000c, 0x3196: 0x000c, 0x3197: 0x000c, + 0x3198: 0x000c, 0x3199: 0x000c, 0x319a: 0x000c, 0x319b: 0x000c, 0x319c: 0x000c, 0x319d: 0x000c, + 0x319e: 0x000c, 0x319f: 0x000c, 0x31a0: 0x000c, 0x31a1: 0x000c, 0x31a2: 0x000c, 0x31a3: 0x000c, + 0x31a4: 0x000c, 0x31a5: 0x000c, 0x31a6: 0x000c, 0x31a7: 0x000c, + 0x31aa: 0x000c, 0x31ab: 0x000c, 0x31ac: 0x000c, 0x31ad: 0x000c, 0x31ae: 0x000c, 0x31af: 0x000c, + 0x31b0: 0x000c, 0x31b2: 0x000c, 0x31b3: 0x000c, 0x31b5: 0x000c, + 0x31b6: 0x000c, + // Block 0xc7, offset 0x31c0 + 0x31f1: 0x000c, 0x31f2: 0x000c, 0x31f3: 0x000c, 0x31f4: 0x000c, 0x31f5: 0x000c, + 0x31f6: 0x000c, 0x31fa: 0x000c, + 0x31fc: 0x000c, 0x31fd: 0x000c, 0x31ff: 0x000c, + // Block 0xc8, offset 0x3200 + 0x3200: 0x000c, 0x3201: 0x000c, 0x3202: 0x000c, 0x3203: 0x000c, 0x3204: 0x000c, 0x3205: 0x000c, + 0x3207: 0x000c, + // Block 0xc9, offset 0x3240 + 0x3250: 0x000c, 0x3251: 0x000c, + 0x3255: 0x000c, 0x3257: 0x000c, + // Block 0xca, offset 0x3280 + 0x32b3: 0x000c, 0x32b4: 0x000c, + // Block 0xcb, offset 0x32c0 + 0x32c0: 0x000c, 0x32c1: 0x000c, + 0x32f6: 0x000c, 0x32f7: 0x000c, 0x32f8: 0x000c, 0x32f9: 0x000c, 0x32fa: 0x000c, + // Block 0xcc, offset 0x3300 + 0x3300: 0x000c, 0x3302: 0x000c, + // Block 0xcd, offset 0x3340 + 0x3355: 0x000a, 0x3356: 0x000a, 0x3357: 0x000a, + 0x3358: 0x000a, 0x3359: 0x000a, 0x335a: 0x000a, 0x335b: 0x000a, 0x335c: 0x000a, 0x335d: 0x0004, + 0x335e: 0x0004, 0x335f: 0x0004, 0x3360: 0x0004, 0x3361: 0x000a, 0x3362: 0x000a, 0x3363: 0x000a, + 0x3364: 0x000a, 0x3365: 0x000a, 0x3366: 0x000a, 0x3367: 0x000a, 0x3368: 0x000a, 0x3369: 0x000a, + 0x336a: 0x000a, 0x336b: 0x000a, 0x336c: 0x000a, 0x336d: 0x000a, 0x336e: 0x000a, 0x336f: 0x000a, + 0x3370: 0x000a, 0x3371: 0x000a, + // Block 0xce, offset 0x3380 + 0x3380: 0x000c, + 0x3387: 0x000c, 0x3388: 0x000c, 0x3389: 0x000c, 0x338a: 0x000c, 0x338b: 0x000c, + 0x338c: 0x000c, 0x338d: 0x000c, 0x338e: 0x000c, 0x338f: 0x000c, 0x3390: 0x000c, 0x3391: 0x000c, + 0x3392: 0x000c, 0x3393: 0x000c, 0x3394: 0x000c, 0x3395: 0x000c, + // Block 0xcf, offset 0x33c0 + 0x33f0: 0x000c, 0x33f1: 0x000c, 0x33f2: 0x000c, 0x33f3: 0x000c, 0x33f4: 0x000c, + // Block 0xd0, offset 0x3400 + 0x3430: 0x000c, 0x3431: 0x000c, 0x3432: 0x000c, 0x3433: 0x000c, 0x3434: 0x000c, 0x3435: 0x000c, + 0x3436: 0x000c, + // Block 0xd1, offset 0x3440 + 0x344f: 0x000c, + // Block 0xd2, offset 0x3480 + 0x348f: 0x000c, 0x3490: 0x000c, 0x3491: 0x000c, + 0x3492: 0x000c, + // Block 0xd3, offset 0x34c0 + 0x34e2: 0x000a, + 0x34e4: 0x000c, + // Block 0xd4, offset 0x3500 + 0x351d: 0x000c, + 0x351e: 0x000c, 0x3520: 0x000b, 0x3521: 0x000b, 0x3522: 0x000b, 0x3523: 0x000b, + // Block 0xd5, offset 0x3540 + 0x3540: 0x000c, 0x3541: 0x000c, 0x3542: 0x000c, 0x3543: 0x000c, 0x3544: 0x000c, 0x3545: 0x000c, + 0x3546: 0x000c, 0x3547: 0x000c, 0x3548: 0x000c, 0x3549: 0x000c, 0x354a: 0x000c, 0x354b: 0x000c, + 0x354c: 0x000c, 0x354d: 0x000c, 0x354e: 0x000c, 0x354f: 0x000c, 0x3550: 0x000c, 0x3551: 0x000c, + 0x3552: 0x000c, 0x3553: 0x000c, 0x3554: 0x000c, 0x3555: 0x000c, 0x3556: 0x000c, 0x3557: 0x000c, + 0x3558: 0x000c, 0x3559: 0x000c, 0x355a: 0x000c, 0x355b: 0x000c, 0x355c: 0x000c, 0x355d: 0x000c, + 0x355e: 0x000c, 0x355f: 0x000c, 0x3560: 0x000c, 0x3561: 0x000c, 0x3562: 0x000c, 0x3563: 0x000c, + 0x3564: 0x000c, 0x3565: 0x000c, 0x3566: 0x000c, 0x3567: 0x000c, 0x3568: 0x000c, 0x3569: 0x000c, + 0x356a: 0x000c, 0x356b: 0x000c, 0x356c: 0x000c, 0x356d: 0x000c, + 0x3570: 0x000c, 0x3571: 0x000c, 0x3572: 0x000c, 0x3573: 0x000c, 0x3574: 0x000c, 0x3575: 0x000c, + 0x3576: 0x000c, 0x3577: 0x000c, 0x3578: 0x000c, 0x3579: 0x000c, 0x357a: 0x000c, 0x357b: 0x000c, + 0x357c: 0x000c, 0x357d: 0x000c, 0x357e: 0x000c, 0x357f: 0x000c, + // Block 0xd6, offset 0x3580 + 0x3580: 0x000c, 0x3581: 0x000c, 0x3582: 0x000c, 0x3583: 0x000c, 0x3584: 0x000c, 0x3585: 0x000c, + 0x3586: 0x000c, + // Block 0xd7, offset 0x35c0 + 0x35e7: 0x000c, 0x35e8: 0x000c, 0x35e9: 0x000c, + 0x35f3: 0x000b, 0x35f4: 0x000b, 0x35f5: 0x000b, + 0x35f6: 0x000b, 0x35f7: 0x000b, 0x35f8: 0x000b, 0x35f9: 0x000b, 0x35fa: 0x000b, 0x35fb: 0x000c, + 0x35fc: 0x000c, 0x35fd: 0x000c, 0x35fe: 0x000c, 0x35ff: 0x000c, + // Block 0xd8, offset 0x3600 + 0x3600: 0x000c, 0x3601: 0x000c, 0x3602: 0x000c, 0x3605: 0x000c, + 0x3606: 0x000c, 0x3607: 0x000c, 0x3608: 0x000c, 0x3609: 0x000c, 0x360a: 0x000c, 0x360b: 0x000c, + 0x362a: 0x000c, 0x362b: 0x000c, 0x362c: 0x000c, 0x362d: 0x000c, + // Block 0xd9, offset 0x3640 + 0x3669: 0x000a, + 0x366a: 0x000a, + // Block 0xda, offset 0x3680 + 0x3680: 0x000a, 0x3681: 0x000a, 0x3682: 0x000c, 0x3683: 0x000c, 0x3684: 0x000c, 0x3685: 0x000a, + // Block 0xdb, offset 0x36c0 + 0x36c0: 0x000a, 0x36c1: 0x000a, 0x36c2: 0x000a, 0x36c3: 0x000a, 0x36c4: 0x000a, 0x36c5: 0x000a, + 0x36c6: 0x000a, 0x36c7: 0x000a, 0x36c8: 0x000a, 0x36c9: 0x000a, 0x36ca: 0x000a, 0x36cb: 0x000a, + 0x36cc: 0x000a, 0x36cd: 0x000a, 0x36ce: 0x000a, 0x36cf: 0x000a, 0x36d0: 0x000a, 0x36d1: 0x000a, + 0x36d2: 0x000a, 0x36d3: 0x000a, 0x36d4: 0x000a, 0x36d5: 0x000a, 0x36d6: 0x000a, + // Block 0xdc, offset 0x3700 + 0x371b: 0x000a, + // Block 0xdd, offset 0x3740 + 0x3755: 0x000a, + // Block 0xde, offset 0x3780 + 0x378f: 0x000a, + // Block 0xdf, offset 0x37c0 + 0x37c9: 0x000a, + // Block 0xe0, offset 0x3800 + 0x3803: 0x000a, + 0x380e: 0x0002, 0x380f: 0x0002, 0x3810: 0x0002, 0x3811: 0x0002, + 0x3812: 0x0002, 0x3813: 0x0002, 0x3814: 0x0002, 0x3815: 0x0002, 0x3816: 0x0002, 0x3817: 0x0002, + 0x3818: 0x0002, 0x3819: 0x0002, 0x381a: 0x0002, 0x381b: 0x0002, 0x381c: 0x0002, 0x381d: 0x0002, + 0x381e: 0x0002, 0x381f: 0x0002, 0x3820: 0x0002, 0x3821: 0x0002, 0x3822: 0x0002, 0x3823: 0x0002, + 0x3824: 0x0002, 0x3825: 0x0002, 0x3826: 0x0002, 0x3827: 0x0002, 0x3828: 0x0002, 0x3829: 0x0002, + 0x382a: 0x0002, 0x382b: 0x0002, 0x382c: 0x0002, 0x382d: 0x0002, 0x382e: 0x0002, 0x382f: 0x0002, + 0x3830: 0x0002, 0x3831: 0x0002, 0x3832: 0x0002, 0x3833: 0x0002, 0x3834: 0x0002, 0x3835: 0x0002, + 0x3836: 0x0002, 0x3837: 0x0002, 0x3838: 0x0002, 0x3839: 0x0002, 0x383a: 0x0002, 0x383b: 0x0002, + 0x383c: 0x0002, 0x383d: 0x0002, 0x383e: 0x0002, 0x383f: 0x0002, + // Block 0xe1, offset 0x3840 + 0x3840: 0x000c, 0x3841: 0x000c, 0x3842: 0x000c, 0x3843: 0x000c, 0x3844: 0x000c, 0x3845: 0x000c, + 0x3846: 0x000c, 0x3847: 0x000c, 0x3848: 0x000c, 0x3849: 0x000c, 0x384a: 0x000c, 0x384b: 0x000c, + 0x384c: 0x000c, 0x384d: 0x000c, 0x384e: 0x000c, 0x384f: 0x000c, 0x3850: 0x000c, 0x3851: 0x000c, + 0x3852: 0x000c, 0x3853: 0x000c, 0x3854: 0x000c, 0x3855: 0x000c, 0x3856: 0x000c, 0x3857: 0x000c, + 0x3858: 0x000c, 0x3859: 0x000c, 0x385a: 0x000c, 0x385b: 0x000c, 0x385c: 0x000c, 0x385d: 0x000c, + 0x385e: 0x000c, 0x385f: 0x000c, 0x3860: 0x000c, 0x3861: 0x000c, 0x3862: 0x000c, 0x3863: 0x000c, + 0x3864: 0x000c, 0x3865: 0x000c, 0x3866: 0x000c, 0x3867: 0x000c, 0x3868: 0x000c, 0x3869: 0x000c, + 0x386a: 0x000c, 0x386b: 0x000c, 0x386c: 0x000c, 0x386d: 0x000c, 0x386e: 0x000c, 0x386f: 0x000c, + 0x3870: 0x000c, 0x3871: 0x000c, 0x3872: 0x000c, 0x3873: 0x000c, 0x3874: 0x000c, 0x3875: 0x000c, + 0x3876: 0x000c, 0x387b: 0x000c, + 0x387c: 0x000c, 0x387d: 0x000c, 0x387e: 0x000c, 0x387f: 0x000c, + // Block 0xe2, offset 0x3880 + 0x3880: 0x000c, 0x3881: 0x000c, 0x3882: 0x000c, 0x3883: 0x000c, 0x3884: 0x000c, 0x3885: 0x000c, + 0x3886: 0x000c, 0x3887: 0x000c, 0x3888: 0x000c, 0x3889: 0x000c, 0x388a: 0x000c, 0x388b: 0x000c, + 0x388c: 0x000c, 0x388d: 0x000c, 0x388e: 0x000c, 0x388f: 0x000c, 0x3890: 0x000c, 0x3891: 0x000c, + 0x3892: 0x000c, 0x3893: 0x000c, 0x3894: 0x000c, 0x3895: 0x000c, 0x3896: 0x000c, 0x3897: 0x000c, + 0x3898: 0x000c, 0x3899: 0x000c, 0x389a: 0x000c, 0x389b: 0x000c, 0x389c: 0x000c, 0x389d: 0x000c, + 0x389e: 0x000c, 0x389f: 0x000c, 0x38a0: 0x000c, 0x38a1: 0x000c, 0x38a2: 0x000c, 0x38a3: 0x000c, + 0x38a4: 0x000c, 0x38a5: 0x000c, 0x38a6: 0x000c, 0x38a7: 0x000c, 0x38a8: 0x000c, 0x38a9: 0x000c, + 0x38aa: 0x000c, 0x38ab: 0x000c, 0x38ac: 0x000c, + 0x38b5: 0x000c, + // Block 0xe3, offset 0x38c0 + 0x38c4: 0x000c, + 0x38db: 0x000c, 0x38dc: 0x000c, 0x38dd: 0x000c, + 0x38de: 0x000c, 0x38df: 0x000c, 0x38e1: 0x000c, 0x38e2: 0x000c, 0x38e3: 0x000c, + 0x38e4: 0x000c, 0x38e5: 0x000c, 0x38e6: 0x000c, 0x38e7: 0x000c, 0x38e8: 0x000c, 0x38e9: 0x000c, + 0x38ea: 0x000c, 0x38eb: 0x000c, 0x38ec: 0x000c, 0x38ed: 0x000c, 0x38ee: 0x000c, 0x38ef: 0x000c, + // Block 0xe4, offset 0x3900 + 0x3900: 0x000c, 0x3901: 0x000c, 0x3902: 0x000c, 0x3903: 0x000c, 0x3904: 0x000c, 0x3905: 0x000c, + 0x3906: 0x000c, 0x3908: 0x000c, 0x3909: 0x000c, 0x390a: 0x000c, 0x390b: 0x000c, + 0x390c: 0x000c, 0x390d: 0x000c, 0x390e: 0x000c, 0x390f: 0x000c, 0x3910: 0x000c, 0x3911: 0x000c, + 0x3912: 0x000c, 0x3913: 0x000c, 0x3914: 0x000c, 0x3915: 0x000c, 0x3916: 0x000c, 0x3917: 0x000c, + 0x3918: 0x000c, 0x391b: 0x000c, 0x391c: 0x000c, 0x391d: 0x000c, + 0x391e: 0x000c, 0x391f: 0x000c, 0x3920: 0x000c, 0x3921: 0x000c, 0x3923: 0x000c, + 0x3924: 0x000c, 0x3926: 0x000c, 0x3927: 0x000c, 0x3928: 0x000c, 0x3929: 0x000c, + 0x392a: 0x000c, + // Block 0xe5, offset 0x3940 + 0x396e: 0x000c, + // Block 0xe6, offset 0x3980 + 0x39ac: 0x000c, 0x39ad: 0x000c, 0x39ae: 0x000c, 0x39af: 0x000c, + 0x39bf: 0x0004, + // Block 0xe7, offset 0x39c0 + 0x39ec: 0x000c, 0x39ed: 0x000c, 0x39ee: 0x000c, 0x39ef: 0x000c, + // Block 0xe8, offset 0x3a00 + 0x3a00: 0x0001, 0x3a01: 0x0001, 0x3a02: 0x0001, 0x3a03: 0x0001, 0x3a04: 0x0001, 0x3a05: 0x0001, + 0x3a06: 0x0001, 0x3a07: 0x0001, 0x3a08: 0x0001, 0x3a09: 0x0001, 0x3a0a: 0x0001, 0x3a0b: 0x0001, + 0x3a0c: 0x0001, 0x3a0d: 0x0001, 0x3a0e: 0x0001, 0x3a0f: 0x0001, 0x3a10: 0x000c, 0x3a11: 0x000c, + 0x3a12: 0x000c, 0x3a13: 0x000c, 0x3a14: 0x000c, 0x3a15: 0x000c, 0x3a16: 0x000c, 0x3a17: 0x0001, + 0x3a18: 0x0001, 0x3a19: 0x0001, 0x3a1a: 0x0001, 0x3a1b: 0x0001, 0x3a1c: 0x0001, 0x3a1d: 0x0001, + 0x3a1e: 0x0001, 0x3a1f: 0x0001, 0x3a20: 0x0001, 0x3a21: 0x0001, 0x3a22: 0x0001, 0x3a23: 0x0001, + 0x3a24: 0x0001, 0x3a25: 0x0001, 0x3a26: 0x0001, 0x3a27: 0x0001, 0x3a28: 0x0001, 0x3a29: 0x0001, + 0x3a2a: 0x0001, 0x3a2b: 0x0001, 0x3a2c: 0x0001, 0x3a2d: 0x0001, 0x3a2e: 0x0001, 0x3a2f: 0x0001, + 0x3a30: 0x0001, 0x3a31: 0x0001, 0x3a32: 0x0001, 0x3a33: 0x0001, 0x3a34: 0x0001, 0x3a35: 0x0001, + 0x3a36: 0x0001, 0x3a37: 0x0001, 0x3a38: 0x0001, 0x3a39: 0x0001, 0x3a3a: 0x0001, 0x3a3b: 0x0001, + 0x3a3c: 0x0001, 0x3a3d: 0x0001, 0x3a3e: 0x0001, 0x3a3f: 0x0001, + // Block 0xe9, offset 0x3a40 + 0x3a40: 0x0001, 0x3a41: 0x0001, 0x3a42: 0x0001, 0x3a43: 0x0001, 0x3a44: 0x000c, 0x3a45: 0x000c, + 0x3a46: 0x000c, 0x3a47: 0x000c, 0x3a48: 0x000c, 0x3a49: 0x000c, 0x3a4a: 0x000c, 0x3a4b: 0x0001, + 0x3a4c: 0x0001, 0x3a4d: 0x0001, 0x3a4e: 0x0001, 0x3a4f: 0x0001, 0x3a50: 0x0001, 0x3a51: 0x0001, + 0x3a52: 0x0001, 0x3a53: 0x0001, 0x3a54: 0x0001, 0x3a55: 0x0001, 0x3a56: 0x0001, 0x3a57: 0x0001, + 0x3a58: 0x0001, 0x3a59: 0x0001, 0x3a5a: 0x0001, 0x3a5b: 0x0001, 0x3a5c: 0x0001, 0x3a5d: 0x0001, + 0x3a5e: 0x0001, 0x3a5f: 0x0001, 0x3a60: 0x0001, 0x3a61: 0x0001, 0x3a62: 0x0001, 0x3a63: 0x0001, + 0x3a64: 0x0001, 0x3a65: 0x0001, 0x3a66: 0x0001, 0x3a67: 0x0001, 0x3a68: 0x0001, 0x3a69: 0x0001, + 0x3a6a: 0x0001, 0x3a6b: 0x0001, 0x3a6c: 0x0001, 0x3a6d: 0x0001, 0x3a6e: 0x0001, 0x3a6f: 0x0001, + 0x3a70: 0x0001, 0x3a71: 0x0001, 0x3a72: 0x0001, 0x3a73: 0x0001, 0x3a74: 0x0001, 0x3a75: 0x0001, + 0x3a76: 0x0001, 0x3a77: 0x0001, 0x3a78: 0x0001, 0x3a79: 0x0001, 0x3a7a: 0x0001, 0x3a7b: 0x0001, + 0x3a7c: 0x0001, 0x3a7d: 0x0001, 0x3a7e: 0x0001, 0x3a7f: 0x0001, + // Block 0xea, offset 0x3a80 + 0x3a80: 0x0001, 0x3a81: 0x0001, 0x3a82: 0x0001, 0x3a83: 0x0001, 0x3a84: 0x0001, 0x3a85: 0x0001, + 0x3a86: 0x0001, 0x3a87: 0x0001, 0x3a88: 0x0001, 0x3a89: 0x0001, 0x3a8a: 0x0001, 0x3a8b: 0x0001, + 0x3a8c: 0x0001, 0x3a8d: 0x0001, 0x3a8e: 0x0001, 0x3a8f: 0x0001, 0x3a90: 0x0001, 0x3a91: 0x0001, + 0x3a92: 0x0001, 0x3a93: 0x0001, 0x3a94: 0x0001, 0x3a95: 0x0001, 0x3a96: 0x0001, 0x3a97: 0x0001, + 0x3a98: 0x0001, 0x3a99: 0x0001, 0x3a9a: 0x0001, 0x3a9b: 0x0001, 0x3a9c: 0x0001, 0x3a9d: 0x0001, + 0x3a9e: 0x0001, 0x3a9f: 0x0001, 0x3aa0: 0x0001, 0x3aa1: 0x0001, 0x3aa2: 0x0001, 0x3aa3: 0x0001, + 0x3aa4: 0x0001, 0x3aa5: 0x0001, 0x3aa6: 0x0001, 0x3aa7: 0x0001, 0x3aa8: 0x0001, 0x3aa9: 0x0001, + 0x3aaa: 0x0001, 0x3aab: 0x0001, 0x3aac: 0x0001, 0x3aad: 0x0001, 0x3aae: 0x0001, 0x3aaf: 0x0001, + 0x3ab0: 0x0001, 0x3ab1: 0x000d, 0x3ab2: 0x000d, 0x3ab3: 0x000d, 0x3ab4: 0x000d, 0x3ab5: 0x000d, + 0x3ab6: 0x000d, 0x3ab7: 0x000d, 0x3ab8: 0x000d, 0x3ab9: 0x000d, 0x3aba: 0x000d, 0x3abb: 0x000d, + 0x3abc: 0x000d, 0x3abd: 0x000d, 0x3abe: 0x000d, 0x3abf: 0x000d, + // Block 0xeb, offset 0x3ac0 + 0x3ac0: 0x000d, 0x3ac1: 0x000d, 0x3ac2: 0x000d, 0x3ac3: 0x000d, 0x3ac4: 0x000d, 0x3ac5: 0x000d, + 0x3ac6: 0x000d, 0x3ac7: 0x000d, 0x3ac8: 0x000d, 0x3ac9: 0x000d, 0x3aca: 0x000d, 0x3acb: 0x000d, + 0x3acc: 0x000d, 0x3acd: 0x000d, 0x3ace: 0x000d, 0x3acf: 0x000d, 0x3ad0: 0x000d, 0x3ad1: 0x000d, + 0x3ad2: 0x000d, 0x3ad3: 0x000d, 0x3ad4: 0x000d, 0x3ad5: 0x000d, 0x3ad6: 0x000d, 0x3ad7: 0x000d, + 0x3ad8: 0x000d, 0x3ad9: 0x000d, 0x3ada: 0x000d, 0x3adb: 0x000d, 0x3adc: 0x000d, 0x3add: 0x000d, + 0x3ade: 0x000d, 0x3adf: 0x000d, 0x3ae0: 0x000d, 0x3ae1: 0x000d, 0x3ae2: 0x000d, 0x3ae3: 0x000d, + 0x3ae4: 0x000d, 0x3ae5: 0x000d, 0x3ae6: 0x000d, 0x3ae7: 0x000d, 0x3ae8: 0x000d, 0x3ae9: 0x000d, + 0x3aea: 0x000d, 0x3aeb: 0x000d, 0x3aec: 0x000d, 0x3aed: 0x000d, 0x3aee: 0x000d, 0x3aef: 0x000d, + 0x3af0: 0x000d, 0x3af1: 0x000d, 0x3af2: 0x000d, 0x3af3: 0x000d, 0x3af4: 0x000d, 0x3af5: 0x0001, + 0x3af6: 0x0001, 0x3af7: 0x0001, 0x3af8: 0x0001, 0x3af9: 0x0001, 0x3afa: 0x0001, 0x3afb: 0x0001, + 0x3afc: 0x0001, 0x3afd: 0x0001, 0x3afe: 0x0001, 0x3aff: 0x0001, + // Block 0xec, offset 0x3b00 + 0x3b00: 0x0001, 0x3b01: 0x000d, 0x3b02: 0x000d, 0x3b03: 0x000d, 0x3b04: 0x000d, 0x3b05: 0x000d, + 0x3b06: 0x000d, 0x3b07: 0x000d, 0x3b08: 0x000d, 0x3b09: 0x000d, 0x3b0a: 0x000d, 0x3b0b: 0x000d, + 0x3b0c: 0x000d, 0x3b0d: 0x000d, 0x3b0e: 0x000d, 0x3b0f: 0x000d, 0x3b10: 0x000d, 0x3b11: 0x000d, + 0x3b12: 0x000d, 0x3b13: 0x000d, 0x3b14: 0x000d, 0x3b15: 0x000d, 0x3b16: 0x000d, 0x3b17: 0x000d, + 0x3b18: 0x000d, 0x3b19: 0x000d, 0x3b1a: 0x000d, 0x3b1b: 0x000d, 0x3b1c: 0x000d, 0x3b1d: 0x000d, + 0x3b1e: 0x000d, 0x3b1f: 0x000d, 0x3b20: 0x000d, 0x3b21: 0x000d, 0x3b22: 0x000d, 0x3b23: 0x000d, + 0x3b24: 0x000d, 0x3b25: 0x000d, 0x3b26: 0x000d, 0x3b27: 0x000d, 0x3b28: 0x000d, 0x3b29: 0x000d, + 0x3b2a: 0x000d, 0x3b2b: 0x000d, 0x3b2c: 0x000d, 0x3b2d: 0x000d, 0x3b2e: 0x000d, 0x3b2f: 0x000d, + 0x3b30: 0x000d, 0x3b31: 0x000d, 0x3b32: 0x000d, 0x3b33: 0x000d, 0x3b34: 0x000d, 0x3b35: 0x000d, + 0x3b36: 0x000d, 0x3b37: 0x000d, 0x3b38: 0x000d, 0x3b39: 0x000d, 0x3b3a: 0x000d, 0x3b3b: 0x000d, + 0x3b3c: 0x000d, 0x3b3d: 0x000d, 0x3b3e: 0x0001, 0x3b3f: 0x0001, + // Block 0xed, offset 0x3b40 + 0x3b40: 0x000d, 0x3b41: 0x000d, 0x3b42: 0x000d, 0x3b43: 0x000d, 0x3b44: 0x000d, 0x3b45: 0x000d, + 0x3b46: 0x000d, 0x3b47: 0x000d, 0x3b48: 0x000d, 0x3b49: 0x000d, 0x3b4a: 0x000d, 0x3b4b: 0x000d, + 0x3b4c: 0x000d, 0x3b4d: 0x000d, 0x3b4e: 0x000d, 0x3b4f: 0x000d, 0x3b50: 0x000d, 0x3b51: 0x000d, + 0x3b52: 0x000d, 0x3b53: 0x000d, 0x3b54: 0x000d, 0x3b55: 0x000d, 0x3b56: 0x000d, 0x3b57: 0x000d, + 0x3b58: 0x000d, 0x3b59: 0x000d, 0x3b5a: 0x000d, 0x3b5b: 0x000d, 0x3b5c: 0x000d, 0x3b5d: 0x000d, + 0x3b5e: 0x000d, 0x3b5f: 0x000d, 0x3b60: 0x000d, 0x3b61: 0x000d, 0x3b62: 0x000d, 0x3b63: 0x000d, + 0x3b64: 0x000d, 0x3b65: 0x000d, 0x3b66: 0x000d, 0x3b67: 0x000d, 0x3b68: 0x000d, 0x3b69: 0x000d, + 0x3b6a: 0x000d, 0x3b6b: 0x000d, 0x3b6c: 0x000d, 0x3b6d: 0x000d, 0x3b6e: 0x000d, 0x3b6f: 0x000d, + 0x3b70: 0x000a, 0x3b71: 0x000a, 0x3b72: 0x000d, 0x3b73: 0x000d, 0x3b74: 0x000d, 0x3b75: 0x000d, + 0x3b76: 0x000d, 0x3b77: 0x000d, 0x3b78: 0x000d, 0x3b79: 0x000d, 0x3b7a: 0x000d, 0x3b7b: 0x000d, + 0x3b7c: 0x000d, 0x3b7d: 0x000d, 0x3b7e: 0x000d, 0x3b7f: 0x000d, + // Block 0xee, offset 0x3b80 + 0x3b80: 0x000a, 0x3b81: 0x000a, 0x3b82: 0x000a, 0x3b83: 0x000a, 0x3b84: 0x000a, 0x3b85: 0x000a, + 0x3b86: 0x000a, 0x3b87: 0x000a, 0x3b88: 0x000a, 0x3b89: 0x000a, 0x3b8a: 0x000a, 0x3b8b: 0x000a, + 0x3b8c: 0x000a, 0x3b8d: 0x000a, 0x3b8e: 0x000a, 0x3b8f: 0x000a, 0x3b90: 0x000a, 0x3b91: 0x000a, + 0x3b92: 0x000a, 0x3b93: 0x000a, 0x3b94: 0x000a, 0x3b95: 0x000a, 0x3b96: 0x000a, 0x3b97: 0x000a, + 0x3b98: 0x000a, 0x3b99: 0x000a, 0x3b9a: 0x000a, 0x3b9b: 0x000a, 0x3b9c: 0x000a, 0x3b9d: 0x000a, + 0x3b9e: 0x000a, 0x3b9f: 0x000a, 0x3ba0: 0x000a, 0x3ba1: 0x000a, 0x3ba2: 0x000a, 0x3ba3: 0x000a, + 0x3ba4: 0x000a, 0x3ba5: 0x000a, 0x3ba6: 0x000a, 0x3ba7: 0x000a, 0x3ba8: 0x000a, 0x3ba9: 0x000a, + 0x3baa: 0x000a, 0x3bab: 0x000a, + 0x3bb0: 0x000a, 0x3bb1: 0x000a, 0x3bb2: 0x000a, 0x3bb3: 0x000a, 0x3bb4: 0x000a, 0x3bb5: 0x000a, + 0x3bb6: 0x000a, 0x3bb7: 0x000a, 0x3bb8: 0x000a, 0x3bb9: 0x000a, 0x3bba: 0x000a, 0x3bbb: 0x000a, + 0x3bbc: 0x000a, 0x3bbd: 0x000a, 0x3bbe: 0x000a, 0x3bbf: 0x000a, + // Block 0xef, offset 0x3bc0 + 0x3bc0: 0x000a, 0x3bc1: 0x000a, 0x3bc2: 0x000a, 0x3bc3: 0x000a, 0x3bc4: 0x000a, 0x3bc5: 0x000a, + 0x3bc6: 0x000a, 0x3bc7: 0x000a, 0x3bc8: 0x000a, 0x3bc9: 0x000a, 0x3bca: 0x000a, 0x3bcb: 0x000a, + 0x3bcc: 0x000a, 0x3bcd: 0x000a, 0x3bce: 0x000a, 0x3bcf: 0x000a, 0x3bd0: 0x000a, 0x3bd1: 0x000a, + 0x3bd2: 0x000a, 0x3bd3: 0x000a, + 0x3be0: 0x000a, 0x3be1: 0x000a, 0x3be2: 0x000a, 0x3be3: 0x000a, + 0x3be4: 0x000a, 0x3be5: 0x000a, 0x3be6: 0x000a, 0x3be7: 0x000a, 0x3be8: 0x000a, 0x3be9: 0x000a, + 0x3bea: 0x000a, 0x3beb: 0x000a, 0x3bec: 0x000a, 0x3bed: 0x000a, 0x3bee: 0x000a, + 0x3bf1: 0x000a, 0x3bf2: 0x000a, 0x3bf3: 0x000a, 0x3bf4: 0x000a, 0x3bf5: 0x000a, + 0x3bf6: 0x000a, 0x3bf7: 0x000a, 0x3bf8: 0x000a, 0x3bf9: 0x000a, 0x3bfa: 0x000a, 0x3bfb: 0x000a, + 0x3bfc: 0x000a, 0x3bfd: 0x000a, 0x3bfe: 0x000a, 0x3bff: 0x000a, + // Block 0xf0, offset 0x3c00 + 0x3c01: 0x000a, 0x3c02: 0x000a, 0x3c03: 0x000a, 0x3c04: 0x000a, 0x3c05: 0x000a, + 0x3c06: 0x000a, 0x3c07: 0x000a, 0x3c08: 0x000a, 0x3c09: 0x000a, 0x3c0a: 0x000a, 0x3c0b: 0x000a, + 0x3c0c: 0x000a, 0x3c0d: 0x000a, 0x3c0e: 0x000a, 0x3c0f: 0x000a, 0x3c11: 0x000a, + 0x3c12: 0x000a, 0x3c13: 0x000a, 0x3c14: 0x000a, 0x3c15: 0x000a, 0x3c16: 0x000a, 0x3c17: 0x000a, + 0x3c18: 0x000a, 0x3c19: 0x000a, 0x3c1a: 0x000a, 0x3c1b: 0x000a, 0x3c1c: 0x000a, 0x3c1d: 0x000a, + 0x3c1e: 0x000a, 0x3c1f: 0x000a, 0x3c20: 0x000a, 0x3c21: 0x000a, 0x3c22: 0x000a, 0x3c23: 0x000a, + 0x3c24: 0x000a, 0x3c25: 0x000a, 0x3c26: 0x000a, 0x3c27: 0x000a, 0x3c28: 0x000a, 0x3c29: 0x000a, + 0x3c2a: 0x000a, 0x3c2b: 0x000a, 0x3c2c: 0x000a, 0x3c2d: 0x000a, 0x3c2e: 0x000a, 0x3c2f: 0x000a, + 0x3c30: 0x000a, 0x3c31: 0x000a, 0x3c32: 0x000a, 0x3c33: 0x000a, 0x3c34: 0x000a, 0x3c35: 0x000a, + // Block 0xf1, offset 0x3c40 + 0x3c40: 0x0002, 0x3c41: 0x0002, 0x3c42: 0x0002, 0x3c43: 0x0002, 0x3c44: 0x0002, 0x3c45: 0x0002, + 0x3c46: 0x0002, 0x3c47: 0x0002, 0x3c48: 0x0002, 0x3c49: 0x0002, 0x3c4a: 0x0002, 0x3c4b: 0x000a, + 0x3c4c: 0x000a, 0x3c4d: 0x000a, 0x3c4e: 0x000a, 0x3c4f: 0x000a, + 0x3c6f: 0x000a, + // Block 0xf2, offset 0x3c80 + 0x3caa: 0x000a, 0x3cab: 0x000a, 0x3cac: 0x000a, 0x3cad: 0x000a, 0x3cae: 0x000a, 0x3caf: 0x000a, + // Block 0xf3, offset 0x3cc0 + 0x3ced: 0x000a, + // Block 0xf4, offset 0x3d00 + 0x3d20: 0x000a, 0x3d21: 0x000a, 0x3d22: 0x000a, 0x3d23: 0x000a, + 0x3d24: 0x000a, 0x3d25: 0x000a, + // Block 0xf5, offset 0x3d40 + 0x3d40: 0x000a, 0x3d41: 0x000a, 0x3d42: 0x000a, 0x3d43: 0x000a, 0x3d44: 0x000a, 0x3d45: 0x000a, + 0x3d46: 0x000a, 0x3d47: 0x000a, 0x3d48: 0x000a, 0x3d49: 0x000a, 0x3d4a: 0x000a, 0x3d4b: 0x000a, + 0x3d4c: 0x000a, 0x3d4d: 0x000a, 0x3d4e: 0x000a, 0x3d4f: 0x000a, 0x3d50: 0x000a, 0x3d51: 0x000a, + 0x3d52: 0x000a, 0x3d53: 0x000a, 0x3d54: 0x000a, 0x3d55: 0x000a, 0x3d56: 0x000a, 0x3d57: 0x000a, + 0x3d5c: 0x000a, 0x3d5d: 0x000a, + 0x3d5e: 0x000a, 0x3d5f: 0x000a, 0x3d60: 0x000a, 0x3d61: 0x000a, 0x3d62: 0x000a, 0x3d63: 0x000a, + 0x3d64: 0x000a, 0x3d65: 0x000a, 0x3d66: 0x000a, 0x3d67: 0x000a, 0x3d68: 0x000a, 0x3d69: 0x000a, + 0x3d6a: 0x000a, 0x3d6b: 0x000a, 0x3d6c: 0x000a, + 0x3d70: 0x000a, 0x3d71: 0x000a, 0x3d72: 0x000a, 0x3d73: 0x000a, 0x3d74: 0x000a, 0x3d75: 0x000a, + 0x3d76: 0x000a, 0x3d77: 0x000a, 0x3d78: 0x000a, 0x3d79: 0x000a, 0x3d7a: 0x000a, 0x3d7b: 0x000a, + 0x3d7c: 0x000a, + // Block 0xf6, offset 0x3d80 + 0x3d80: 0x000a, 0x3d81: 0x000a, 0x3d82: 0x000a, 0x3d83: 0x000a, 0x3d84: 0x000a, 0x3d85: 0x000a, + 0x3d86: 0x000a, 0x3d87: 0x000a, 0x3d88: 0x000a, 0x3d89: 0x000a, 0x3d8a: 0x000a, 0x3d8b: 0x000a, + 0x3d8c: 0x000a, 0x3d8d: 0x000a, 0x3d8e: 0x000a, 0x3d8f: 0x000a, 0x3d90: 0x000a, 0x3d91: 0x000a, + 0x3d92: 0x000a, 0x3d93: 0x000a, 0x3d94: 0x000a, 0x3d95: 0x000a, 0x3d96: 0x000a, 0x3d97: 0x000a, + 0x3d98: 0x000a, 0x3d99: 0x000a, 0x3d9a: 0x000a, 0x3d9b: 0x000a, 0x3d9c: 0x000a, 0x3d9d: 0x000a, + 0x3d9e: 0x000a, 0x3d9f: 0x000a, 0x3da0: 0x000a, 0x3da1: 0x000a, 0x3da2: 0x000a, 0x3da3: 0x000a, + 0x3da4: 0x000a, 0x3da5: 0x000a, 0x3da6: 0x000a, 0x3da7: 0x000a, 0x3da8: 0x000a, 0x3da9: 0x000a, + 0x3daa: 0x000a, 0x3dab: 0x000a, 0x3dac: 0x000a, 0x3dad: 0x000a, 0x3dae: 0x000a, 0x3daf: 0x000a, + 0x3db0: 0x000a, 0x3db1: 0x000a, 0x3db2: 0x000a, 0x3db3: 0x000a, 0x3db4: 0x000a, 0x3db5: 0x000a, + 0x3db6: 0x000a, 0x3dbb: 0x000a, + 0x3dbc: 0x000a, 0x3dbd: 0x000a, 0x3dbe: 0x000a, 0x3dbf: 0x000a, + // Block 0xf7, offset 0x3dc0 + 0x3dc0: 0x000a, 0x3dc1: 0x000a, 0x3dc2: 0x000a, 0x3dc3: 0x000a, 0x3dc4: 0x000a, 0x3dc5: 0x000a, + 0x3dc6: 0x000a, 0x3dc7: 0x000a, 0x3dc8: 0x000a, 0x3dc9: 0x000a, 0x3dca: 0x000a, 0x3dcb: 0x000a, + 0x3dcc: 0x000a, 0x3dcd: 0x000a, 0x3dce: 0x000a, 0x3dcf: 0x000a, 0x3dd0: 0x000a, 0x3dd1: 0x000a, + 0x3dd2: 0x000a, 0x3dd3: 0x000a, 0x3dd4: 0x000a, 0x3dd5: 0x000a, 0x3dd6: 0x000a, 0x3dd7: 0x000a, + 0x3dd8: 0x000a, 0x3dd9: 0x000a, + 0x3de0: 0x000a, 0x3de1: 0x000a, 0x3de2: 0x000a, 0x3de3: 0x000a, + 0x3de4: 0x000a, 0x3de5: 0x000a, 0x3de6: 0x000a, 0x3de7: 0x000a, 0x3de8: 0x000a, 0x3de9: 0x000a, + 0x3dea: 0x000a, 0x3deb: 0x000a, + 0x3df0: 0x000a, + // Block 0xf8, offset 0x3e00 + 0x3e00: 0x000a, 0x3e01: 0x000a, 0x3e02: 0x000a, 0x3e03: 0x000a, 0x3e04: 0x000a, 0x3e05: 0x000a, + 0x3e06: 0x000a, 0x3e07: 0x000a, 0x3e08: 0x000a, 0x3e09: 0x000a, 0x3e0a: 0x000a, 0x3e0b: 0x000a, + 0x3e10: 0x000a, 0x3e11: 0x000a, + 0x3e12: 0x000a, 0x3e13: 0x000a, 0x3e14: 0x000a, 0x3e15: 0x000a, 0x3e16: 0x000a, 0x3e17: 0x000a, + 0x3e18: 0x000a, 0x3e19: 0x000a, 0x3e1a: 0x000a, 0x3e1b: 0x000a, 0x3e1c: 0x000a, 0x3e1d: 0x000a, + 0x3e1e: 0x000a, 0x3e1f: 0x000a, 0x3e20: 0x000a, 0x3e21: 0x000a, 0x3e22: 0x000a, 0x3e23: 0x000a, + 0x3e24: 0x000a, 0x3e25: 0x000a, 0x3e26: 0x000a, 0x3e27: 0x000a, 0x3e28: 0x000a, 0x3e29: 0x000a, + 0x3e2a: 0x000a, 0x3e2b: 0x000a, 0x3e2c: 0x000a, 0x3e2d: 0x000a, 0x3e2e: 0x000a, 0x3e2f: 0x000a, + 0x3e30: 0x000a, 0x3e31: 0x000a, 0x3e32: 0x000a, 0x3e33: 0x000a, 0x3e34: 0x000a, 0x3e35: 0x000a, + 0x3e36: 0x000a, 0x3e37: 0x000a, 0x3e38: 0x000a, 0x3e39: 0x000a, 0x3e3a: 0x000a, 0x3e3b: 0x000a, + 0x3e3c: 0x000a, 0x3e3d: 0x000a, 0x3e3e: 0x000a, 0x3e3f: 0x000a, + // Block 0xf9, offset 0x3e40 + 0x3e40: 0x000a, 0x3e41: 0x000a, 0x3e42: 0x000a, 0x3e43: 0x000a, 0x3e44: 0x000a, 0x3e45: 0x000a, + 0x3e46: 0x000a, 0x3e47: 0x000a, + 0x3e50: 0x000a, 0x3e51: 0x000a, + 0x3e52: 0x000a, 0x3e53: 0x000a, 0x3e54: 0x000a, 0x3e55: 0x000a, 0x3e56: 0x000a, 0x3e57: 0x000a, + 0x3e58: 0x000a, 0x3e59: 0x000a, + 0x3e60: 0x000a, 0x3e61: 0x000a, 0x3e62: 0x000a, 0x3e63: 0x000a, + 0x3e64: 0x000a, 0x3e65: 0x000a, 0x3e66: 0x000a, 0x3e67: 0x000a, 0x3e68: 0x000a, 0x3e69: 0x000a, + 0x3e6a: 0x000a, 0x3e6b: 0x000a, 0x3e6c: 0x000a, 0x3e6d: 0x000a, 0x3e6e: 0x000a, 0x3e6f: 0x000a, + 0x3e70: 0x000a, 0x3e71: 0x000a, 0x3e72: 0x000a, 0x3e73: 0x000a, 0x3e74: 0x000a, 0x3e75: 0x000a, + 0x3e76: 0x000a, 0x3e77: 0x000a, 0x3e78: 0x000a, 0x3e79: 0x000a, 0x3e7a: 0x000a, 0x3e7b: 0x000a, + 0x3e7c: 0x000a, 0x3e7d: 0x000a, 0x3e7e: 0x000a, 0x3e7f: 0x000a, + // Block 0xfa, offset 0x3e80 + 0x3e80: 0x000a, 0x3e81: 0x000a, 0x3e82: 0x000a, 0x3e83: 0x000a, 0x3e84: 0x000a, 0x3e85: 0x000a, + 0x3e86: 0x000a, 0x3e87: 0x000a, + 0x3e90: 0x000a, 0x3e91: 0x000a, + 0x3e92: 0x000a, 0x3e93: 0x000a, 0x3e94: 0x000a, 0x3e95: 0x000a, 0x3e96: 0x000a, 0x3e97: 0x000a, + 0x3e98: 0x000a, 0x3e99: 0x000a, 0x3e9a: 0x000a, 0x3e9b: 0x000a, 0x3e9c: 0x000a, 0x3e9d: 0x000a, + 0x3e9e: 0x000a, 0x3e9f: 0x000a, 0x3ea0: 0x000a, 0x3ea1: 0x000a, 0x3ea2: 0x000a, 0x3ea3: 0x000a, + 0x3ea4: 0x000a, 0x3ea5: 0x000a, 0x3ea6: 0x000a, 0x3ea7: 0x000a, 0x3ea8: 0x000a, 0x3ea9: 0x000a, + 0x3eaa: 0x000a, 0x3eab: 0x000a, 0x3eac: 0x000a, 0x3ead: 0x000a, + 0x3eb0: 0x000a, 0x3eb1: 0x000a, + // Block 0xfb, offset 0x3ec0 + 0x3ec0: 0x000a, 0x3ec1: 0x000a, 0x3ec2: 0x000a, 0x3ec3: 0x000a, 0x3ec4: 0x000a, 0x3ec5: 0x000a, + 0x3ec6: 0x000a, 0x3ec7: 0x000a, 0x3ec8: 0x000a, 0x3ec9: 0x000a, 0x3eca: 0x000a, 0x3ecb: 0x000a, + 0x3ecc: 0x000a, 0x3ecd: 0x000a, 0x3ece: 0x000a, 0x3ecf: 0x000a, 0x3ed0: 0x000a, 0x3ed1: 0x000a, + 0x3ed2: 0x000a, 0x3ed3: 0x000a, + 0x3ee0: 0x000a, 0x3ee1: 0x000a, 0x3ee2: 0x000a, 0x3ee3: 0x000a, + 0x3ee4: 0x000a, 0x3ee5: 0x000a, 0x3ee6: 0x000a, 0x3ee7: 0x000a, 0x3ee8: 0x000a, 0x3ee9: 0x000a, + 0x3eea: 0x000a, 0x3eeb: 0x000a, 0x3eec: 0x000a, 0x3eed: 0x000a, + 0x3ef0: 0x000a, 0x3ef1: 0x000a, 0x3ef2: 0x000a, 0x3ef3: 0x000a, 0x3ef4: 0x000a, 0x3ef5: 0x000a, + 0x3ef6: 0x000a, 0x3ef7: 0x000a, 0x3ef8: 0x000a, 0x3ef9: 0x000a, 0x3efa: 0x000a, 0x3efb: 0x000a, + 0x3efc: 0x000a, + // Block 0xfc, offset 0x3f00 + 0x3f00: 0x000a, 0x3f01: 0x000a, 0x3f02: 0x000a, 0x3f03: 0x000a, 0x3f04: 0x000a, 0x3f05: 0x000a, + 0x3f06: 0x000a, 0x3f07: 0x000a, 0x3f08: 0x000a, + 0x3f10: 0x000a, 0x3f11: 0x000a, + 0x3f12: 0x000a, 0x3f13: 0x000a, 0x3f14: 0x000a, 0x3f15: 0x000a, 0x3f16: 0x000a, 0x3f17: 0x000a, + 0x3f18: 0x000a, 0x3f19: 0x000a, 0x3f1a: 0x000a, 0x3f1b: 0x000a, 0x3f1c: 0x000a, 0x3f1d: 0x000a, + 0x3f1e: 0x000a, 0x3f1f: 0x000a, 0x3f20: 0x000a, 0x3f21: 0x000a, 0x3f22: 0x000a, 0x3f23: 0x000a, + 0x3f24: 0x000a, 0x3f25: 0x000a, 0x3f26: 0x000a, 0x3f27: 0x000a, 0x3f28: 0x000a, 0x3f29: 0x000a, + 0x3f2a: 0x000a, 0x3f2b: 0x000a, 0x3f2c: 0x000a, 0x3f2d: 0x000a, 0x3f2e: 0x000a, 0x3f2f: 0x000a, + 0x3f30: 0x000a, 0x3f31: 0x000a, 0x3f32: 0x000a, 0x3f33: 0x000a, 0x3f34: 0x000a, 0x3f35: 0x000a, + 0x3f36: 0x000a, 0x3f37: 0x000a, 0x3f38: 0x000a, 0x3f39: 0x000a, 0x3f3a: 0x000a, 0x3f3b: 0x000a, + 0x3f3c: 0x000a, 0x3f3d: 0x000a, 0x3f3f: 0x000a, + // Block 0xfd, offset 0x3f40 + 0x3f40: 0x000a, 0x3f41: 0x000a, 0x3f42: 0x000a, 0x3f43: 0x000a, 0x3f44: 0x000a, 0x3f45: 0x000a, + 0x3f4e: 0x000a, 0x3f4f: 0x000a, 0x3f50: 0x000a, 0x3f51: 0x000a, + 0x3f52: 0x000a, 0x3f53: 0x000a, 0x3f54: 0x000a, 0x3f55: 0x000a, 0x3f56: 0x000a, 0x3f57: 0x000a, + 0x3f58: 0x000a, 0x3f59: 0x000a, 0x3f5a: 0x000a, 0x3f5b: 0x000a, + 0x3f60: 0x000a, 0x3f61: 0x000a, 0x3f62: 0x000a, 0x3f63: 0x000a, + 0x3f64: 0x000a, 0x3f65: 0x000a, 0x3f66: 0x000a, 0x3f67: 0x000a, 0x3f68: 0x000a, + 0x3f70: 0x000a, 0x3f71: 0x000a, 0x3f72: 0x000a, 0x3f73: 0x000a, 0x3f74: 0x000a, 0x3f75: 0x000a, + 0x3f76: 0x000a, 0x3f77: 0x000a, 0x3f78: 0x000a, + // Block 0xfe, offset 0x3f80 + 0x3f80: 0x000a, 0x3f81: 0x000a, 0x3f82: 0x000a, 0x3f83: 0x000a, 0x3f84: 0x000a, 0x3f85: 0x000a, + 0x3f86: 0x000a, 0x3f87: 0x000a, 0x3f88: 0x000a, 0x3f89: 0x000a, 0x3f8a: 0x000a, 0x3f8b: 0x000a, + 0x3f8c: 0x000a, 0x3f8d: 0x000a, 0x3f8e: 0x000a, 0x3f8f: 0x000a, 0x3f90: 0x000a, 0x3f91: 0x000a, + 0x3f92: 0x000a, 0x3f94: 0x000a, 0x3f95: 0x000a, 0x3f96: 0x000a, 0x3f97: 0x000a, + 0x3f98: 0x000a, 0x3f99: 0x000a, 0x3f9a: 0x000a, 0x3f9b: 0x000a, 0x3f9c: 0x000a, 0x3f9d: 0x000a, + 0x3f9e: 0x000a, 0x3f9f: 0x000a, 0x3fa0: 0x000a, 0x3fa1: 0x000a, 0x3fa2: 0x000a, 0x3fa3: 0x000a, + 0x3fa4: 0x000a, 0x3fa5: 0x000a, 0x3fa6: 0x000a, 0x3fa7: 0x000a, 0x3fa8: 0x000a, 0x3fa9: 0x000a, + 0x3faa: 0x000a, 0x3fab: 0x000a, 0x3fac: 0x000a, 0x3fad: 0x000a, 0x3fae: 0x000a, 0x3faf: 0x000a, + 0x3fb0: 0x000a, 0x3fb1: 0x000a, 0x3fb2: 0x000a, 0x3fb3: 0x000a, 0x3fb4: 0x000a, 0x3fb5: 0x000a, + 0x3fb6: 0x000a, 0x3fb7: 0x000a, 0x3fb8: 0x000a, 0x3fb9: 0x000a, 0x3fba: 0x000a, 0x3fbb: 0x000a, + 0x3fbc: 0x000a, 0x3fbd: 0x000a, 0x3fbe: 0x000a, 0x3fbf: 0x000a, + // Block 0xff, offset 0x3fc0 + 0x3fc0: 0x000a, 0x3fc1: 0x000a, 0x3fc2: 0x000a, 0x3fc3: 0x000a, 0x3fc4: 0x000a, 0x3fc5: 0x000a, + 0x3fc6: 0x000a, 0x3fc7: 0x000a, 0x3fc8: 0x000a, 0x3fc9: 0x000a, 0x3fca: 0x000a, + 0x3ff0: 0x0002, 0x3ff1: 0x0002, 0x3ff2: 0x0002, 0x3ff3: 0x0002, 0x3ff4: 0x0002, 0x3ff5: 0x0002, + 0x3ff6: 0x0002, 0x3ff7: 0x0002, 0x3ff8: 0x0002, 0x3ff9: 0x0002, + // Block 0x100, offset 0x4000 + 0x403e: 0x000b, 0x403f: 0x000b, + // Block 0x101, offset 0x4040 + 0x4040: 0x000b, 0x4041: 0x000b, 0x4042: 0x000b, 0x4043: 0x000b, 0x4044: 0x000b, 0x4045: 0x000b, + 0x4046: 0x000b, 0x4047: 0x000b, 0x4048: 0x000b, 0x4049: 0x000b, 0x404a: 0x000b, 0x404b: 0x000b, + 0x404c: 0x000b, 0x404d: 0x000b, 0x404e: 0x000b, 0x404f: 0x000b, 0x4050: 0x000b, 0x4051: 0x000b, + 0x4052: 0x000b, 0x4053: 0x000b, 0x4054: 0x000b, 0x4055: 0x000b, 0x4056: 0x000b, 0x4057: 0x000b, + 0x4058: 0x000b, 0x4059: 0x000b, 0x405a: 0x000b, 0x405b: 0x000b, 0x405c: 0x000b, 0x405d: 0x000b, + 0x405e: 0x000b, 0x405f: 0x000b, 0x4060: 0x000b, 0x4061: 0x000b, 0x4062: 0x000b, 0x4063: 0x000b, + 0x4064: 0x000b, 0x4065: 0x000b, 0x4066: 0x000b, 0x4067: 0x000b, 0x4068: 0x000b, 0x4069: 0x000b, + 0x406a: 0x000b, 0x406b: 0x000b, 0x406c: 0x000b, 0x406d: 0x000b, 0x406e: 0x000b, 0x406f: 0x000b, + 0x4070: 0x000b, 0x4071: 0x000b, 0x4072: 0x000b, 0x4073: 0x000b, 0x4074: 0x000b, 0x4075: 0x000b, + 0x4076: 0x000b, 0x4077: 0x000b, 0x4078: 0x000b, 0x4079: 0x000b, 0x407a: 0x000b, 0x407b: 0x000b, + 0x407c: 0x000b, 0x407d: 0x000b, 0x407e: 0x000b, 0x407f: 0x000b, + // Block 0x102, offset 0x4080 + 0x4080: 0x000c, 0x4081: 0x000c, 0x4082: 0x000c, 0x4083: 0x000c, 0x4084: 0x000c, 0x4085: 0x000c, + 0x4086: 0x000c, 0x4087: 0x000c, 0x4088: 0x000c, 0x4089: 0x000c, 0x408a: 0x000c, 0x408b: 0x000c, + 0x408c: 0x000c, 0x408d: 0x000c, 0x408e: 0x000c, 0x408f: 0x000c, 0x4090: 0x000c, 0x4091: 0x000c, + 0x4092: 0x000c, 0x4093: 0x000c, 0x4094: 0x000c, 0x4095: 0x000c, 0x4096: 0x000c, 0x4097: 0x000c, + 0x4098: 0x000c, 0x4099: 0x000c, 0x409a: 0x000c, 0x409b: 0x000c, 0x409c: 0x000c, 0x409d: 0x000c, + 0x409e: 0x000c, 0x409f: 0x000c, 0x40a0: 0x000c, 0x40a1: 0x000c, 0x40a2: 0x000c, 0x40a3: 0x000c, + 0x40a4: 0x000c, 0x40a5: 0x000c, 0x40a6: 0x000c, 0x40a7: 0x000c, 0x40a8: 0x000c, 0x40a9: 0x000c, + 0x40aa: 0x000c, 0x40ab: 0x000c, 0x40ac: 0x000c, 0x40ad: 0x000c, 0x40ae: 0x000c, 0x40af: 0x000c, + 0x40b0: 0x000b, 0x40b1: 0x000b, 0x40b2: 0x000b, 0x40b3: 0x000b, 0x40b4: 0x000b, 0x40b5: 0x000b, + 0x40b6: 0x000b, 0x40b7: 0x000b, 0x40b8: 0x000b, 0x40b9: 0x000b, 0x40ba: 0x000b, 0x40bb: 0x000b, + 0x40bc: 0x000b, 0x40bd: 0x000b, 0x40be: 0x000b, 0x40bf: 0x000b, +} + +// bidiIndex: 26 blocks, 1664 entries, 3328 bytes +// Block 0 is the zero block. +var bidiIndex = [1664]uint16{ + // Block 0x0, offset 0x0 + // Block 0x1, offset 0x40 + // Block 0x2, offset 0x80 + // Block 0x3, offset 0xc0 + 0xc2: 0x01, 0xc3: 0x02, + 0xca: 0x03, 0xcb: 0x04, 0xcc: 0x05, 0xcd: 0x06, 0xce: 0x07, 0xcf: 0x08, + 0xd2: 0x09, 0xd6: 0x0a, 0xd7: 0x0b, + 0xd8: 0x0c, 0xd9: 0x0d, 0xda: 0x0e, 0xdb: 0x0f, 0xdc: 0x10, 0xdd: 0x11, 0xde: 0x12, 0xdf: 0x13, + 0xe0: 0x02, 0xe1: 0x03, 0xe2: 0x04, 0xe3: 0x05, 0xe4: 0x06, + 0xea: 0x07, 0xef: 0x08, + 0xf0: 0x13, 0xf1: 0x14, 0xf2: 0x14, 0xf3: 0x16, 0xf4: 0x17, + // Block 0x4, offset 0x100 + 0x120: 0x14, 0x121: 0x15, 0x122: 0x16, 0x123: 0x17, 0x124: 0x18, 0x125: 0x19, 0x126: 0x1a, 0x127: 0x1b, + 0x128: 0x1c, 0x129: 0x1d, 0x12a: 0x1c, 0x12b: 0x1e, 0x12c: 0x1f, 0x12d: 0x20, 0x12e: 0x21, 0x12f: 0x22, + 0x130: 0x23, 0x131: 0x24, 0x132: 0x1a, 0x133: 0x25, 0x134: 0x26, 0x135: 0x27, 0x136: 0x28, 0x137: 0x29, + 0x138: 0x2a, 0x139: 0x2b, 0x13a: 0x2c, 0x13b: 0x2d, 0x13c: 0x2e, 0x13d: 0x2f, 0x13e: 0x30, 0x13f: 0x31, + // Block 0x5, offset 0x140 + 0x140: 0x32, 0x141: 0x33, 0x142: 0x34, + 0x14d: 0x35, 0x14e: 0x36, + 0x150: 0x37, + 0x15a: 0x38, 0x15c: 0x39, 0x15d: 0x3a, 0x15e: 0x3b, 0x15f: 0x3c, + 0x160: 0x3d, 0x162: 0x3e, 0x164: 0x3f, 0x165: 0x40, 0x167: 0x41, + 0x168: 0x42, 0x169: 0x43, 0x16a: 0x44, 0x16b: 0x45, 0x16c: 0x46, 0x16d: 0x47, 0x16e: 0x48, 0x16f: 0x49, + 0x170: 0x4a, 0x173: 0x4b, 0x177: 0x05, + 0x17e: 0x4c, 0x17f: 0x4d, + // Block 0x6, offset 0x180 + 0x180: 0x4e, 0x181: 0x4f, 0x182: 0x50, 0x183: 0x51, 0x184: 0x52, 0x185: 0x53, 0x186: 0x54, 0x187: 0x55, + 0x188: 0x56, 0x189: 0x55, 0x18a: 0x55, 0x18b: 0x55, 0x18c: 0x57, 0x18d: 0x58, 0x18e: 0x59, 0x18f: 0x55, + 0x190: 0x5a, 0x191: 0x5b, 0x192: 0x5c, 0x193: 0x5d, 0x194: 0x55, 0x195: 0x55, 0x196: 0x55, 0x197: 0x55, + 0x198: 0x55, 0x199: 0x55, 0x19a: 0x5e, 0x19b: 0x55, 0x19c: 0x55, 0x19d: 0x5f, 0x19e: 0x55, 0x19f: 0x60, + 0x1a4: 0x55, 0x1a5: 0x55, 0x1a6: 0x61, 0x1a7: 0x62, + 0x1a8: 0x55, 0x1a9: 0x55, 0x1aa: 0x55, 0x1ab: 0x55, 0x1ac: 0x55, 0x1ad: 0x63, 0x1ae: 0x64, 0x1af: 0x55, + 0x1b3: 0x65, 0x1b5: 0x66, 0x1b7: 0x67, + 0x1b8: 0x68, 0x1b9: 0x69, 0x1ba: 0x6a, 0x1bb: 0x6b, 0x1bc: 0x55, 0x1bd: 0x55, 0x1be: 0x55, 0x1bf: 0x6c, + // Block 0x7, offset 0x1c0 + 0x1c0: 0x6d, 0x1c2: 0x6e, 0x1c3: 0x6f, 0x1c7: 0x70, + 0x1c8: 0x71, 0x1c9: 0x72, 0x1ca: 0x73, 0x1cb: 0x74, 0x1cd: 0x75, 0x1cf: 0x76, + // Block 0x8, offset 0x200 + 0x237: 0x55, + // Block 0x9, offset 0x240 + 0x252: 0x77, 0x253: 0x78, + 0x258: 0x79, 0x259: 0x7a, 0x25a: 0x7b, 0x25b: 0x7c, 0x25c: 0x7d, 0x25e: 0x7e, + 0x260: 0x7f, 0x261: 0x80, 0x263: 0x81, 0x264: 0x82, 0x265: 0x83, 0x266: 0x84, 0x267: 0x85, + 0x268: 0x86, 0x269: 0x87, 0x26a: 0x88, 0x26b: 0x89, 0x26d: 0x8a, 0x26f: 0x8b, + // Block 0xa, offset 0x280 + 0x2ac: 0x8c, 0x2ad: 0x8d, 0x2ae: 0x0e, 0x2af: 0x0e, + 0x2b0: 0x0e, 0x2b1: 0x0e, 0x2b2: 0x0e, 0x2b3: 0x0e, 0x2b4: 0x8e, 0x2b5: 0x8f, 0x2b6: 0x0e, 0x2b7: 0x90, + 0x2b8: 0x91, 0x2b9: 0x92, 0x2ba: 0x0e, 0x2bb: 0x93, 0x2bc: 0x94, 0x2bd: 0x95, 0x2bf: 0x96, + // Block 0xb, offset 0x2c0 + 0x2c4: 0x97, 0x2c5: 0x55, 0x2c6: 0x98, 0x2c7: 0x99, + 0x2cb: 0x9a, 0x2cd: 0x9b, + 0x2e0: 0x9c, 0x2e1: 0x9c, 0x2e2: 0x9c, 0x2e3: 0x9c, 0x2e4: 0x9d, 0x2e5: 0x9c, 0x2e6: 0x9c, 0x2e7: 0x9c, + 0x2e8: 0x9e, 0x2e9: 0x9c, 0x2ea: 0x9c, 0x2eb: 0x9f, 0x2ec: 0xa0, 0x2ed: 0x9c, 0x2ee: 0x9c, 0x2ef: 0x9c, + 0x2f0: 0x9c, 0x2f1: 0x9c, 0x2f2: 0x9c, 0x2f3: 0x9c, 0x2f4: 0xa1, 0x2f5: 0x9c, 0x2f6: 0x9c, 0x2f7: 0x9c, + 0x2f8: 0x9c, 0x2f9: 0xa2, 0x2fa: 0xa3, 0x2fb: 0xa4, 0x2fc: 0xa5, 0x2fd: 0xa6, 0x2fe: 0xa7, 0x2ff: 0x9c, + // Block 0xc, offset 0x300 + 0x300: 0xa8, 0x301: 0xa9, 0x302: 0xaa, 0x303: 0x21, 0x304: 0xab, 0x305: 0xac, 0x306: 0xad, 0x307: 0xae, + 0x308: 0xaf, 0x309: 0x28, 0x30b: 0xb0, 0x30c: 0x26, 0x30d: 0xb1, + 0x310: 0xb2, 0x311: 0xb3, 0x312: 0xb4, 0x313: 0xb5, 0x316: 0xb6, 0x317: 0xb7, + 0x318: 0xb8, 0x319: 0xb9, 0x31a: 0xba, 0x31c: 0xbb, + 0x320: 0xbc, 0x324: 0xbd, 0x325: 0xbe, 0x327: 0xbf, + 0x328: 0xc0, 0x329: 0xc1, 0x32a: 0xc2, + 0x330: 0xc3, 0x332: 0xc4, 0x334: 0xc5, 0x335: 0xc6, 0x336: 0xc7, + 0x33b: 0xc8, 0x33c: 0xc9, 0x33d: 0xca, 0x33f: 0xcb, + // Block 0xd, offset 0x340 + 0x351: 0xcc, + // Block 0xe, offset 0x380 + 0x3ab: 0xcd, 0x3ac: 0xce, + 0x3bd: 0xcf, 0x3be: 0xd0, 0x3bf: 0xd1, + // Block 0xf, offset 0x3c0 + 0x3f2: 0xd2, + // Block 0x10, offset 0x400 + 0x43c: 0xd3, 0x43d: 0xd4, + // Block 0x11, offset 0x440 + 0x445: 0xd5, 0x446: 0xd6, 0x447: 0xd7, + 0x448: 0x55, 0x449: 0xd8, 0x44c: 0x55, 0x44d: 0xd9, + 0x45b: 0xda, 0x45c: 0xdb, 0x45d: 0xdc, 0x45e: 0xdd, 0x45f: 0xde, + 0x468: 0xdf, 0x469: 0xe0, 0x46a: 0xe1, + // Block 0x12, offset 0x480 + 0x480: 0xe2, 0x482: 0xcf, 0x484: 0xce, + 0x48a: 0xe3, 0x48b: 0xe4, + 0x493: 0xe5, + 0x4a0: 0x9c, 0x4a1: 0x9c, 0x4a2: 0x9c, 0x4a3: 0xe6, 0x4a4: 0x9c, 0x4a5: 0xe7, 0x4a6: 0x9c, 0x4a7: 0x9c, + 0x4a8: 0x9c, 0x4a9: 0x9c, 0x4aa: 0x9c, 0x4ab: 0x9c, 0x4ac: 0x9c, 0x4ad: 0x9c, 0x4ae: 0x9c, 0x4af: 0x9c, + 0x4b0: 0x9c, 0x4b1: 0xe8, 0x4b2: 0xe9, 0x4b3: 0x9c, 0x4b4: 0xea, 0x4b5: 0x9c, 0x4b6: 0x9c, 0x4b7: 0x9c, + 0x4b8: 0x0e, 0x4b9: 0x0e, 0x4ba: 0x0e, 0x4bb: 0xeb, 0x4bc: 0x9c, 0x4bd: 0x9c, 0x4be: 0x9c, 0x4bf: 0x9c, + // Block 0x13, offset 0x4c0 + 0x4c0: 0xec, 0x4c1: 0x55, 0x4c2: 0xed, 0x4c3: 0xee, 0x4c4: 0xef, 0x4c5: 0xf0, 0x4c6: 0xf1, + 0x4c9: 0xf2, 0x4cc: 0x55, 0x4cd: 0x55, 0x4ce: 0x55, 0x4cf: 0x55, + 0x4d0: 0x55, 0x4d1: 0x55, 0x4d2: 0x55, 0x4d3: 0x55, 0x4d4: 0x55, 0x4d5: 0x55, 0x4d6: 0x55, 0x4d7: 0x55, + 0x4d8: 0x55, 0x4d9: 0x55, 0x4da: 0x55, 0x4db: 0xf3, 0x4dc: 0x55, 0x4dd: 0xf4, 0x4de: 0x55, 0x4df: 0xf5, + 0x4e0: 0xf6, 0x4e1: 0xf7, 0x4e2: 0xf8, 0x4e4: 0x55, 0x4e5: 0x55, 0x4e6: 0x55, 0x4e7: 0x55, + 0x4e8: 0x55, 0x4e9: 0xf9, 0x4ea: 0xfa, 0x4eb: 0xfb, 0x4ec: 0x55, 0x4ed: 0x55, 0x4ee: 0xfc, 0x4ef: 0xfd, + 0x4ff: 0xfe, + // Block 0x14, offset 0x500 + 0x53f: 0xfe, + // Block 0x15, offset 0x540 + 0x550: 0x09, 0x551: 0x0a, 0x553: 0x0b, 0x556: 0x0c, + 0x55b: 0x0d, 0x55c: 0x0e, 0x55d: 0x0f, 0x55e: 0x10, 0x55f: 0x11, + 0x56f: 0x12, + 0x57f: 0x12, + // Block 0x16, offset 0x580 + 0x58f: 0x12, + 0x59f: 0x12, + 0x5af: 0x12, + 0x5bf: 0x12, + // Block 0x17, offset 0x5c0 + 0x5c0: 0xff, 0x5c1: 0xff, 0x5c2: 0xff, 0x5c3: 0xff, 0x5c4: 0x05, 0x5c5: 0x05, 0x5c6: 0x05, 0x5c7: 0x100, + 0x5c8: 0xff, 0x5c9: 0xff, 0x5ca: 0xff, 0x5cb: 0xff, 0x5cc: 0xff, 0x5cd: 0xff, 0x5ce: 0xff, 0x5cf: 0xff, + 0x5d0: 0xff, 0x5d1: 0xff, 0x5d2: 0xff, 0x5d3: 0xff, 0x5d4: 0xff, 0x5d5: 0xff, 0x5d6: 0xff, 0x5d7: 0xff, + 0x5d8: 0xff, 0x5d9: 0xff, 0x5da: 0xff, 0x5db: 0xff, 0x5dc: 0xff, 0x5dd: 0xff, 0x5de: 0xff, 0x5df: 0xff, + 0x5e0: 0xff, 0x5e1: 0xff, 0x5e2: 0xff, 0x5e3: 0xff, 0x5e4: 0xff, 0x5e5: 0xff, 0x5e6: 0xff, 0x5e7: 0xff, + 0x5e8: 0xff, 0x5e9: 0xff, 0x5ea: 0xff, 0x5eb: 0xff, 0x5ec: 0xff, 0x5ed: 0xff, 0x5ee: 0xff, 0x5ef: 0xff, + 0x5f0: 0xff, 0x5f1: 0xff, 0x5f2: 0xff, 0x5f3: 0xff, 0x5f4: 0xff, 0x5f5: 0xff, 0x5f6: 0xff, 0x5f7: 0xff, + 0x5f8: 0xff, 0x5f9: 0xff, 0x5fa: 0xff, 0x5fb: 0xff, 0x5fc: 0xff, 0x5fd: 0xff, 0x5fe: 0xff, 0x5ff: 0xff, + // Block 0x18, offset 0x600 + 0x60f: 0x12, + 0x61f: 0x12, + 0x620: 0x15, + 0x62f: 0x12, + 0x63f: 0x12, + // Block 0x19, offset 0x640 + 0x64f: 0x12, +} + +// Total table size 19960 bytes (19KiB); checksum: F50EF68C diff --git a/vendor/golang.org/x/text/unicode/norm/tables13.0.0.go b/vendor/golang.org/x/text/unicode/norm/tables13.0.0.go index 9115ef25..f65785e8 100644 --- a/vendor/golang.org/x/text/unicode/norm/tables13.0.0.go +++ b/vendor/golang.org/x/text/unicode/norm/tables13.0.0.go @@ -1,7 +1,7 @@ // Code generated by running "go generate" in golang.org/x/text. DO NOT EDIT. -//go:build go1.16 -// +build go1.16 +//go:build go1.16 && !go1.21 +// +build go1.16,!go1.21 package norm diff --git a/vendor/golang.org/x/text/unicode/norm/tables15.0.0.go b/vendor/golang.org/x/text/unicode/norm/tables15.0.0.go new file mode 100644 index 00000000..e1858b87 --- /dev/null +++ b/vendor/golang.org/x/text/unicode/norm/tables15.0.0.go @@ -0,0 +1,7908 @@ +// Code generated by running "go generate" in golang.org/x/text. DO NOT EDIT. + +//go:build go1.21 +// +build go1.21 + +package norm + +import "sync" + +const ( + // Version is the Unicode edition from which the tables are derived. + Version = "15.0.0" + + // MaxTransformChunkSize indicates the maximum number of bytes that Transform + // may need to write atomically for any Form. Making a destination buffer at + // least this size ensures that Transform can always make progress and that + // the user does not need to grow the buffer on an ErrShortDst. + MaxTransformChunkSize = 35 + maxNonStarters*4 +) + +var ccc = [56]uint8{ + 0, 1, 6, 7, 8, 9, 10, 11, + 12, 13, 14, 15, 16, 17, 18, 19, + 20, 21, 22, 23, 24, 25, 26, 27, + 28, 29, 30, 31, 32, 33, 34, 35, + 36, 84, 91, 103, 107, 118, 122, 129, + 130, 132, 202, 214, 216, 218, 220, 222, + 224, 226, 228, 230, 232, 233, 234, 240, +} + +const ( + firstMulti = 0x199A + firstCCC = 0x2DD5 + endMulti = 0x30A1 + firstLeadingCCC = 0x4AEF + firstCCCZeroExcept = 0x4BB9 + firstStarterWithNLead = 0x4BE0 + lastDecomp = 0x4BE2 + maxDecomp = 0x8000 +) + +// decomps: 19426 bytes +var decomps = [...]byte{ + // Bytes 0 - 3f + 0x00, 0x41, 0x20, 0x41, 0x21, 0x41, 0x22, 0x41, + 0x23, 0x41, 0x24, 0x41, 0x25, 0x41, 0x26, 0x41, + 0x27, 0x41, 0x28, 0x41, 0x29, 0x41, 0x2A, 0x41, + 0x2B, 0x41, 0x2C, 0x41, 0x2D, 0x41, 0x2E, 0x41, + 0x2F, 0x41, 0x30, 0x41, 0x31, 0x41, 0x32, 0x41, + 0x33, 0x41, 0x34, 0x41, 0x35, 0x41, 0x36, 0x41, + 0x37, 0x41, 0x38, 0x41, 0x39, 0x41, 0x3A, 0x41, + 0x3B, 0x41, 0x3C, 0x41, 0x3D, 0x41, 0x3E, 0x41, + // Bytes 40 - 7f + 0x3F, 0x41, 0x40, 0x41, 0x41, 0x41, 0x42, 0x41, + 0x43, 0x41, 0x44, 0x41, 0x45, 0x41, 0x46, 0x41, + 0x47, 0x41, 0x48, 0x41, 0x49, 0x41, 0x4A, 0x41, + 0x4B, 0x41, 0x4C, 0x41, 0x4D, 0x41, 0x4E, 0x41, + 0x4F, 0x41, 0x50, 0x41, 0x51, 0x41, 0x52, 0x41, + 0x53, 0x41, 0x54, 0x41, 0x55, 0x41, 0x56, 0x41, + 0x57, 0x41, 0x58, 0x41, 0x59, 0x41, 0x5A, 0x41, + 0x5B, 0x41, 0x5C, 0x41, 0x5D, 0x41, 0x5E, 0x41, + // Bytes 80 - bf + 0x5F, 0x41, 0x60, 0x41, 0x61, 0x41, 0x62, 0x41, + 0x63, 0x41, 0x64, 0x41, 0x65, 0x41, 0x66, 0x41, + 0x67, 0x41, 0x68, 0x41, 0x69, 0x41, 0x6A, 0x41, + 0x6B, 0x41, 0x6C, 0x41, 0x6D, 0x41, 0x6E, 0x41, + 0x6F, 0x41, 0x70, 0x41, 0x71, 0x41, 0x72, 0x41, + 0x73, 0x41, 0x74, 0x41, 0x75, 0x41, 0x76, 0x41, + 0x77, 0x41, 0x78, 0x41, 0x79, 0x41, 0x7A, 0x41, + 0x7B, 0x41, 0x7C, 0x41, 0x7D, 0x41, 0x7E, 0x42, + // Bytes c0 - ff + 0xC2, 0xA2, 0x42, 0xC2, 0xA3, 0x42, 0xC2, 0xA5, + 0x42, 0xC2, 0xA6, 0x42, 0xC2, 0xAC, 0x42, 0xC2, + 0xB7, 0x42, 0xC3, 0x86, 0x42, 0xC3, 0xA6, 0x42, + 0xC3, 0xB0, 0x42, 0xC3, 0xB8, 0x42, 0xC4, 0xA6, + 0x42, 0xC4, 0xA7, 0x42, 0xC4, 0xB1, 0x42, 0xC5, + 0x8B, 0x42, 0xC5, 0x93, 0x42, 0xC6, 0x8E, 0x42, + 0xC6, 0x90, 0x42, 0xC6, 0xAB, 0x42, 0xC7, 0x80, + 0x42, 0xC7, 0x81, 0x42, 0xC7, 0x82, 0x42, 0xC8, + // Bytes 100 - 13f + 0xA2, 0x42, 0xC8, 0xB7, 0x42, 0xC9, 0x90, 0x42, + 0xC9, 0x91, 0x42, 0xC9, 0x92, 0x42, 0xC9, 0x93, + 0x42, 0xC9, 0x94, 0x42, 0xC9, 0x95, 0x42, 0xC9, + 0x96, 0x42, 0xC9, 0x97, 0x42, 0xC9, 0x98, 0x42, + 0xC9, 0x99, 0x42, 0xC9, 0x9B, 0x42, 0xC9, 0x9C, + 0x42, 0xC9, 0x9E, 0x42, 0xC9, 0x9F, 0x42, 0xC9, + 0xA0, 0x42, 0xC9, 0xA1, 0x42, 0xC9, 0xA2, 0x42, + 0xC9, 0xA3, 0x42, 0xC9, 0xA4, 0x42, 0xC9, 0xA5, + // Bytes 140 - 17f + 0x42, 0xC9, 0xA6, 0x42, 0xC9, 0xA7, 0x42, 0xC9, + 0xA8, 0x42, 0xC9, 0xA9, 0x42, 0xC9, 0xAA, 0x42, + 0xC9, 0xAB, 0x42, 0xC9, 0xAC, 0x42, 0xC9, 0xAD, + 0x42, 0xC9, 0xAE, 0x42, 0xC9, 0xAF, 0x42, 0xC9, + 0xB0, 0x42, 0xC9, 0xB1, 0x42, 0xC9, 0xB2, 0x42, + 0xC9, 0xB3, 0x42, 0xC9, 0xB4, 0x42, 0xC9, 0xB5, + 0x42, 0xC9, 0xB6, 0x42, 0xC9, 0xB7, 0x42, 0xC9, + 0xB8, 0x42, 0xC9, 0xB9, 0x42, 0xC9, 0xBA, 0x42, + // Bytes 180 - 1bf + 0xC9, 0xBB, 0x42, 0xC9, 0xBD, 0x42, 0xC9, 0xBE, + 0x42, 0xCA, 0x80, 0x42, 0xCA, 0x81, 0x42, 0xCA, + 0x82, 0x42, 0xCA, 0x83, 0x42, 0xCA, 0x84, 0x42, + 0xCA, 0x88, 0x42, 0xCA, 0x89, 0x42, 0xCA, 0x8A, + 0x42, 0xCA, 0x8B, 0x42, 0xCA, 0x8C, 0x42, 0xCA, + 0x8D, 0x42, 0xCA, 0x8E, 0x42, 0xCA, 0x8F, 0x42, + 0xCA, 0x90, 0x42, 0xCA, 0x91, 0x42, 0xCA, 0x92, + 0x42, 0xCA, 0x95, 0x42, 0xCA, 0x98, 0x42, 0xCA, + // Bytes 1c0 - 1ff + 0x99, 0x42, 0xCA, 0x9B, 0x42, 0xCA, 0x9C, 0x42, + 0xCA, 0x9D, 0x42, 0xCA, 0x9F, 0x42, 0xCA, 0xA1, + 0x42, 0xCA, 0xA2, 0x42, 0xCA, 0xA3, 0x42, 0xCA, + 0xA4, 0x42, 0xCA, 0xA5, 0x42, 0xCA, 0xA6, 0x42, + 0xCA, 0xA7, 0x42, 0xCA, 0xA8, 0x42, 0xCA, 0xA9, + 0x42, 0xCA, 0xAA, 0x42, 0xCA, 0xAB, 0x42, 0xCA, + 0xB9, 0x42, 0xCB, 0x90, 0x42, 0xCB, 0x91, 0x42, + 0xCE, 0x91, 0x42, 0xCE, 0x92, 0x42, 0xCE, 0x93, + // Bytes 200 - 23f + 0x42, 0xCE, 0x94, 0x42, 0xCE, 0x95, 0x42, 0xCE, + 0x96, 0x42, 0xCE, 0x97, 0x42, 0xCE, 0x98, 0x42, + 0xCE, 0x99, 0x42, 0xCE, 0x9A, 0x42, 0xCE, 0x9B, + 0x42, 0xCE, 0x9C, 0x42, 0xCE, 0x9D, 0x42, 0xCE, + 0x9E, 0x42, 0xCE, 0x9F, 0x42, 0xCE, 0xA0, 0x42, + 0xCE, 0xA1, 0x42, 0xCE, 0xA3, 0x42, 0xCE, 0xA4, + 0x42, 0xCE, 0xA5, 0x42, 0xCE, 0xA6, 0x42, 0xCE, + 0xA7, 0x42, 0xCE, 0xA8, 0x42, 0xCE, 0xA9, 0x42, + // Bytes 240 - 27f + 0xCE, 0xB1, 0x42, 0xCE, 0xB2, 0x42, 0xCE, 0xB3, + 0x42, 0xCE, 0xB4, 0x42, 0xCE, 0xB5, 0x42, 0xCE, + 0xB6, 0x42, 0xCE, 0xB7, 0x42, 0xCE, 0xB8, 0x42, + 0xCE, 0xB9, 0x42, 0xCE, 0xBA, 0x42, 0xCE, 0xBB, + 0x42, 0xCE, 0xBC, 0x42, 0xCE, 0xBD, 0x42, 0xCE, + 0xBE, 0x42, 0xCE, 0xBF, 0x42, 0xCF, 0x80, 0x42, + 0xCF, 0x81, 0x42, 0xCF, 0x82, 0x42, 0xCF, 0x83, + 0x42, 0xCF, 0x84, 0x42, 0xCF, 0x85, 0x42, 0xCF, + // Bytes 280 - 2bf + 0x86, 0x42, 0xCF, 0x87, 0x42, 0xCF, 0x88, 0x42, + 0xCF, 0x89, 0x42, 0xCF, 0x9C, 0x42, 0xCF, 0x9D, + 0x42, 0xD0, 0xB0, 0x42, 0xD0, 0xB1, 0x42, 0xD0, + 0xB2, 0x42, 0xD0, 0xB3, 0x42, 0xD0, 0xB4, 0x42, + 0xD0, 0xB5, 0x42, 0xD0, 0xB6, 0x42, 0xD0, 0xB7, + 0x42, 0xD0, 0xB8, 0x42, 0xD0, 0xBA, 0x42, 0xD0, + 0xBB, 0x42, 0xD0, 0xBC, 0x42, 0xD0, 0xBD, 0x42, + 0xD0, 0xBE, 0x42, 0xD0, 0xBF, 0x42, 0xD1, 0x80, + // Bytes 2c0 - 2ff + 0x42, 0xD1, 0x81, 0x42, 0xD1, 0x82, 0x42, 0xD1, + 0x83, 0x42, 0xD1, 0x84, 0x42, 0xD1, 0x85, 0x42, + 0xD1, 0x86, 0x42, 0xD1, 0x87, 0x42, 0xD1, 0x88, + 0x42, 0xD1, 0x8A, 0x42, 0xD1, 0x8B, 0x42, 0xD1, + 0x8C, 0x42, 0xD1, 0x8D, 0x42, 0xD1, 0x8E, 0x42, + 0xD1, 0x95, 0x42, 0xD1, 0x96, 0x42, 0xD1, 0x98, + 0x42, 0xD1, 0x9F, 0x42, 0xD2, 0x91, 0x42, 0xD2, + 0xAB, 0x42, 0xD2, 0xAF, 0x42, 0xD2, 0xB1, 0x42, + // Bytes 300 - 33f + 0xD3, 0x8F, 0x42, 0xD3, 0x99, 0x42, 0xD3, 0xA9, + 0x42, 0xD7, 0x90, 0x42, 0xD7, 0x91, 0x42, 0xD7, + 0x92, 0x42, 0xD7, 0x93, 0x42, 0xD7, 0x94, 0x42, + 0xD7, 0x9B, 0x42, 0xD7, 0x9C, 0x42, 0xD7, 0x9D, + 0x42, 0xD7, 0xA2, 0x42, 0xD7, 0xA8, 0x42, 0xD7, + 0xAA, 0x42, 0xD8, 0xA1, 0x42, 0xD8, 0xA7, 0x42, + 0xD8, 0xA8, 0x42, 0xD8, 0xA9, 0x42, 0xD8, 0xAA, + 0x42, 0xD8, 0xAB, 0x42, 0xD8, 0xAC, 0x42, 0xD8, + // Bytes 340 - 37f + 0xAD, 0x42, 0xD8, 0xAE, 0x42, 0xD8, 0xAF, 0x42, + 0xD8, 0xB0, 0x42, 0xD8, 0xB1, 0x42, 0xD8, 0xB2, + 0x42, 0xD8, 0xB3, 0x42, 0xD8, 0xB4, 0x42, 0xD8, + 0xB5, 0x42, 0xD8, 0xB6, 0x42, 0xD8, 0xB7, 0x42, + 0xD8, 0xB8, 0x42, 0xD8, 0xB9, 0x42, 0xD8, 0xBA, + 0x42, 0xD9, 0x81, 0x42, 0xD9, 0x82, 0x42, 0xD9, + 0x83, 0x42, 0xD9, 0x84, 0x42, 0xD9, 0x85, 0x42, + 0xD9, 0x86, 0x42, 0xD9, 0x87, 0x42, 0xD9, 0x88, + // Bytes 380 - 3bf + 0x42, 0xD9, 0x89, 0x42, 0xD9, 0x8A, 0x42, 0xD9, + 0xAE, 0x42, 0xD9, 0xAF, 0x42, 0xD9, 0xB1, 0x42, + 0xD9, 0xB9, 0x42, 0xD9, 0xBA, 0x42, 0xD9, 0xBB, + 0x42, 0xD9, 0xBE, 0x42, 0xD9, 0xBF, 0x42, 0xDA, + 0x80, 0x42, 0xDA, 0x83, 0x42, 0xDA, 0x84, 0x42, + 0xDA, 0x86, 0x42, 0xDA, 0x87, 0x42, 0xDA, 0x88, + 0x42, 0xDA, 0x8C, 0x42, 0xDA, 0x8D, 0x42, 0xDA, + 0x8E, 0x42, 0xDA, 0x91, 0x42, 0xDA, 0x98, 0x42, + // Bytes 3c0 - 3ff + 0xDA, 0xA1, 0x42, 0xDA, 0xA4, 0x42, 0xDA, 0xA6, + 0x42, 0xDA, 0xA9, 0x42, 0xDA, 0xAD, 0x42, 0xDA, + 0xAF, 0x42, 0xDA, 0xB1, 0x42, 0xDA, 0xB3, 0x42, + 0xDA, 0xBA, 0x42, 0xDA, 0xBB, 0x42, 0xDA, 0xBE, + 0x42, 0xDB, 0x81, 0x42, 0xDB, 0x85, 0x42, 0xDB, + 0x86, 0x42, 0xDB, 0x87, 0x42, 0xDB, 0x88, 0x42, + 0xDB, 0x89, 0x42, 0xDB, 0x8B, 0x42, 0xDB, 0x8C, + 0x42, 0xDB, 0x90, 0x42, 0xDB, 0x92, 0x43, 0xE0, + // Bytes 400 - 43f + 0xBC, 0x8B, 0x43, 0xE1, 0x83, 0x9C, 0x43, 0xE1, + 0x84, 0x80, 0x43, 0xE1, 0x84, 0x81, 0x43, 0xE1, + 0x84, 0x82, 0x43, 0xE1, 0x84, 0x83, 0x43, 0xE1, + 0x84, 0x84, 0x43, 0xE1, 0x84, 0x85, 0x43, 0xE1, + 0x84, 0x86, 0x43, 0xE1, 0x84, 0x87, 0x43, 0xE1, + 0x84, 0x88, 0x43, 0xE1, 0x84, 0x89, 0x43, 0xE1, + 0x84, 0x8A, 0x43, 0xE1, 0x84, 0x8B, 0x43, 0xE1, + 0x84, 0x8C, 0x43, 0xE1, 0x84, 0x8D, 0x43, 0xE1, + // Bytes 440 - 47f + 0x84, 0x8E, 0x43, 0xE1, 0x84, 0x8F, 0x43, 0xE1, + 0x84, 0x90, 0x43, 0xE1, 0x84, 0x91, 0x43, 0xE1, + 0x84, 0x92, 0x43, 0xE1, 0x84, 0x94, 0x43, 0xE1, + 0x84, 0x95, 0x43, 0xE1, 0x84, 0x9A, 0x43, 0xE1, + 0x84, 0x9C, 0x43, 0xE1, 0x84, 0x9D, 0x43, 0xE1, + 0x84, 0x9E, 0x43, 0xE1, 0x84, 0xA0, 0x43, 0xE1, + 0x84, 0xA1, 0x43, 0xE1, 0x84, 0xA2, 0x43, 0xE1, + 0x84, 0xA3, 0x43, 0xE1, 0x84, 0xA7, 0x43, 0xE1, + // Bytes 480 - 4bf + 0x84, 0xA9, 0x43, 0xE1, 0x84, 0xAB, 0x43, 0xE1, + 0x84, 0xAC, 0x43, 0xE1, 0x84, 0xAD, 0x43, 0xE1, + 0x84, 0xAE, 0x43, 0xE1, 0x84, 0xAF, 0x43, 0xE1, + 0x84, 0xB2, 0x43, 0xE1, 0x84, 0xB6, 0x43, 0xE1, + 0x85, 0x80, 0x43, 0xE1, 0x85, 0x87, 0x43, 0xE1, + 0x85, 0x8C, 0x43, 0xE1, 0x85, 0x97, 0x43, 0xE1, + 0x85, 0x98, 0x43, 0xE1, 0x85, 0x99, 0x43, 0xE1, + 0x85, 0xA0, 0x43, 0xE1, 0x86, 0x84, 0x43, 0xE1, + // Bytes 4c0 - 4ff + 0x86, 0x85, 0x43, 0xE1, 0x86, 0x88, 0x43, 0xE1, + 0x86, 0x91, 0x43, 0xE1, 0x86, 0x92, 0x43, 0xE1, + 0x86, 0x94, 0x43, 0xE1, 0x86, 0x9E, 0x43, 0xE1, + 0x86, 0xA1, 0x43, 0xE1, 0x87, 0x87, 0x43, 0xE1, + 0x87, 0x88, 0x43, 0xE1, 0x87, 0x8C, 0x43, 0xE1, + 0x87, 0x8E, 0x43, 0xE1, 0x87, 0x93, 0x43, 0xE1, + 0x87, 0x97, 0x43, 0xE1, 0x87, 0x99, 0x43, 0xE1, + 0x87, 0x9D, 0x43, 0xE1, 0x87, 0x9F, 0x43, 0xE1, + // Bytes 500 - 53f + 0x87, 0xB1, 0x43, 0xE1, 0x87, 0xB2, 0x43, 0xE1, + 0xB4, 0x82, 0x43, 0xE1, 0xB4, 0x96, 0x43, 0xE1, + 0xB4, 0x97, 0x43, 0xE1, 0xB4, 0x9C, 0x43, 0xE1, + 0xB4, 0x9D, 0x43, 0xE1, 0xB4, 0xA5, 0x43, 0xE1, + 0xB5, 0xBB, 0x43, 0xE1, 0xB6, 0x85, 0x43, 0xE1, + 0xB6, 0x91, 0x43, 0xE2, 0x80, 0x82, 0x43, 0xE2, + 0x80, 0x83, 0x43, 0xE2, 0x80, 0x90, 0x43, 0xE2, + 0x80, 0x93, 0x43, 0xE2, 0x80, 0x94, 0x43, 0xE2, + // Bytes 540 - 57f + 0x82, 0xA9, 0x43, 0xE2, 0x86, 0x90, 0x43, 0xE2, + 0x86, 0x91, 0x43, 0xE2, 0x86, 0x92, 0x43, 0xE2, + 0x86, 0x93, 0x43, 0xE2, 0x88, 0x82, 0x43, 0xE2, + 0x88, 0x87, 0x43, 0xE2, 0x88, 0x91, 0x43, 0xE2, + 0x88, 0x92, 0x43, 0xE2, 0x94, 0x82, 0x43, 0xE2, + 0x96, 0xA0, 0x43, 0xE2, 0x97, 0x8B, 0x43, 0xE2, + 0xA6, 0x85, 0x43, 0xE2, 0xA6, 0x86, 0x43, 0xE2, + 0xB1, 0xB1, 0x43, 0xE2, 0xB5, 0xA1, 0x43, 0xE3, + // Bytes 580 - 5bf + 0x80, 0x81, 0x43, 0xE3, 0x80, 0x82, 0x43, 0xE3, + 0x80, 0x88, 0x43, 0xE3, 0x80, 0x89, 0x43, 0xE3, + 0x80, 0x8A, 0x43, 0xE3, 0x80, 0x8B, 0x43, 0xE3, + 0x80, 0x8C, 0x43, 0xE3, 0x80, 0x8D, 0x43, 0xE3, + 0x80, 0x8E, 0x43, 0xE3, 0x80, 0x8F, 0x43, 0xE3, + 0x80, 0x90, 0x43, 0xE3, 0x80, 0x91, 0x43, 0xE3, + 0x80, 0x92, 0x43, 0xE3, 0x80, 0x94, 0x43, 0xE3, + 0x80, 0x95, 0x43, 0xE3, 0x80, 0x96, 0x43, 0xE3, + // Bytes 5c0 - 5ff + 0x80, 0x97, 0x43, 0xE3, 0x82, 0xA1, 0x43, 0xE3, + 0x82, 0xA2, 0x43, 0xE3, 0x82, 0xA3, 0x43, 0xE3, + 0x82, 0xA4, 0x43, 0xE3, 0x82, 0xA5, 0x43, 0xE3, + 0x82, 0xA6, 0x43, 0xE3, 0x82, 0xA7, 0x43, 0xE3, + 0x82, 0xA8, 0x43, 0xE3, 0x82, 0xA9, 0x43, 0xE3, + 0x82, 0xAA, 0x43, 0xE3, 0x82, 0xAB, 0x43, 0xE3, + 0x82, 0xAD, 0x43, 0xE3, 0x82, 0xAF, 0x43, 0xE3, + 0x82, 0xB1, 0x43, 0xE3, 0x82, 0xB3, 0x43, 0xE3, + // Bytes 600 - 63f + 0x82, 0xB5, 0x43, 0xE3, 0x82, 0xB7, 0x43, 0xE3, + 0x82, 0xB9, 0x43, 0xE3, 0x82, 0xBB, 0x43, 0xE3, + 0x82, 0xBD, 0x43, 0xE3, 0x82, 0xBF, 0x43, 0xE3, + 0x83, 0x81, 0x43, 0xE3, 0x83, 0x83, 0x43, 0xE3, + 0x83, 0x84, 0x43, 0xE3, 0x83, 0x86, 0x43, 0xE3, + 0x83, 0x88, 0x43, 0xE3, 0x83, 0x8A, 0x43, 0xE3, + 0x83, 0x8B, 0x43, 0xE3, 0x83, 0x8C, 0x43, 0xE3, + 0x83, 0x8D, 0x43, 0xE3, 0x83, 0x8E, 0x43, 0xE3, + // Bytes 640 - 67f + 0x83, 0x8F, 0x43, 0xE3, 0x83, 0x92, 0x43, 0xE3, + 0x83, 0x95, 0x43, 0xE3, 0x83, 0x98, 0x43, 0xE3, + 0x83, 0x9B, 0x43, 0xE3, 0x83, 0x9E, 0x43, 0xE3, + 0x83, 0x9F, 0x43, 0xE3, 0x83, 0xA0, 0x43, 0xE3, + 0x83, 0xA1, 0x43, 0xE3, 0x83, 0xA2, 0x43, 0xE3, + 0x83, 0xA3, 0x43, 0xE3, 0x83, 0xA4, 0x43, 0xE3, + 0x83, 0xA5, 0x43, 0xE3, 0x83, 0xA6, 0x43, 0xE3, + 0x83, 0xA7, 0x43, 0xE3, 0x83, 0xA8, 0x43, 0xE3, + // Bytes 680 - 6bf + 0x83, 0xA9, 0x43, 0xE3, 0x83, 0xAA, 0x43, 0xE3, + 0x83, 0xAB, 0x43, 0xE3, 0x83, 0xAC, 0x43, 0xE3, + 0x83, 0xAD, 0x43, 0xE3, 0x83, 0xAF, 0x43, 0xE3, + 0x83, 0xB0, 0x43, 0xE3, 0x83, 0xB1, 0x43, 0xE3, + 0x83, 0xB2, 0x43, 0xE3, 0x83, 0xB3, 0x43, 0xE3, + 0x83, 0xBB, 0x43, 0xE3, 0x83, 0xBC, 0x43, 0xE3, + 0x92, 0x9E, 0x43, 0xE3, 0x92, 0xB9, 0x43, 0xE3, + 0x92, 0xBB, 0x43, 0xE3, 0x93, 0x9F, 0x43, 0xE3, + // Bytes 6c0 - 6ff + 0x94, 0x95, 0x43, 0xE3, 0x9B, 0xAE, 0x43, 0xE3, + 0x9B, 0xBC, 0x43, 0xE3, 0x9E, 0x81, 0x43, 0xE3, + 0xA0, 0xAF, 0x43, 0xE3, 0xA1, 0xA2, 0x43, 0xE3, + 0xA1, 0xBC, 0x43, 0xE3, 0xA3, 0x87, 0x43, 0xE3, + 0xA3, 0xA3, 0x43, 0xE3, 0xA4, 0x9C, 0x43, 0xE3, + 0xA4, 0xBA, 0x43, 0xE3, 0xA8, 0xAE, 0x43, 0xE3, + 0xA9, 0xAC, 0x43, 0xE3, 0xAB, 0xA4, 0x43, 0xE3, + 0xAC, 0x88, 0x43, 0xE3, 0xAC, 0x99, 0x43, 0xE3, + // Bytes 700 - 73f + 0xAD, 0x89, 0x43, 0xE3, 0xAE, 0x9D, 0x43, 0xE3, + 0xB0, 0x98, 0x43, 0xE3, 0xB1, 0x8E, 0x43, 0xE3, + 0xB4, 0xB3, 0x43, 0xE3, 0xB6, 0x96, 0x43, 0xE3, + 0xBA, 0xAC, 0x43, 0xE3, 0xBA, 0xB8, 0x43, 0xE3, + 0xBC, 0x9B, 0x43, 0xE3, 0xBF, 0xBC, 0x43, 0xE4, + 0x80, 0x88, 0x43, 0xE4, 0x80, 0x98, 0x43, 0xE4, + 0x80, 0xB9, 0x43, 0xE4, 0x81, 0x86, 0x43, 0xE4, + 0x82, 0x96, 0x43, 0xE4, 0x83, 0xA3, 0x43, 0xE4, + // Bytes 740 - 77f + 0x84, 0xAF, 0x43, 0xE4, 0x88, 0x82, 0x43, 0xE4, + 0x88, 0xA7, 0x43, 0xE4, 0x8A, 0xA0, 0x43, 0xE4, + 0x8C, 0x81, 0x43, 0xE4, 0x8C, 0xB4, 0x43, 0xE4, + 0x8D, 0x99, 0x43, 0xE4, 0x8F, 0x95, 0x43, 0xE4, + 0x8F, 0x99, 0x43, 0xE4, 0x90, 0x8B, 0x43, 0xE4, + 0x91, 0xAB, 0x43, 0xE4, 0x94, 0xAB, 0x43, 0xE4, + 0x95, 0x9D, 0x43, 0xE4, 0x95, 0xA1, 0x43, 0xE4, + 0x95, 0xAB, 0x43, 0xE4, 0x97, 0x97, 0x43, 0xE4, + // Bytes 780 - 7bf + 0x97, 0xB9, 0x43, 0xE4, 0x98, 0xB5, 0x43, 0xE4, + 0x9A, 0xBE, 0x43, 0xE4, 0x9B, 0x87, 0x43, 0xE4, + 0xA6, 0x95, 0x43, 0xE4, 0xA7, 0xA6, 0x43, 0xE4, + 0xA9, 0xAE, 0x43, 0xE4, 0xA9, 0xB6, 0x43, 0xE4, + 0xAA, 0xB2, 0x43, 0xE4, 0xAC, 0xB3, 0x43, 0xE4, + 0xAF, 0x8E, 0x43, 0xE4, 0xB3, 0x8E, 0x43, 0xE4, + 0xB3, 0xAD, 0x43, 0xE4, 0xB3, 0xB8, 0x43, 0xE4, + 0xB5, 0x96, 0x43, 0xE4, 0xB8, 0x80, 0x43, 0xE4, + // Bytes 7c0 - 7ff + 0xB8, 0x81, 0x43, 0xE4, 0xB8, 0x83, 0x43, 0xE4, + 0xB8, 0x89, 0x43, 0xE4, 0xB8, 0x8A, 0x43, 0xE4, + 0xB8, 0x8B, 0x43, 0xE4, 0xB8, 0x8D, 0x43, 0xE4, + 0xB8, 0x99, 0x43, 0xE4, 0xB8, 0xA6, 0x43, 0xE4, + 0xB8, 0xA8, 0x43, 0xE4, 0xB8, 0xAD, 0x43, 0xE4, + 0xB8, 0xB2, 0x43, 0xE4, 0xB8, 0xB6, 0x43, 0xE4, + 0xB8, 0xB8, 0x43, 0xE4, 0xB8, 0xB9, 0x43, 0xE4, + 0xB8, 0xBD, 0x43, 0xE4, 0xB8, 0xBF, 0x43, 0xE4, + // Bytes 800 - 83f + 0xB9, 0x81, 0x43, 0xE4, 0xB9, 0x99, 0x43, 0xE4, + 0xB9, 0x9D, 0x43, 0xE4, 0xBA, 0x82, 0x43, 0xE4, + 0xBA, 0x85, 0x43, 0xE4, 0xBA, 0x86, 0x43, 0xE4, + 0xBA, 0x8C, 0x43, 0xE4, 0xBA, 0x94, 0x43, 0xE4, + 0xBA, 0xA0, 0x43, 0xE4, 0xBA, 0xA4, 0x43, 0xE4, + 0xBA, 0xAE, 0x43, 0xE4, 0xBA, 0xBA, 0x43, 0xE4, + 0xBB, 0x80, 0x43, 0xE4, 0xBB, 0x8C, 0x43, 0xE4, + 0xBB, 0xA4, 0x43, 0xE4, 0xBC, 0x81, 0x43, 0xE4, + // Bytes 840 - 87f + 0xBC, 0x91, 0x43, 0xE4, 0xBD, 0xA0, 0x43, 0xE4, + 0xBE, 0x80, 0x43, 0xE4, 0xBE, 0x86, 0x43, 0xE4, + 0xBE, 0x8B, 0x43, 0xE4, 0xBE, 0xAE, 0x43, 0xE4, + 0xBE, 0xBB, 0x43, 0xE4, 0xBE, 0xBF, 0x43, 0xE5, + 0x80, 0x82, 0x43, 0xE5, 0x80, 0xAB, 0x43, 0xE5, + 0x81, 0xBA, 0x43, 0xE5, 0x82, 0x99, 0x43, 0xE5, + 0x83, 0x8F, 0x43, 0xE5, 0x83, 0x9A, 0x43, 0xE5, + 0x83, 0xA7, 0x43, 0xE5, 0x84, 0xAA, 0x43, 0xE5, + // Bytes 880 - 8bf + 0x84, 0xBF, 0x43, 0xE5, 0x85, 0x80, 0x43, 0xE5, + 0x85, 0x85, 0x43, 0xE5, 0x85, 0x8D, 0x43, 0xE5, + 0x85, 0x94, 0x43, 0xE5, 0x85, 0xA4, 0x43, 0xE5, + 0x85, 0xA5, 0x43, 0xE5, 0x85, 0xA7, 0x43, 0xE5, + 0x85, 0xA8, 0x43, 0xE5, 0x85, 0xA9, 0x43, 0xE5, + 0x85, 0xAB, 0x43, 0xE5, 0x85, 0xAD, 0x43, 0xE5, + 0x85, 0xB7, 0x43, 0xE5, 0x86, 0x80, 0x43, 0xE5, + 0x86, 0x82, 0x43, 0xE5, 0x86, 0x8D, 0x43, 0xE5, + // Bytes 8c0 - 8ff + 0x86, 0x92, 0x43, 0xE5, 0x86, 0x95, 0x43, 0xE5, + 0x86, 0x96, 0x43, 0xE5, 0x86, 0x97, 0x43, 0xE5, + 0x86, 0x99, 0x43, 0xE5, 0x86, 0xA4, 0x43, 0xE5, + 0x86, 0xAB, 0x43, 0xE5, 0x86, 0xAC, 0x43, 0xE5, + 0x86, 0xB5, 0x43, 0xE5, 0x86, 0xB7, 0x43, 0xE5, + 0x87, 0x89, 0x43, 0xE5, 0x87, 0x8C, 0x43, 0xE5, + 0x87, 0x9C, 0x43, 0xE5, 0x87, 0x9E, 0x43, 0xE5, + 0x87, 0xA0, 0x43, 0xE5, 0x87, 0xB5, 0x43, 0xE5, + // Bytes 900 - 93f + 0x88, 0x80, 0x43, 0xE5, 0x88, 0x83, 0x43, 0xE5, + 0x88, 0x87, 0x43, 0xE5, 0x88, 0x97, 0x43, 0xE5, + 0x88, 0x9D, 0x43, 0xE5, 0x88, 0xA9, 0x43, 0xE5, + 0x88, 0xBA, 0x43, 0xE5, 0x88, 0xBB, 0x43, 0xE5, + 0x89, 0x86, 0x43, 0xE5, 0x89, 0x8D, 0x43, 0xE5, + 0x89, 0xB2, 0x43, 0xE5, 0x89, 0xB7, 0x43, 0xE5, + 0x8A, 0x89, 0x43, 0xE5, 0x8A, 0x9B, 0x43, 0xE5, + 0x8A, 0xA3, 0x43, 0xE5, 0x8A, 0xB3, 0x43, 0xE5, + // Bytes 940 - 97f + 0x8A, 0xB4, 0x43, 0xE5, 0x8B, 0x87, 0x43, 0xE5, + 0x8B, 0x89, 0x43, 0xE5, 0x8B, 0x92, 0x43, 0xE5, + 0x8B, 0x9E, 0x43, 0xE5, 0x8B, 0xA4, 0x43, 0xE5, + 0x8B, 0xB5, 0x43, 0xE5, 0x8B, 0xB9, 0x43, 0xE5, + 0x8B, 0xBA, 0x43, 0xE5, 0x8C, 0x85, 0x43, 0xE5, + 0x8C, 0x86, 0x43, 0xE5, 0x8C, 0x95, 0x43, 0xE5, + 0x8C, 0x97, 0x43, 0xE5, 0x8C, 0x9A, 0x43, 0xE5, + 0x8C, 0xB8, 0x43, 0xE5, 0x8C, 0xBB, 0x43, 0xE5, + // Bytes 980 - 9bf + 0x8C, 0xBF, 0x43, 0xE5, 0x8D, 0x81, 0x43, 0xE5, + 0x8D, 0x84, 0x43, 0xE5, 0x8D, 0x85, 0x43, 0xE5, + 0x8D, 0x89, 0x43, 0xE5, 0x8D, 0x91, 0x43, 0xE5, + 0x8D, 0x94, 0x43, 0xE5, 0x8D, 0x9A, 0x43, 0xE5, + 0x8D, 0x9C, 0x43, 0xE5, 0x8D, 0xA9, 0x43, 0xE5, + 0x8D, 0xB0, 0x43, 0xE5, 0x8D, 0xB3, 0x43, 0xE5, + 0x8D, 0xB5, 0x43, 0xE5, 0x8D, 0xBD, 0x43, 0xE5, + 0x8D, 0xBF, 0x43, 0xE5, 0x8E, 0x82, 0x43, 0xE5, + // Bytes 9c0 - 9ff + 0x8E, 0xB6, 0x43, 0xE5, 0x8F, 0x83, 0x43, 0xE5, + 0x8F, 0x88, 0x43, 0xE5, 0x8F, 0x8A, 0x43, 0xE5, + 0x8F, 0x8C, 0x43, 0xE5, 0x8F, 0x9F, 0x43, 0xE5, + 0x8F, 0xA3, 0x43, 0xE5, 0x8F, 0xA5, 0x43, 0xE5, + 0x8F, 0xAB, 0x43, 0xE5, 0x8F, 0xAF, 0x43, 0xE5, + 0x8F, 0xB1, 0x43, 0xE5, 0x8F, 0xB3, 0x43, 0xE5, + 0x90, 0x86, 0x43, 0xE5, 0x90, 0x88, 0x43, 0xE5, + 0x90, 0x8D, 0x43, 0xE5, 0x90, 0x8F, 0x43, 0xE5, + // Bytes a00 - a3f + 0x90, 0x9D, 0x43, 0xE5, 0x90, 0xB8, 0x43, 0xE5, + 0x90, 0xB9, 0x43, 0xE5, 0x91, 0x82, 0x43, 0xE5, + 0x91, 0x88, 0x43, 0xE5, 0x91, 0xA8, 0x43, 0xE5, + 0x92, 0x9E, 0x43, 0xE5, 0x92, 0xA2, 0x43, 0xE5, + 0x92, 0xBD, 0x43, 0xE5, 0x93, 0xB6, 0x43, 0xE5, + 0x94, 0x90, 0x43, 0xE5, 0x95, 0x8F, 0x43, 0xE5, + 0x95, 0x93, 0x43, 0xE5, 0x95, 0x95, 0x43, 0xE5, + 0x95, 0xA3, 0x43, 0xE5, 0x96, 0x84, 0x43, 0xE5, + // Bytes a40 - a7f + 0x96, 0x87, 0x43, 0xE5, 0x96, 0x99, 0x43, 0xE5, + 0x96, 0x9D, 0x43, 0xE5, 0x96, 0xAB, 0x43, 0xE5, + 0x96, 0xB3, 0x43, 0xE5, 0x96, 0xB6, 0x43, 0xE5, + 0x97, 0x80, 0x43, 0xE5, 0x97, 0x82, 0x43, 0xE5, + 0x97, 0xA2, 0x43, 0xE5, 0x98, 0x86, 0x43, 0xE5, + 0x99, 0x91, 0x43, 0xE5, 0x99, 0xA8, 0x43, 0xE5, + 0x99, 0xB4, 0x43, 0xE5, 0x9B, 0x97, 0x43, 0xE5, + 0x9B, 0x9B, 0x43, 0xE5, 0x9B, 0xB9, 0x43, 0xE5, + // Bytes a80 - abf + 0x9C, 0x96, 0x43, 0xE5, 0x9C, 0x97, 0x43, 0xE5, + 0x9C, 0x9F, 0x43, 0xE5, 0x9C, 0xB0, 0x43, 0xE5, + 0x9E, 0x8B, 0x43, 0xE5, 0x9F, 0x8E, 0x43, 0xE5, + 0x9F, 0xB4, 0x43, 0xE5, 0xA0, 0x8D, 0x43, 0xE5, + 0xA0, 0xB1, 0x43, 0xE5, 0xA0, 0xB2, 0x43, 0xE5, + 0xA1, 0x80, 0x43, 0xE5, 0xA1, 0x9A, 0x43, 0xE5, + 0xA1, 0x9E, 0x43, 0xE5, 0xA2, 0xA8, 0x43, 0xE5, + 0xA2, 0xAC, 0x43, 0xE5, 0xA2, 0xB3, 0x43, 0xE5, + // Bytes ac0 - aff + 0xA3, 0x98, 0x43, 0xE5, 0xA3, 0x9F, 0x43, 0xE5, + 0xA3, 0xAB, 0x43, 0xE5, 0xA3, 0xAE, 0x43, 0xE5, + 0xA3, 0xB0, 0x43, 0xE5, 0xA3, 0xB2, 0x43, 0xE5, + 0xA3, 0xB7, 0x43, 0xE5, 0xA4, 0x82, 0x43, 0xE5, + 0xA4, 0x86, 0x43, 0xE5, 0xA4, 0x8A, 0x43, 0xE5, + 0xA4, 0x95, 0x43, 0xE5, 0xA4, 0x9A, 0x43, 0xE5, + 0xA4, 0x9C, 0x43, 0xE5, 0xA4, 0xA2, 0x43, 0xE5, + 0xA4, 0xA7, 0x43, 0xE5, 0xA4, 0xA9, 0x43, 0xE5, + // Bytes b00 - b3f + 0xA5, 0x84, 0x43, 0xE5, 0xA5, 0x88, 0x43, 0xE5, + 0xA5, 0x91, 0x43, 0xE5, 0xA5, 0x94, 0x43, 0xE5, + 0xA5, 0xA2, 0x43, 0xE5, 0xA5, 0xB3, 0x43, 0xE5, + 0xA7, 0x98, 0x43, 0xE5, 0xA7, 0xAC, 0x43, 0xE5, + 0xA8, 0x9B, 0x43, 0xE5, 0xA8, 0xA7, 0x43, 0xE5, + 0xA9, 0xA2, 0x43, 0xE5, 0xA9, 0xA6, 0x43, 0xE5, + 0xAA, 0xB5, 0x43, 0xE5, 0xAC, 0x88, 0x43, 0xE5, + 0xAC, 0xA8, 0x43, 0xE5, 0xAC, 0xBE, 0x43, 0xE5, + // Bytes b40 - b7f + 0xAD, 0x90, 0x43, 0xE5, 0xAD, 0x97, 0x43, 0xE5, + 0xAD, 0xA6, 0x43, 0xE5, 0xAE, 0x80, 0x43, 0xE5, + 0xAE, 0x85, 0x43, 0xE5, 0xAE, 0x97, 0x43, 0xE5, + 0xAF, 0x83, 0x43, 0xE5, 0xAF, 0x98, 0x43, 0xE5, + 0xAF, 0xA7, 0x43, 0xE5, 0xAF, 0xAE, 0x43, 0xE5, + 0xAF, 0xB3, 0x43, 0xE5, 0xAF, 0xB8, 0x43, 0xE5, + 0xAF, 0xBF, 0x43, 0xE5, 0xB0, 0x86, 0x43, 0xE5, + 0xB0, 0x8F, 0x43, 0xE5, 0xB0, 0xA2, 0x43, 0xE5, + // Bytes b80 - bbf + 0xB0, 0xB8, 0x43, 0xE5, 0xB0, 0xBF, 0x43, 0xE5, + 0xB1, 0xA0, 0x43, 0xE5, 0xB1, 0xA2, 0x43, 0xE5, + 0xB1, 0xA4, 0x43, 0xE5, 0xB1, 0xA5, 0x43, 0xE5, + 0xB1, 0xAE, 0x43, 0xE5, 0xB1, 0xB1, 0x43, 0xE5, + 0xB2, 0x8D, 0x43, 0xE5, 0xB3, 0x80, 0x43, 0xE5, + 0xB4, 0x99, 0x43, 0xE5, 0xB5, 0x83, 0x43, 0xE5, + 0xB5, 0x90, 0x43, 0xE5, 0xB5, 0xAB, 0x43, 0xE5, + 0xB5, 0xAE, 0x43, 0xE5, 0xB5, 0xBC, 0x43, 0xE5, + // Bytes bc0 - bff + 0xB6, 0xB2, 0x43, 0xE5, 0xB6, 0xBA, 0x43, 0xE5, + 0xB7, 0x9B, 0x43, 0xE5, 0xB7, 0xA1, 0x43, 0xE5, + 0xB7, 0xA2, 0x43, 0xE5, 0xB7, 0xA5, 0x43, 0xE5, + 0xB7, 0xA6, 0x43, 0xE5, 0xB7, 0xB1, 0x43, 0xE5, + 0xB7, 0xBD, 0x43, 0xE5, 0xB7, 0xBE, 0x43, 0xE5, + 0xB8, 0xA8, 0x43, 0xE5, 0xB8, 0xBD, 0x43, 0xE5, + 0xB9, 0xA9, 0x43, 0xE5, 0xB9, 0xB2, 0x43, 0xE5, + 0xB9, 0xB4, 0x43, 0xE5, 0xB9, 0xBA, 0x43, 0xE5, + // Bytes c00 - c3f + 0xB9, 0xBC, 0x43, 0xE5, 0xB9, 0xBF, 0x43, 0xE5, + 0xBA, 0xA6, 0x43, 0xE5, 0xBA, 0xB0, 0x43, 0xE5, + 0xBA, 0xB3, 0x43, 0xE5, 0xBA, 0xB6, 0x43, 0xE5, + 0xBB, 0x89, 0x43, 0xE5, 0xBB, 0x8A, 0x43, 0xE5, + 0xBB, 0x92, 0x43, 0xE5, 0xBB, 0x93, 0x43, 0xE5, + 0xBB, 0x99, 0x43, 0xE5, 0xBB, 0xAC, 0x43, 0xE5, + 0xBB, 0xB4, 0x43, 0xE5, 0xBB, 0xBE, 0x43, 0xE5, + 0xBC, 0x84, 0x43, 0xE5, 0xBC, 0x8B, 0x43, 0xE5, + // Bytes c40 - c7f + 0xBC, 0x93, 0x43, 0xE5, 0xBC, 0xA2, 0x43, 0xE5, + 0xBD, 0x90, 0x43, 0xE5, 0xBD, 0x93, 0x43, 0xE5, + 0xBD, 0xA1, 0x43, 0xE5, 0xBD, 0xA2, 0x43, 0xE5, + 0xBD, 0xA9, 0x43, 0xE5, 0xBD, 0xAB, 0x43, 0xE5, + 0xBD, 0xB3, 0x43, 0xE5, 0xBE, 0x8B, 0x43, 0xE5, + 0xBE, 0x8C, 0x43, 0xE5, 0xBE, 0x97, 0x43, 0xE5, + 0xBE, 0x9A, 0x43, 0xE5, 0xBE, 0xA9, 0x43, 0xE5, + 0xBE, 0xAD, 0x43, 0xE5, 0xBF, 0x83, 0x43, 0xE5, + // Bytes c80 - cbf + 0xBF, 0x8D, 0x43, 0xE5, 0xBF, 0x97, 0x43, 0xE5, + 0xBF, 0xB5, 0x43, 0xE5, 0xBF, 0xB9, 0x43, 0xE6, + 0x80, 0x92, 0x43, 0xE6, 0x80, 0x9C, 0x43, 0xE6, + 0x81, 0xB5, 0x43, 0xE6, 0x82, 0x81, 0x43, 0xE6, + 0x82, 0x94, 0x43, 0xE6, 0x83, 0x87, 0x43, 0xE6, + 0x83, 0x98, 0x43, 0xE6, 0x83, 0xA1, 0x43, 0xE6, + 0x84, 0x88, 0x43, 0xE6, 0x85, 0x84, 0x43, 0xE6, + 0x85, 0x88, 0x43, 0xE6, 0x85, 0x8C, 0x43, 0xE6, + // Bytes cc0 - cff + 0x85, 0x8E, 0x43, 0xE6, 0x85, 0xA0, 0x43, 0xE6, + 0x85, 0xA8, 0x43, 0xE6, 0x85, 0xBA, 0x43, 0xE6, + 0x86, 0x8E, 0x43, 0xE6, 0x86, 0x90, 0x43, 0xE6, + 0x86, 0xA4, 0x43, 0xE6, 0x86, 0xAF, 0x43, 0xE6, + 0x86, 0xB2, 0x43, 0xE6, 0x87, 0x9E, 0x43, 0xE6, + 0x87, 0xB2, 0x43, 0xE6, 0x87, 0xB6, 0x43, 0xE6, + 0x88, 0x80, 0x43, 0xE6, 0x88, 0x88, 0x43, 0xE6, + 0x88, 0x90, 0x43, 0xE6, 0x88, 0x9B, 0x43, 0xE6, + // Bytes d00 - d3f + 0x88, 0xAE, 0x43, 0xE6, 0x88, 0xB4, 0x43, 0xE6, + 0x88, 0xB6, 0x43, 0xE6, 0x89, 0x8B, 0x43, 0xE6, + 0x89, 0x93, 0x43, 0xE6, 0x89, 0x9D, 0x43, 0xE6, + 0x8A, 0x95, 0x43, 0xE6, 0x8A, 0xB1, 0x43, 0xE6, + 0x8B, 0x89, 0x43, 0xE6, 0x8B, 0x8F, 0x43, 0xE6, + 0x8B, 0x93, 0x43, 0xE6, 0x8B, 0x94, 0x43, 0xE6, + 0x8B, 0xBC, 0x43, 0xE6, 0x8B, 0xBE, 0x43, 0xE6, + 0x8C, 0x87, 0x43, 0xE6, 0x8C, 0xBD, 0x43, 0xE6, + // Bytes d40 - d7f + 0x8D, 0x90, 0x43, 0xE6, 0x8D, 0x95, 0x43, 0xE6, + 0x8D, 0xA8, 0x43, 0xE6, 0x8D, 0xBB, 0x43, 0xE6, + 0x8E, 0x83, 0x43, 0xE6, 0x8E, 0xA0, 0x43, 0xE6, + 0x8E, 0xA9, 0x43, 0xE6, 0x8F, 0x84, 0x43, 0xE6, + 0x8F, 0x85, 0x43, 0xE6, 0x8F, 0xA4, 0x43, 0xE6, + 0x90, 0x9C, 0x43, 0xE6, 0x90, 0xA2, 0x43, 0xE6, + 0x91, 0x92, 0x43, 0xE6, 0x91, 0xA9, 0x43, 0xE6, + 0x91, 0xB7, 0x43, 0xE6, 0x91, 0xBE, 0x43, 0xE6, + // Bytes d80 - dbf + 0x92, 0x9A, 0x43, 0xE6, 0x92, 0x9D, 0x43, 0xE6, + 0x93, 0x84, 0x43, 0xE6, 0x94, 0xAF, 0x43, 0xE6, + 0x94, 0xB4, 0x43, 0xE6, 0x95, 0x8F, 0x43, 0xE6, + 0x95, 0x96, 0x43, 0xE6, 0x95, 0xAC, 0x43, 0xE6, + 0x95, 0xB8, 0x43, 0xE6, 0x96, 0x87, 0x43, 0xE6, + 0x96, 0x97, 0x43, 0xE6, 0x96, 0x99, 0x43, 0xE6, + 0x96, 0xA4, 0x43, 0xE6, 0x96, 0xB0, 0x43, 0xE6, + 0x96, 0xB9, 0x43, 0xE6, 0x97, 0x85, 0x43, 0xE6, + // Bytes dc0 - dff + 0x97, 0xA0, 0x43, 0xE6, 0x97, 0xA2, 0x43, 0xE6, + 0x97, 0xA3, 0x43, 0xE6, 0x97, 0xA5, 0x43, 0xE6, + 0x98, 0x93, 0x43, 0xE6, 0x98, 0xA0, 0x43, 0xE6, + 0x99, 0x89, 0x43, 0xE6, 0x99, 0xB4, 0x43, 0xE6, + 0x9A, 0x88, 0x43, 0xE6, 0x9A, 0x91, 0x43, 0xE6, + 0x9A, 0x9C, 0x43, 0xE6, 0x9A, 0xB4, 0x43, 0xE6, + 0x9B, 0x86, 0x43, 0xE6, 0x9B, 0xB0, 0x43, 0xE6, + 0x9B, 0xB4, 0x43, 0xE6, 0x9B, 0xB8, 0x43, 0xE6, + // Bytes e00 - e3f + 0x9C, 0x80, 0x43, 0xE6, 0x9C, 0x88, 0x43, 0xE6, + 0x9C, 0x89, 0x43, 0xE6, 0x9C, 0x97, 0x43, 0xE6, + 0x9C, 0x9B, 0x43, 0xE6, 0x9C, 0xA1, 0x43, 0xE6, + 0x9C, 0xA8, 0x43, 0xE6, 0x9D, 0x8E, 0x43, 0xE6, + 0x9D, 0x93, 0x43, 0xE6, 0x9D, 0x96, 0x43, 0xE6, + 0x9D, 0x9E, 0x43, 0xE6, 0x9D, 0xBB, 0x43, 0xE6, + 0x9E, 0x85, 0x43, 0xE6, 0x9E, 0x97, 0x43, 0xE6, + 0x9F, 0xB3, 0x43, 0xE6, 0x9F, 0xBA, 0x43, 0xE6, + // Bytes e40 - e7f + 0xA0, 0x97, 0x43, 0xE6, 0xA0, 0x9F, 0x43, 0xE6, + 0xA0, 0xAA, 0x43, 0xE6, 0xA1, 0x92, 0x43, 0xE6, + 0xA2, 0x81, 0x43, 0xE6, 0xA2, 0x85, 0x43, 0xE6, + 0xA2, 0x8E, 0x43, 0xE6, 0xA2, 0xA8, 0x43, 0xE6, + 0xA4, 0x94, 0x43, 0xE6, 0xA5, 0x82, 0x43, 0xE6, + 0xA6, 0xA3, 0x43, 0xE6, 0xA7, 0xAA, 0x43, 0xE6, + 0xA8, 0x82, 0x43, 0xE6, 0xA8, 0x93, 0x43, 0xE6, + 0xAA, 0xA8, 0x43, 0xE6, 0xAB, 0x93, 0x43, 0xE6, + // Bytes e80 - ebf + 0xAB, 0x9B, 0x43, 0xE6, 0xAC, 0x84, 0x43, 0xE6, + 0xAC, 0xA0, 0x43, 0xE6, 0xAC, 0xA1, 0x43, 0xE6, + 0xAD, 0x94, 0x43, 0xE6, 0xAD, 0xA2, 0x43, 0xE6, + 0xAD, 0xA3, 0x43, 0xE6, 0xAD, 0xB2, 0x43, 0xE6, + 0xAD, 0xB7, 0x43, 0xE6, 0xAD, 0xB9, 0x43, 0xE6, + 0xAE, 0x9F, 0x43, 0xE6, 0xAE, 0xAE, 0x43, 0xE6, + 0xAE, 0xB3, 0x43, 0xE6, 0xAE, 0xBA, 0x43, 0xE6, + 0xAE, 0xBB, 0x43, 0xE6, 0xAF, 0x8B, 0x43, 0xE6, + // Bytes ec0 - eff + 0xAF, 0x8D, 0x43, 0xE6, 0xAF, 0x94, 0x43, 0xE6, + 0xAF, 0x9B, 0x43, 0xE6, 0xB0, 0x8F, 0x43, 0xE6, + 0xB0, 0x94, 0x43, 0xE6, 0xB0, 0xB4, 0x43, 0xE6, + 0xB1, 0x8E, 0x43, 0xE6, 0xB1, 0xA7, 0x43, 0xE6, + 0xB2, 0x88, 0x43, 0xE6, 0xB2, 0xBF, 0x43, 0xE6, + 0xB3, 0x8C, 0x43, 0xE6, 0xB3, 0x8D, 0x43, 0xE6, + 0xB3, 0xA5, 0x43, 0xE6, 0xB3, 0xA8, 0x43, 0xE6, + 0xB4, 0x96, 0x43, 0xE6, 0xB4, 0x9B, 0x43, 0xE6, + // Bytes f00 - f3f + 0xB4, 0x9E, 0x43, 0xE6, 0xB4, 0xB4, 0x43, 0xE6, + 0xB4, 0xBE, 0x43, 0xE6, 0xB5, 0x81, 0x43, 0xE6, + 0xB5, 0xA9, 0x43, 0xE6, 0xB5, 0xAA, 0x43, 0xE6, + 0xB5, 0xB7, 0x43, 0xE6, 0xB5, 0xB8, 0x43, 0xE6, + 0xB6, 0x85, 0x43, 0xE6, 0xB7, 0x8B, 0x43, 0xE6, + 0xB7, 0x9A, 0x43, 0xE6, 0xB7, 0xAA, 0x43, 0xE6, + 0xB7, 0xB9, 0x43, 0xE6, 0xB8, 0x9A, 0x43, 0xE6, + 0xB8, 0xAF, 0x43, 0xE6, 0xB9, 0xAE, 0x43, 0xE6, + // Bytes f40 - f7f + 0xBA, 0x80, 0x43, 0xE6, 0xBA, 0x9C, 0x43, 0xE6, + 0xBA, 0xBA, 0x43, 0xE6, 0xBB, 0x87, 0x43, 0xE6, + 0xBB, 0x8B, 0x43, 0xE6, 0xBB, 0x91, 0x43, 0xE6, + 0xBB, 0x9B, 0x43, 0xE6, 0xBC, 0x8F, 0x43, 0xE6, + 0xBC, 0x94, 0x43, 0xE6, 0xBC, 0xA2, 0x43, 0xE6, + 0xBC, 0xA3, 0x43, 0xE6, 0xBD, 0xAE, 0x43, 0xE6, + 0xBF, 0x86, 0x43, 0xE6, 0xBF, 0xAB, 0x43, 0xE6, + 0xBF, 0xBE, 0x43, 0xE7, 0x80, 0x9B, 0x43, 0xE7, + // Bytes f80 - fbf + 0x80, 0x9E, 0x43, 0xE7, 0x80, 0xB9, 0x43, 0xE7, + 0x81, 0x8A, 0x43, 0xE7, 0x81, 0xAB, 0x43, 0xE7, + 0x81, 0xB0, 0x43, 0xE7, 0x81, 0xB7, 0x43, 0xE7, + 0x81, 0xBD, 0x43, 0xE7, 0x82, 0x99, 0x43, 0xE7, + 0x82, 0xAD, 0x43, 0xE7, 0x83, 0x88, 0x43, 0xE7, + 0x83, 0x99, 0x43, 0xE7, 0x84, 0xA1, 0x43, 0xE7, + 0x85, 0x85, 0x43, 0xE7, 0x85, 0x89, 0x43, 0xE7, + 0x85, 0xAE, 0x43, 0xE7, 0x86, 0x9C, 0x43, 0xE7, + // Bytes fc0 - fff + 0x87, 0x8E, 0x43, 0xE7, 0x87, 0x90, 0x43, 0xE7, + 0x88, 0x90, 0x43, 0xE7, 0x88, 0x9B, 0x43, 0xE7, + 0x88, 0xA8, 0x43, 0xE7, 0x88, 0xAA, 0x43, 0xE7, + 0x88, 0xAB, 0x43, 0xE7, 0x88, 0xB5, 0x43, 0xE7, + 0x88, 0xB6, 0x43, 0xE7, 0x88, 0xBB, 0x43, 0xE7, + 0x88, 0xBF, 0x43, 0xE7, 0x89, 0x87, 0x43, 0xE7, + 0x89, 0x90, 0x43, 0xE7, 0x89, 0x99, 0x43, 0xE7, + 0x89, 0x9B, 0x43, 0xE7, 0x89, 0xA2, 0x43, 0xE7, + // Bytes 1000 - 103f + 0x89, 0xB9, 0x43, 0xE7, 0x8A, 0x80, 0x43, 0xE7, + 0x8A, 0x95, 0x43, 0xE7, 0x8A, 0xAC, 0x43, 0xE7, + 0x8A, 0xAF, 0x43, 0xE7, 0x8B, 0x80, 0x43, 0xE7, + 0x8B, 0xBC, 0x43, 0xE7, 0x8C, 0xAA, 0x43, 0xE7, + 0x8D, 0xB5, 0x43, 0xE7, 0x8D, 0xBA, 0x43, 0xE7, + 0x8E, 0x84, 0x43, 0xE7, 0x8E, 0x87, 0x43, 0xE7, + 0x8E, 0x89, 0x43, 0xE7, 0x8E, 0x8B, 0x43, 0xE7, + 0x8E, 0xA5, 0x43, 0xE7, 0x8E, 0xB2, 0x43, 0xE7, + // Bytes 1040 - 107f + 0x8F, 0x9E, 0x43, 0xE7, 0x90, 0x86, 0x43, 0xE7, + 0x90, 0x89, 0x43, 0xE7, 0x90, 0xA2, 0x43, 0xE7, + 0x91, 0x87, 0x43, 0xE7, 0x91, 0x9C, 0x43, 0xE7, + 0x91, 0xA9, 0x43, 0xE7, 0x91, 0xB1, 0x43, 0xE7, + 0x92, 0x85, 0x43, 0xE7, 0x92, 0x89, 0x43, 0xE7, + 0x92, 0x98, 0x43, 0xE7, 0x93, 0x8A, 0x43, 0xE7, + 0x93, 0x9C, 0x43, 0xE7, 0x93, 0xA6, 0x43, 0xE7, + 0x94, 0x86, 0x43, 0xE7, 0x94, 0x98, 0x43, 0xE7, + // Bytes 1080 - 10bf + 0x94, 0x9F, 0x43, 0xE7, 0x94, 0xA4, 0x43, 0xE7, + 0x94, 0xA8, 0x43, 0xE7, 0x94, 0xB0, 0x43, 0xE7, + 0x94, 0xB2, 0x43, 0xE7, 0x94, 0xB3, 0x43, 0xE7, + 0x94, 0xB7, 0x43, 0xE7, 0x94, 0xBB, 0x43, 0xE7, + 0x94, 0xBE, 0x43, 0xE7, 0x95, 0x99, 0x43, 0xE7, + 0x95, 0xA5, 0x43, 0xE7, 0x95, 0xB0, 0x43, 0xE7, + 0x96, 0x8B, 0x43, 0xE7, 0x96, 0x92, 0x43, 0xE7, + 0x97, 0xA2, 0x43, 0xE7, 0x98, 0x90, 0x43, 0xE7, + // Bytes 10c0 - 10ff + 0x98, 0x9D, 0x43, 0xE7, 0x98, 0x9F, 0x43, 0xE7, + 0x99, 0x82, 0x43, 0xE7, 0x99, 0xA9, 0x43, 0xE7, + 0x99, 0xB6, 0x43, 0xE7, 0x99, 0xBD, 0x43, 0xE7, + 0x9A, 0xAE, 0x43, 0xE7, 0x9A, 0xBF, 0x43, 0xE7, + 0x9B, 0x8A, 0x43, 0xE7, 0x9B, 0x9B, 0x43, 0xE7, + 0x9B, 0xA3, 0x43, 0xE7, 0x9B, 0xA7, 0x43, 0xE7, + 0x9B, 0xAE, 0x43, 0xE7, 0x9B, 0xB4, 0x43, 0xE7, + 0x9C, 0x81, 0x43, 0xE7, 0x9C, 0x9E, 0x43, 0xE7, + // Bytes 1100 - 113f + 0x9C, 0x9F, 0x43, 0xE7, 0x9D, 0x80, 0x43, 0xE7, + 0x9D, 0x8A, 0x43, 0xE7, 0x9E, 0x8B, 0x43, 0xE7, + 0x9E, 0xA7, 0x43, 0xE7, 0x9F, 0x9B, 0x43, 0xE7, + 0x9F, 0xA2, 0x43, 0xE7, 0x9F, 0xB3, 0x43, 0xE7, + 0xA1, 0x8E, 0x43, 0xE7, 0xA1, 0xAB, 0x43, 0xE7, + 0xA2, 0x8C, 0x43, 0xE7, 0xA2, 0x91, 0x43, 0xE7, + 0xA3, 0x8A, 0x43, 0xE7, 0xA3, 0x8C, 0x43, 0xE7, + 0xA3, 0xBB, 0x43, 0xE7, 0xA4, 0xAA, 0x43, 0xE7, + // Bytes 1140 - 117f + 0xA4, 0xBA, 0x43, 0xE7, 0xA4, 0xBC, 0x43, 0xE7, + 0xA4, 0xBE, 0x43, 0xE7, 0xA5, 0x88, 0x43, 0xE7, + 0xA5, 0x89, 0x43, 0xE7, 0xA5, 0x90, 0x43, 0xE7, + 0xA5, 0x96, 0x43, 0xE7, 0xA5, 0x9D, 0x43, 0xE7, + 0xA5, 0x9E, 0x43, 0xE7, 0xA5, 0xA5, 0x43, 0xE7, + 0xA5, 0xBF, 0x43, 0xE7, 0xA6, 0x81, 0x43, 0xE7, + 0xA6, 0x8D, 0x43, 0xE7, 0xA6, 0x8E, 0x43, 0xE7, + 0xA6, 0x8F, 0x43, 0xE7, 0xA6, 0xAE, 0x43, 0xE7, + // Bytes 1180 - 11bf + 0xA6, 0xB8, 0x43, 0xE7, 0xA6, 0xBE, 0x43, 0xE7, + 0xA7, 0x8A, 0x43, 0xE7, 0xA7, 0x98, 0x43, 0xE7, + 0xA7, 0xAB, 0x43, 0xE7, 0xA8, 0x9C, 0x43, 0xE7, + 0xA9, 0x80, 0x43, 0xE7, 0xA9, 0x8A, 0x43, 0xE7, + 0xA9, 0x8F, 0x43, 0xE7, 0xA9, 0xB4, 0x43, 0xE7, + 0xA9, 0xBA, 0x43, 0xE7, 0xAA, 0x81, 0x43, 0xE7, + 0xAA, 0xB1, 0x43, 0xE7, 0xAB, 0x8B, 0x43, 0xE7, + 0xAB, 0xAE, 0x43, 0xE7, 0xAB, 0xB9, 0x43, 0xE7, + // Bytes 11c0 - 11ff + 0xAC, 0xA0, 0x43, 0xE7, 0xAE, 0x8F, 0x43, 0xE7, + 0xAF, 0x80, 0x43, 0xE7, 0xAF, 0x86, 0x43, 0xE7, + 0xAF, 0x89, 0x43, 0xE7, 0xB0, 0xBE, 0x43, 0xE7, + 0xB1, 0xA0, 0x43, 0xE7, 0xB1, 0xB3, 0x43, 0xE7, + 0xB1, 0xBB, 0x43, 0xE7, 0xB2, 0x92, 0x43, 0xE7, + 0xB2, 0xBE, 0x43, 0xE7, 0xB3, 0x92, 0x43, 0xE7, + 0xB3, 0x96, 0x43, 0xE7, 0xB3, 0xA3, 0x43, 0xE7, + 0xB3, 0xA7, 0x43, 0xE7, 0xB3, 0xA8, 0x43, 0xE7, + // Bytes 1200 - 123f + 0xB3, 0xB8, 0x43, 0xE7, 0xB4, 0x80, 0x43, 0xE7, + 0xB4, 0x90, 0x43, 0xE7, 0xB4, 0xA2, 0x43, 0xE7, + 0xB4, 0xAF, 0x43, 0xE7, 0xB5, 0x82, 0x43, 0xE7, + 0xB5, 0x9B, 0x43, 0xE7, 0xB5, 0xA3, 0x43, 0xE7, + 0xB6, 0xA0, 0x43, 0xE7, 0xB6, 0xBE, 0x43, 0xE7, + 0xB7, 0x87, 0x43, 0xE7, 0xB7, 0xB4, 0x43, 0xE7, + 0xB8, 0x82, 0x43, 0xE7, 0xB8, 0x89, 0x43, 0xE7, + 0xB8, 0xB7, 0x43, 0xE7, 0xB9, 0x81, 0x43, 0xE7, + // Bytes 1240 - 127f + 0xB9, 0x85, 0x43, 0xE7, 0xBC, 0xB6, 0x43, 0xE7, + 0xBC, 0xBE, 0x43, 0xE7, 0xBD, 0x91, 0x43, 0xE7, + 0xBD, 0xB2, 0x43, 0xE7, 0xBD, 0xB9, 0x43, 0xE7, + 0xBD, 0xBA, 0x43, 0xE7, 0xBE, 0x85, 0x43, 0xE7, + 0xBE, 0x8A, 0x43, 0xE7, 0xBE, 0x95, 0x43, 0xE7, + 0xBE, 0x9A, 0x43, 0xE7, 0xBE, 0xBD, 0x43, 0xE7, + 0xBF, 0xBA, 0x43, 0xE8, 0x80, 0x81, 0x43, 0xE8, + 0x80, 0x85, 0x43, 0xE8, 0x80, 0x8C, 0x43, 0xE8, + // Bytes 1280 - 12bf + 0x80, 0x92, 0x43, 0xE8, 0x80, 0xB3, 0x43, 0xE8, + 0x81, 0x86, 0x43, 0xE8, 0x81, 0xA0, 0x43, 0xE8, + 0x81, 0xAF, 0x43, 0xE8, 0x81, 0xB0, 0x43, 0xE8, + 0x81, 0xBE, 0x43, 0xE8, 0x81, 0xBF, 0x43, 0xE8, + 0x82, 0x89, 0x43, 0xE8, 0x82, 0x8B, 0x43, 0xE8, + 0x82, 0xAD, 0x43, 0xE8, 0x82, 0xB2, 0x43, 0xE8, + 0x84, 0x83, 0x43, 0xE8, 0x84, 0xBE, 0x43, 0xE8, + 0x87, 0x98, 0x43, 0xE8, 0x87, 0xA3, 0x43, 0xE8, + // Bytes 12c0 - 12ff + 0x87, 0xA8, 0x43, 0xE8, 0x87, 0xAA, 0x43, 0xE8, + 0x87, 0xAD, 0x43, 0xE8, 0x87, 0xB3, 0x43, 0xE8, + 0x87, 0xBC, 0x43, 0xE8, 0x88, 0x81, 0x43, 0xE8, + 0x88, 0x84, 0x43, 0xE8, 0x88, 0x8C, 0x43, 0xE8, + 0x88, 0x98, 0x43, 0xE8, 0x88, 0x9B, 0x43, 0xE8, + 0x88, 0x9F, 0x43, 0xE8, 0x89, 0xAE, 0x43, 0xE8, + 0x89, 0xAF, 0x43, 0xE8, 0x89, 0xB2, 0x43, 0xE8, + 0x89, 0xB8, 0x43, 0xE8, 0x89, 0xB9, 0x43, 0xE8, + // Bytes 1300 - 133f + 0x8A, 0x8B, 0x43, 0xE8, 0x8A, 0x91, 0x43, 0xE8, + 0x8A, 0x9D, 0x43, 0xE8, 0x8A, 0xB1, 0x43, 0xE8, + 0x8A, 0xB3, 0x43, 0xE8, 0x8A, 0xBD, 0x43, 0xE8, + 0x8B, 0xA5, 0x43, 0xE8, 0x8B, 0xA6, 0x43, 0xE8, + 0x8C, 0x9D, 0x43, 0xE8, 0x8C, 0xA3, 0x43, 0xE8, + 0x8C, 0xB6, 0x43, 0xE8, 0x8D, 0x92, 0x43, 0xE8, + 0x8D, 0x93, 0x43, 0xE8, 0x8D, 0xA3, 0x43, 0xE8, + 0x8E, 0xAD, 0x43, 0xE8, 0x8E, 0xBD, 0x43, 0xE8, + // Bytes 1340 - 137f + 0x8F, 0x89, 0x43, 0xE8, 0x8F, 0x8A, 0x43, 0xE8, + 0x8F, 0x8C, 0x43, 0xE8, 0x8F, 0x9C, 0x43, 0xE8, + 0x8F, 0xA7, 0x43, 0xE8, 0x8F, 0xAF, 0x43, 0xE8, + 0x8F, 0xB1, 0x43, 0xE8, 0x90, 0xBD, 0x43, 0xE8, + 0x91, 0x89, 0x43, 0xE8, 0x91, 0x97, 0x43, 0xE8, + 0x93, 0xAE, 0x43, 0xE8, 0x93, 0xB1, 0x43, 0xE8, + 0x93, 0xB3, 0x43, 0xE8, 0x93, 0xBC, 0x43, 0xE8, + 0x94, 0x96, 0x43, 0xE8, 0x95, 0xA4, 0x43, 0xE8, + // Bytes 1380 - 13bf + 0x97, 0x8D, 0x43, 0xE8, 0x97, 0xBA, 0x43, 0xE8, + 0x98, 0x86, 0x43, 0xE8, 0x98, 0x92, 0x43, 0xE8, + 0x98, 0xAD, 0x43, 0xE8, 0x98, 0xBF, 0x43, 0xE8, + 0x99, 0x8D, 0x43, 0xE8, 0x99, 0x90, 0x43, 0xE8, + 0x99, 0x9C, 0x43, 0xE8, 0x99, 0xA7, 0x43, 0xE8, + 0x99, 0xA9, 0x43, 0xE8, 0x99, 0xAB, 0x43, 0xE8, + 0x9A, 0x88, 0x43, 0xE8, 0x9A, 0xA9, 0x43, 0xE8, + 0x9B, 0xA2, 0x43, 0xE8, 0x9C, 0x8E, 0x43, 0xE8, + // Bytes 13c0 - 13ff + 0x9C, 0xA8, 0x43, 0xE8, 0x9D, 0xAB, 0x43, 0xE8, + 0x9D, 0xB9, 0x43, 0xE8, 0x9E, 0x86, 0x43, 0xE8, + 0x9E, 0xBA, 0x43, 0xE8, 0x9F, 0xA1, 0x43, 0xE8, + 0xA0, 0x81, 0x43, 0xE8, 0xA0, 0x9F, 0x43, 0xE8, + 0xA1, 0x80, 0x43, 0xE8, 0xA1, 0x8C, 0x43, 0xE8, + 0xA1, 0xA0, 0x43, 0xE8, 0xA1, 0xA3, 0x43, 0xE8, + 0xA3, 0x82, 0x43, 0xE8, 0xA3, 0x8F, 0x43, 0xE8, + 0xA3, 0x97, 0x43, 0xE8, 0xA3, 0x9E, 0x43, 0xE8, + // Bytes 1400 - 143f + 0xA3, 0xA1, 0x43, 0xE8, 0xA3, 0xB8, 0x43, 0xE8, + 0xA3, 0xBA, 0x43, 0xE8, 0xA4, 0x90, 0x43, 0xE8, + 0xA5, 0x81, 0x43, 0xE8, 0xA5, 0xA4, 0x43, 0xE8, + 0xA5, 0xBE, 0x43, 0xE8, 0xA6, 0x86, 0x43, 0xE8, + 0xA6, 0x8B, 0x43, 0xE8, 0xA6, 0x96, 0x43, 0xE8, + 0xA7, 0x92, 0x43, 0xE8, 0xA7, 0xA3, 0x43, 0xE8, + 0xA8, 0x80, 0x43, 0xE8, 0xAA, 0xA0, 0x43, 0xE8, + 0xAA, 0xAA, 0x43, 0xE8, 0xAA, 0xBF, 0x43, 0xE8, + // Bytes 1440 - 147f + 0xAB, 0x8B, 0x43, 0xE8, 0xAB, 0x92, 0x43, 0xE8, + 0xAB, 0x96, 0x43, 0xE8, 0xAB, 0xAD, 0x43, 0xE8, + 0xAB, 0xB8, 0x43, 0xE8, 0xAB, 0xBE, 0x43, 0xE8, + 0xAC, 0x81, 0x43, 0xE8, 0xAC, 0xB9, 0x43, 0xE8, + 0xAD, 0x98, 0x43, 0xE8, 0xAE, 0x80, 0x43, 0xE8, + 0xAE, 0x8A, 0x43, 0xE8, 0xB0, 0xB7, 0x43, 0xE8, + 0xB1, 0x86, 0x43, 0xE8, 0xB1, 0x88, 0x43, 0xE8, + 0xB1, 0x95, 0x43, 0xE8, 0xB1, 0xB8, 0x43, 0xE8, + // Bytes 1480 - 14bf + 0xB2, 0x9D, 0x43, 0xE8, 0xB2, 0xA1, 0x43, 0xE8, + 0xB2, 0xA9, 0x43, 0xE8, 0xB2, 0xAB, 0x43, 0xE8, + 0xB3, 0x81, 0x43, 0xE8, 0xB3, 0x82, 0x43, 0xE8, + 0xB3, 0x87, 0x43, 0xE8, 0xB3, 0x88, 0x43, 0xE8, + 0xB3, 0x93, 0x43, 0xE8, 0xB4, 0x88, 0x43, 0xE8, + 0xB4, 0x9B, 0x43, 0xE8, 0xB5, 0xA4, 0x43, 0xE8, + 0xB5, 0xB0, 0x43, 0xE8, 0xB5, 0xB7, 0x43, 0xE8, + 0xB6, 0xB3, 0x43, 0xE8, 0xB6, 0xBC, 0x43, 0xE8, + // Bytes 14c0 - 14ff + 0xB7, 0x8B, 0x43, 0xE8, 0xB7, 0xAF, 0x43, 0xE8, + 0xB7, 0xB0, 0x43, 0xE8, 0xBA, 0xAB, 0x43, 0xE8, + 0xBB, 0x8A, 0x43, 0xE8, 0xBB, 0x94, 0x43, 0xE8, + 0xBC, 0xA6, 0x43, 0xE8, 0xBC, 0xAA, 0x43, 0xE8, + 0xBC, 0xB8, 0x43, 0xE8, 0xBC, 0xBB, 0x43, 0xE8, + 0xBD, 0xA2, 0x43, 0xE8, 0xBE, 0x9B, 0x43, 0xE8, + 0xBE, 0x9E, 0x43, 0xE8, 0xBE, 0xB0, 0x43, 0xE8, + 0xBE, 0xB5, 0x43, 0xE8, 0xBE, 0xB6, 0x43, 0xE9, + // Bytes 1500 - 153f + 0x80, 0xA3, 0x43, 0xE9, 0x80, 0xB8, 0x43, 0xE9, + 0x81, 0x8A, 0x43, 0xE9, 0x81, 0xA9, 0x43, 0xE9, + 0x81, 0xB2, 0x43, 0xE9, 0x81, 0xBC, 0x43, 0xE9, + 0x82, 0x8F, 0x43, 0xE9, 0x82, 0x91, 0x43, 0xE9, + 0x82, 0x94, 0x43, 0xE9, 0x83, 0x8E, 0x43, 0xE9, + 0x83, 0x9E, 0x43, 0xE9, 0x83, 0xB1, 0x43, 0xE9, + 0x83, 0xBD, 0x43, 0xE9, 0x84, 0x91, 0x43, 0xE9, + 0x84, 0x9B, 0x43, 0xE9, 0x85, 0x89, 0x43, 0xE9, + // Bytes 1540 - 157f + 0x85, 0x8D, 0x43, 0xE9, 0x85, 0xAA, 0x43, 0xE9, + 0x86, 0x99, 0x43, 0xE9, 0x86, 0xB4, 0x43, 0xE9, + 0x87, 0x86, 0x43, 0xE9, 0x87, 0x8C, 0x43, 0xE9, + 0x87, 0x8F, 0x43, 0xE9, 0x87, 0x91, 0x43, 0xE9, + 0x88, 0xB4, 0x43, 0xE9, 0x88, 0xB8, 0x43, 0xE9, + 0x89, 0xB6, 0x43, 0xE9, 0x89, 0xBC, 0x43, 0xE9, + 0x8B, 0x97, 0x43, 0xE9, 0x8B, 0x98, 0x43, 0xE9, + 0x8C, 0x84, 0x43, 0xE9, 0x8D, 0x8A, 0x43, 0xE9, + // Bytes 1580 - 15bf + 0x8F, 0xB9, 0x43, 0xE9, 0x90, 0x95, 0x43, 0xE9, + 0x95, 0xB7, 0x43, 0xE9, 0x96, 0x80, 0x43, 0xE9, + 0x96, 0x8B, 0x43, 0xE9, 0x96, 0xAD, 0x43, 0xE9, + 0x96, 0xB7, 0x43, 0xE9, 0x98, 0x9C, 0x43, 0xE9, + 0x98, 0xAE, 0x43, 0xE9, 0x99, 0x8B, 0x43, 0xE9, + 0x99, 0x8D, 0x43, 0xE9, 0x99, 0xB5, 0x43, 0xE9, + 0x99, 0xB8, 0x43, 0xE9, 0x99, 0xBC, 0x43, 0xE9, + 0x9A, 0x86, 0x43, 0xE9, 0x9A, 0xA3, 0x43, 0xE9, + // Bytes 15c0 - 15ff + 0x9A, 0xB6, 0x43, 0xE9, 0x9A, 0xB7, 0x43, 0xE9, + 0x9A, 0xB8, 0x43, 0xE9, 0x9A, 0xB9, 0x43, 0xE9, + 0x9B, 0x83, 0x43, 0xE9, 0x9B, 0xA2, 0x43, 0xE9, + 0x9B, 0xA3, 0x43, 0xE9, 0x9B, 0xA8, 0x43, 0xE9, + 0x9B, 0xB6, 0x43, 0xE9, 0x9B, 0xB7, 0x43, 0xE9, + 0x9C, 0xA3, 0x43, 0xE9, 0x9C, 0xB2, 0x43, 0xE9, + 0x9D, 0x88, 0x43, 0xE9, 0x9D, 0x91, 0x43, 0xE9, + 0x9D, 0x96, 0x43, 0xE9, 0x9D, 0x9E, 0x43, 0xE9, + // Bytes 1600 - 163f + 0x9D, 0xA2, 0x43, 0xE9, 0x9D, 0xA9, 0x43, 0xE9, + 0x9F, 0x8B, 0x43, 0xE9, 0x9F, 0x9B, 0x43, 0xE9, + 0x9F, 0xA0, 0x43, 0xE9, 0x9F, 0xAD, 0x43, 0xE9, + 0x9F, 0xB3, 0x43, 0xE9, 0x9F, 0xBF, 0x43, 0xE9, + 0xA0, 0x81, 0x43, 0xE9, 0xA0, 0x85, 0x43, 0xE9, + 0xA0, 0x8B, 0x43, 0xE9, 0xA0, 0x98, 0x43, 0xE9, + 0xA0, 0xA9, 0x43, 0xE9, 0xA0, 0xBB, 0x43, 0xE9, + 0xA1, 0x9E, 0x43, 0xE9, 0xA2, 0xA8, 0x43, 0xE9, + // Bytes 1640 - 167f + 0xA3, 0x9B, 0x43, 0xE9, 0xA3, 0x9F, 0x43, 0xE9, + 0xA3, 0xA2, 0x43, 0xE9, 0xA3, 0xAF, 0x43, 0xE9, + 0xA3, 0xBC, 0x43, 0xE9, 0xA4, 0xA8, 0x43, 0xE9, + 0xA4, 0xA9, 0x43, 0xE9, 0xA6, 0x96, 0x43, 0xE9, + 0xA6, 0x99, 0x43, 0xE9, 0xA6, 0xA7, 0x43, 0xE9, + 0xA6, 0xAC, 0x43, 0xE9, 0xA7, 0x82, 0x43, 0xE9, + 0xA7, 0xB1, 0x43, 0xE9, 0xA7, 0xBE, 0x43, 0xE9, + 0xA9, 0xAA, 0x43, 0xE9, 0xAA, 0xA8, 0x43, 0xE9, + // Bytes 1680 - 16bf + 0xAB, 0x98, 0x43, 0xE9, 0xAB, 0x9F, 0x43, 0xE9, + 0xAC, 0x92, 0x43, 0xE9, 0xAC, 0xA5, 0x43, 0xE9, + 0xAC, 0xAF, 0x43, 0xE9, 0xAC, 0xB2, 0x43, 0xE9, + 0xAC, 0xBC, 0x43, 0xE9, 0xAD, 0x9A, 0x43, 0xE9, + 0xAD, 0xAF, 0x43, 0xE9, 0xB1, 0x80, 0x43, 0xE9, + 0xB1, 0x97, 0x43, 0xE9, 0xB3, 0xA5, 0x43, 0xE9, + 0xB3, 0xBD, 0x43, 0xE9, 0xB5, 0xA7, 0x43, 0xE9, + 0xB6, 0xB4, 0x43, 0xE9, 0xB7, 0xBA, 0x43, 0xE9, + // Bytes 16c0 - 16ff + 0xB8, 0x9E, 0x43, 0xE9, 0xB9, 0xB5, 0x43, 0xE9, + 0xB9, 0xBF, 0x43, 0xE9, 0xBA, 0x97, 0x43, 0xE9, + 0xBA, 0x9F, 0x43, 0xE9, 0xBA, 0xA5, 0x43, 0xE9, + 0xBA, 0xBB, 0x43, 0xE9, 0xBB, 0x83, 0x43, 0xE9, + 0xBB, 0x8D, 0x43, 0xE9, 0xBB, 0x8E, 0x43, 0xE9, + 0xBB, 0x91, 0x43, 0xE9, 0xBB, 0xB9, 0x43, 0xE9, + 0xBB, 0xBD, 0x43, 0xE9, 0xBB, 0xBE, 0x43, 0xE9, + 0xBC, 0x85, 0x43, 0xE9, 0xBC, 0x8E, 0x43, 0xE9, + // Bytes 1700 - 173f + 0xBC, 0x8F, 0x43, 0xE9, 0xBC, 0x93, 0x43, 0xE9, + 0xBC, 0x96, 0x43, 0xE9, 0xBC, 0xA0, 0x43, 0xE9, + 0xBC, 0xBB, 0x43, 0xE9, 0xBD, 0x83, 0x43, 0xE9, + 0xBD, 0x8A, 0x43, 0xE9, 0xBD, 0x92, 0x43, 0xE9, + 0xBE, 0x8D, 0x43, 0xE9, 0xBE, 0x8E, 0x43, 0xE9, + 0xBE, 0x9C, 0x43, 0xE9, 0xBE, 0x9F, 0x43, 0xE9, + 0xBE, 0xA0, 0x43, 0xEA, 0x99, 0x91, 0x43, 0xEA, + 0x9A, 0x89, 0x43, 0xEA, 0x9C, 0xA7, 0x43, 0xEA, + // Bytes 1740 - 177f + 0x9D, 0xAF, 0x43, 0xEA, 0x9E, 0x8E, 0x43, 0xEA, + 0xAC, 0xB7, 0x43, 0xEA, 0xAD, 0x92, 0x43, 0xEA, + 0xAD, 0xA6, 0x43, 0xEA, 0xAD, 0xA7, 0x44, 0xF0, + 0x9D, 0xBC, 0x84, 0x44, 0xF0, 0x9D, 0xBC, 0x85, + 0x44, 0xF0, 0x9D, 0xBC, 0x86, 0x44, 0xF0, 0x9D, + 0xBC, 0x88, 0x44, 0xF0, 0x9D, 0xBC, 0x8A, 0x44, + 0xF0, 0x9D, 0xBC, 0x9E, 0x44, 0xF0, 0xA0, 0x84, + 0xA2, 0x44, 0xF0, 0xA0, 0x94, 0x9C, 0x44, 0xF0, + // Bytes 1780 - 17bf + 0xA0, 0x94, 0xA5, 0x44, 0xF0, 0xA0, 0x95, 0x8B, + 0x44, 0xF0, 0xA0, 0x98, 0xBA, 0x44, 0xF0, 0xA0, + 0xA0, 0x84, 0x44, 0xF0, 0xA0, 0xA3, 0x9E, 0x44, + 0xF0, 0xA0, 0xA8, 0xAC, 0x44, 0xF0, 0xA0, 0xAD, + 0xA3, 0x44, 0xF0, 0xA1, 0x93, 0xA4, 0x44, 0xF0, + 0xA1, 0x9A, 0xA8, 0x44, 0xF0, 0xA1, 0x9B, 0xAA, + 0x44, 0xF0, 0xA1, 0xA7, 0x88, 0x44, 0xF0, 0xA1, + 0xAC, 0x98, 0x44, 0xF0, 0xA1, 0xB4, 0x8B, 0x44, + // Bytes 17c0 - 17ff + 0xF0, 0xA1, 0xB7, 0xA4, 0x44, 0xF0, 0xA1, 0xB7, + 0xA6, 0x44, 0xF0, 0xA2, 0x86, 0x83, 0x44, 0xF0, + 0xA2, 0x86, 0x9F, 0x44, 0xF0, 0xA2, 0x8C, 0xB1, + 0x44, 0xF0, 0xA2, 0x9B, 0x94, 0x44, 0xF0, 0xA2, + 0xA1, 0x84, 0x44, 0xF0, 0xA2, 0xA1, 0x8A, 0x44, + 0xF0, 0xA2, 0xAC, 0x8C, 0x44, 0xF0, 0xA2, 0xAF, + 0xB1, 0x44, 0xF0, 0xA3, 0x80, 0x8A, 0x44, 0xF0, + 0xA3, 0x8A, 0xB8, 0x44, 0xF0, 0xA3, 0x8D, 0x9F, + // Bytes 1800 - 183f + 0x44, 0xF0, 0xA3, 0x8E, 0x93, 0x44, 0xF0, 0xA3, + 0x8E, 0x9C, 0x44, 0xF0, 0xA3, 0x8F, 0x83, 0x44, + 0xF0, 0xA3, 0x8F, 0x95, 0x44, 0xF0, 0xA3, 0x91, + 0xAD, 0x44, 0xF0, 0xA3, 0x9A, 0xA3, 0x44, 0xF0, + 0xA3, 0xA2, 0xA7, 0x44, 0xF0, 0xA3, 0xAA, 0x8D, + 0x44, 0xF0, 0xA3, 0xAB, 0xBA, 0x44, 0xF0, 0xA3, + 0xB2, 0xBC, 0x44, 0xF0, 0xA3, 0xB4, 0x9E, 0x44, + 0xF0, 0xA3, 0xBB, 0x91, 0x44, 0xF0, 0xA3, 0xBD, + // Bytes 1840 - 187f + 0x9E, 0x44, 0xF0, 0xA3, 0xBE, 0x8E, 0x44, 0xF0, + 0xA4, 0x89, 0xA3, 0x44, 0xF0, 0xA4, 0x8B, 0xAE, + 0x44, 0xF0, 0xA4, 0x8E, 0xAB, 0x44, 0xF0, 0xA4, + 0x98, 0x88, 0x44, 0xF0, 0xA4, 0x9C, 0xB5, 0x44, + 0xF0, 0xA4, 0xA0, 0x94, 0x44, 0xF0, 0xA4, 0xB0, + 0xB6, 0x44, 0xF0, 0xA4, 0xB2, 0x92, 0x44, 0xF0, + 0xA4, 0xBE, 0xA1, 0x44, 0xF0, 0xA4, 0xBE, 0xB8, + 0x44, 0xF0, 0xA5, 0x81, 0x84, 0x44, 0xF0, 0xA5, + // Bytes 1880 - 18bf + 0x83, 0xB2, 0x44, 0xF0, 0xA5, 0x83, 0xB3, 0x44, + 0xF0, 0xA5, 0x84, 0x99, 0x44, 0xF0, 0xA5, 0x84, + 0xB3, 0x44, 0xF0, 0xA5, 0x89, 0x89, 0x44, 0xF0, + 0xA5, 0x90, 0x9D, 0x44, 0xF0, 0xA5, 0x98, 0xA6, + 0x44, 0xF0, 0xA5, 0x9A, 0x9A, 0x44, 0xF0, 0xA5, + 0x9B, 0x85, 0x44, 0xF0, 0xA5, 0xA5, 0xBC, 0x44, + 0xF0, 0xA5, 0xAA, 0xA7, 0x44, 0xF0, 0xA5, 0xAE, + 0xAB, 0x44, 0xF0, 0xA5, 0xB2, 0x80, 0x44, 0xF0, + // Bytes 18c0 - 18ff + 0xA5, 0xB3, 0x90, 0x44, 0xF0, 0xA5, 0xBE, 0x86, + 0x44, 0xF0, 0xA6, 0x87, 0x9A, 0x44, 0xF0, 0xA6, + 0x88, 0xA8, 0x44, 0xF0, 0xA6, 0x89, 0x87, 0x44, + 0xF0, 0xA6, 0x8B, 0x99, 0x44, 0xF0, 0xA6, 0x8C, + 0xBE, 0x44, 0xF0, 0xA6, 0x93, 0x9A, 0x44, 0xF0, + 0xA6, 0x94, 0xA3, 0x44, 0xF0, 0xA6, 0x96, 0xA8, + 0x44, 0xF0, 0xA6, 0x9E, 0xA7, 0x44, 0xF0, 0xA6, + 0x9E, 0xB5, 0x44, 0xF0, 0xA6, 0xAC, 0xBC, 0x44, + // Bytes 1900 - 193f + 0xF0, 0xA6, 0xB0, 0xB6, 0x44, 0xF0, 0xA6, 0xB3, + 0x95, 0x44, 0xF0, 0xA6, 0xB5, 0xAB, 0x44, 0xF0, + 0xA6, 0xBC, 0xAC, 0x44, 0xF0, 0xA6, 0xBE, 0xB1, + 0x44, 0xF0, 0xA7, 0x83, 0x92, 0x44, 0xF0, 0xA7, + 0x8F, 0x8A, 0x44, 0xF0, 0xA7, 0x99, 0xA7, 0x44, + 0xF0, 0xA7, 0xA2, 0xAE, 0x44, 0xF0, 0xA7, 0xA5, + 0xA6, 0x44, 0xF0, 0xA7, 0xB2, 0xA8, 0x44, 0xF0, + 0xA7, 0xBB, 0x93, 0x44, 0xF0, 0xA7, 0xBC, 0xAF, + // Bytes 1940 - 197f + 0x44, 0xF0, 0xA8, 0x97, 0x92, 0x44, 0xF0, 0xA8, + 0x97, 0xAD, 0x44, 0xF0, 0xA8, 0x9C, 0xAE, 0x44, + 0xF0, 0xA8, 0xAF, 0xBA, 0x44, 0xF0, 0xA8, 0xB5, + 0xB7, 0x44, 0xF0, 0xA9, 0x85, 0x85, 0x44, 0xF0, + 0xA9, 0x87, 0x9F, 0x44, 0xF0, 0xA9, 0x88, 0x9A, + 0x44, 0xF0, 0xA9, 0x90, 0x8A, 0x44, 0xF0, 0xA9, + 0x92, 0x96, 0x44, 0xF0, 0xA9, 0x96, 0xB6, 0x44, + 0xF0, 0xA9, 0xAC, 0xB0, 0x44, 0xF0, 0xAA, 0x83, + // Bytes 1980 - 19bf + 0x8E, 0x44, 0xF0, 0xAA, 0x84, 0x85, 0x44, 0xF0, + 0xAA, 0x88, 0x8E, 0x44, 0xF0, 0xAA, 0x8A, 0x91, + 0x44, 0xF0, 0xAA, 0x8E, 0x92, 0x44, 0xF0, 0xAA, + 0x98, 0x80, 0x42, 0x21, 0x21, 0x42, 0x21, 0x3F, + 0x42, 0x2E, 0x2E, 0x42, 0x30, 0x2C, 0x42, 0x30, + 0x2E, 0x42, 0x31, 0x2C, 0x42, 0x31, 0x2E, 0x42, + 0x31, 0x30, 0x42, 0x31, 0x31, 0x42, 0x31, 0x32, + 0x42, 0x31, 0x33, 0x42, 0x31, 0x34, 0x42, 0x31, + // Bytes 19c0 - 19ff + 0x35, 0x42, 0x31, 0x36, 0x42, 0x31, 0x37, 0x42, + 0x31, 0x38, 0x42, 0x31, 0x39, 0x42, 0x32, 0x2C, + 0x42, 0x32, 0x2E, 0x42, 0x32, 0x30, 0x42, 0x32, + 0x31, 0x42, 0x32, 0x32, 0x42, 0x32, 0x33, 0x42, + 0x32, 0x34, 0x42, 0x32, 0x35, 0x42, 0x32, 0x36, + 0x42, 0x32, 0x37, 0x42, 0x32, 0x38, 0x42, 0x32, + 0x39, 0x42, 0x33, 0x2C, 0x42, 0x33, 0x2E, 0x42, + 0x33, 0x30, 0x42, 0x33, 0x31, 0x42, 0x33, 0x32, + // Bytes 1a00 - 1a3f + 0x42, 0x33, 0x33, 0x42, 0x33, 0x34, 0x42, 0x33, + 0x35, 0x42, 0x33, 0x36, 0x42, 0x33, 0x37, 0x42, + 0x33, 0x38, 0x42, 0x33, 0x39, 0x42, 0x34, 0x2C, + 0x42, 0x34, 0x2E, 0x42, 0x34, 0x30, 0x42, 0x34, + 0x31, 0x42, 0x34, 0x32, 0x42, 0x34, 0x33, 0x42, + 0x34, 0x34, 0x42, 0x34, 0x35, 0x42, 0x34, 0x36, + 0x42, 0x34, 0x37, 0x42, 0x34, 0x38, 0x42, 0x34, + 0x39, 0x42, 0x35, 0x2C, 0x42, 0x35, 0x2E, 0x42, + // Bytes 1a40 - 1a7f + 0x35, 0x30, 0x42, 0x36, 0x2C, 0x42, 0x36, 0x2E, + 0x42, 0x37, 0x2C, 0x42, 0x37, 0x2E, 0x42, 0x38, + 0x2C, 0x42, 0x38, 0x2E, 0x42, 0x39, 0x2C, 0x42, + 0x39, 0x2E, 0x42, 0x3D, 0x3D, 0x42, 0x3F, 0x21, + 0x42, 0x3F, 0x3F, 0x42, 0x41, 0x55, 0x42, 0x42, + 0x71, 0x42, 0x43, 0x44, 0x42, 0x44, 0x4A, 0x42, + 0x44, 0x5A, 0x42, 0x44, 0x7A, 0x42, 0x47, 0x42, + 0x42, 0x47, 0x79, 0x42, 0x48, 0x50, 0x42, 0x48, + // Bytes 1a80 - 1abf + 0x56, 0x42, 0x48, 0x67, 0x42, 0x48, 0x7A, 0x42, + 0x49, 0x49, 0x42, 0x49, 0x4A, 0x42, 0x49, 0x55, + 0x42, 0x49, 0x56, 0x42, 0x49, 0x58, 0x42, 0x4B, + 0x42, 0x42, 0x4B, 0x4B, 0x42, 0x4B, 0x4D, 0x42, + 0x4C, 0x4A, 0x42, 0x4C, 0x6A, 0x42, 0x4D, 0x42, + 0x42, 0x4D, 0x43, 0x42, 0x4D, 0x44, 0x42, 0x4D, + 0x52, 0x42, 0x4D, 0x56, 0x42, 0x4D, 0x57, 0x42, + 0x4E, 0x4A, 0x42, 0x4E, 0x6A, 0x42, 0x4E, 0x6F, + // Bytes 1ac0 - 1aff + 0x42, 0x50, 0x48, 0x42, 0x50, 0x52, 0x42, 0x50, + 0x61, 0x42, 0x52, 0x73, 0x42, 0x53, 0x44, 0x42, + 0x53, 0x4D, 0x42, 0x53, 0x53, 0x42, 0x53, 0x76, + 0x42, 0x54, 0x4D, 0x42, 0x56, 0x49, 0x42, 0x57, + 0x43, 0x42, 0x57, 0x5A, 0x42, 0x57, 0x62, 0x42, + 0x58, 0x49, 0x42, 0x63, 0x63, 0x42, 0x63, 0x64, + 0x42, 0x63, 0x6D, 0x42, 0x64, 0x42, 0x42, 0x64, + 0x61, 0x42, 0x64, 0x6C, 0x42, 0x64, 0x6D, 0x42, + // Bytes 1b00 - 1b3f + 0x64, 0x7A, 0x42, 0x65, 0x56, 0x42, 0x66, 0x66, + 0x42, 0x66, 0x69, 0x42, 0x66, 0x6C, 0x42, 0x66, + 0x6D, 0x42, 0x68, 0x61, 0x42, 0x69, 0x69, 0x42, + 0x69, 0x6A, 0x42, 0x69, 0x6E, 0x42, 0x69, 0x76, + 0x42, 0x69, 0x78, 0x42, 0x6B, 0x41, 0x42, 0x6B, + 0x56, 0x42, 0x6B, 0x57, 0x42, 0x6B, 0x67, 0x42, + 0x6B, 0x6C, 0x42, 0x6B, 0x6D, 0x42, 0x6B, 0x74, + 0x42, 0x6C, 0x6A, 0x42, 0x6C, 0x6D, 0x42, 0x6C, + // Bytes 1b40 - 1b7f + 0x6E, 0x42, 0x6C, 0x78, 0x42, 0x6D, 0x32, 0x42, + 0x6D, 0x33, 0x42, 0x6D, 0x41, 0x42, 0x6D, 0x56, + 0x42, 0x6D, 0x57, 0x42, 0x6D, 0x62, 0x42, 0x6D, + 0x67, 0x42, 0x6D, 0x6C, 0x42, 0x6D, 0x6D, 0x42, + 0x6D, 0x73, 0x42, 0x6E, 0x41, 0x42, 0x6E, 0x46, + 0x42, 0x6E, 0x56, 0x42, 0x6E, 0x57, 0x42, 0x6E, + 0x6A, 0x42, 0x6E, 0x6D, 0x42, 0x6E, 0x73, 0x42, + 0x6F, 0x56, 0x42, 0x70, 0x41, 0x42, 0x70, 0x46, + // Bytes 1b80 - 1bbf + 0x42, 0x70, 0x56, 0x42, 0x70, 0x57, 0x42, 0x70, + 0x63, 0x42, 0x70, 0x73, 0x42, 0x73, 0x72, 0x42, + 0x73, 0x74, 0x42, 0x76, 0x69, 0x42, 0x78, 0x69, + 0x43, 0x28, 0x31, 0x29, 0x43, 0x28, 0x32, 0x29, + 0x43, 0x28, 0x33, 0x29, 0x43, 0x28, 0x34, 0x29, + 0x43, 0x28, 0x35, 0x29, 0x43, 0x28, 0x36, 0x29, + 0x43, 0x28, 0x37, 0x29, 0x43, 0x28, 0x38, 0x29, + 0x43, 0x28, 0x39, 0x29, 0x43, 0x28, 0x41, 0x29, + // Bytes 1bc0 - 1bff + 0x43, 0x28, 0x42, 0x29, 0x43, 0x28, 0x43, 0x29, + 0x43, 0x28, 0x44, 0x29, 0x43, 0x28, 0x45, 0x29, + 0x43, 0x28, 0x46, 0x29, 0x43, 0x28, 0x47, 0x29, + 0x43, 0x28, 0x48, 0x29, 0x43, 0x28, 0x49, 0x29, + 0x43, 0x28, 0x4A, 0x29, 0x43, 0x28, 0x4B, 0x29, + 0x43, 0x28, 0x4C, 0x29, 0x43, 0x28, 0x4D, 0x29, + 0x43, 0x28, 0x4E, 0x29, 0x43, 0x28, 0x4F, 0x29, + 0x43, 0x28, 0x50, 0x29, 0x43, 0x28, 0x51, 0x29, + // Bytes 1c00 - 1c3f + 0x43, 0x28, 0x52, 0x29, 0x43, 0x28, 0x53, 0x29, + 0x43, 0x28, 0x54, 0x29, 0x43, 0x28, 0x55, 0x29, + 0x43, 0x28, 0x56, 0x29, 0x43, 0x28, 0x57, 0x29, + 0x43, 0x28, 0x58, 0x29, 0x43, 0x28, 0x59, 0x29, + 0x43, 0x28, 0x5A, 0x29, 0x43, 0x28, 0x61, 0x29, + 0x43, 0x28, 0x62, 0x29, 0x43, 0x28, 0x63, 0x29, + 0x43, 0x28, 0x64, 0x29, 0x43, 0x28, 0x65, 0x29, + 0x43, 0x28, 0x66, 0x29, 0x43, 0x28, 0x67, 0x29, + // Bytes 1c40 - 1c7f + 0x43, 0x28, 0x68, 0x29, 0x43, 0x28, 0x69, 0x29, + 0x43, 0x28, 0x6A, 0x29, 0x43, 0x28, 0x6B, 0x29, + 0x43, 0x28, 0x6C, 0x29, 0x43, 0x28, 0x6D, 0x29, + 0x43, 0x28, 0x6E, 0x29, 0x43, 0x28, 0x6F, 0x29, + 0x43, 0x28, 0x70, 0x29, 0x43, 0x28, 0x71, 0x29, + 0x43, 0x28, 0x72, 0x29, 0x43, 0x28, 0x73, 0x29, + 0x43, 0x28, 0x74, 0x29, 0x43, 0x28, 0x75, 0x29, + 0x43, 0x28, 0x76, 0x29, 0x43, 0x28, 0x77, 0x29, + // Bytes 1c80 - 1cbf + 0x43, 0x28, 0x78, 0x29, 0x43, 0x28, 0x79, 0x29, + 0x43, 0x28, 0x7A, 0x29, 0x43, 0x2E, 0x2E, 0x2E, + 0x43, 0x31, 0x30, 0x2E, 0x43, 0x31, 0x31, 0x2E, + 0x43, 0x31, 0x32, 0x2E, 0x43, 0x31, 0x33, 0x2E, + 0x43, 0x31, 0x34, 0x2E, 0x43, 0x31, 0x35, 0x2E, + 0x43, 0x31, 0x36, 0x2E, 0x43, 0x31, 0x37, 0x2E, + 0x43, 0x31, 0x38, 0x2E, 0x43, 0x31, 0x39, 0x2E, + 0x43, 0x32, 0x30, 0x2E, 0x43, 0x3A, 0x3A, 0x3D, + // Bytes 1cc0 - 1cff + 0x43, 0x3D, 0x3D, 0x3D, 0x43, 0x43, 0x6F, 0x2E, + 0x43, 0x46, 0x41, 0x58, 0x43, 0x47, 0x48, 0x7A, + 0x43, 0x47, 0x50, 0x61, 0x43, 0x49, 0x49, 0x49, + 0x43, 0x4C, 0x54, 0x44, 0x43, 0x4C, 0xC2, 0xB7, + 0x43, 0x4D, 0x48, 0x7A, 0x43, 0x4D, 0x50, 0x61, + 0x43, 0x4D, 0xCE, 0xA9, 0x43, 0x50, 0x50, 0x4D, + 0x43, 0x50, 0x50, 0x56, 0x43, 0x50, 0x54, 0x45, + 0x43, 0x54, 0x45, 0x4C, 0x43, 0x54, 0x48, 0x7A, + // Bytes 1d00 - 1d3f + 0x43, 0x56, 0x49, 0x49, 0x43, 0x58, 0x49, 0x49, + 0x43, 0x61, 0x2F, 0x63, 0x43, 0x61, 0x2F, 0x73, + 0x43, 0x61, 0xCA, 0xBE, 0x43, 0x62, 0x61, 0x72, + 0x43, 0x63, 0x2F, 0x6F, 0x43, 0x63, 0x2F, 0x75, + 0x43, 0x63, 0x61, 0x6C, 0x43, 0x63, 0x6D, 0x32, + 0x43, 0x63, 0x6D, 0x33, 0x43, 0x64, 0x6D, 0x32, + 0x43, 0x64, 0x6D, 0x33, 0x43, 0x65, 0x72, 0x67, + 0x43, 0x66, 0x66, 0x69, 0x43, 0x66, 0x66, 0x6C, + // Bytes 1d40 - 1d7f + 0x43, 0x67, 0x61, 0x6C, 0x43, 0x68, 0x50, 0x61, + 0x43, 0x69, 0x69, 0x69, 0x43, 0x6B, 0x48, 0x7A, + 0x43, 0x6B, 0x50, 0x61, 0x43, 0x6B, 0x6D, 0x32, + 0x43, 0x6B, 0x6D, 0x33, 0x43, 0x6B, 0xCE, 0xA9, + 0x43, 0x6C, 0x6F, 0x67, 0x43, 0x6C, 0xC2, 0xB7, + 0x43, 0x6D, 0x69, 0x6C, 0x43, 0x6D, 0x6D, 0x32, + 0x43, 0x6D, 0x6D, 0x33, 0x43, 0x6D, 0x6F, 0x6C, + 0x43, 0x72, 0x61, 0x64, 0x43, 0x76, 0x69, 0x69, + // Bytes 1d80 - 1dbf + 0x43, 0x78, 0x69, 0x69, 0x43, 0xC2, 0xB0, 0x43, + 0x43, 0xC2, 0xB0, 0x46, 0x43, 0xCA, 0xBC, 0x6E, + 0x43, 0xCE, 0xBC, 0x41, 0x43, 0xCE, 0xBC, 0x46, + 0x43, 0xCE, 0xBC, 0x56, 0x43, 0xCE, 0xBC, 0x57, + 0x43, 0xCE, 0xBC, 0x67, 0x43, 0xCE, 0xBC, 0x6C, + 0x43, 0xCE, 0xBC, 0x6D, 0x43, 0xCE, 0xBC, 0x73, + 0x44, 0x28, 0x31, 0x30, 0x29, 0x44, 0x28, 0x31, + 0x31, 0x29, 0x44, 0x28, 0x31, 0x32, 0x29, 0x44, + // Bytes 1dc0 - 1dff + 0x28, 0x31, 0x33, 0x29, 0x44, 0x28, 0x31, 0x34, + 0x29, 0x44, 0x28, 0x31, 0x35, 0x29, 0x44, 0x28, + 0x31, 0x36, 0x29, 0x44, 0x28, 0x31, 0x37, 0x29, + 0x44, 0x28, 0x31, 0x38, 0x29, 0x44, 0x28, 0x31, + 0x39, 0x29, 0x44, 0x28, 0x32, 0x30, 0x29, 0x44, + 0x30, 0xE7, 0x82, 0xB9, 0x44, 0x31, 0xE2, 0x81, + 0x84, 0x44, 0x31, 0xE6, 0x97, 0xA5, 0x44, 0x31, + 0xE6, 0x9C, 0x88, 0x44, 0x31, 0xE7, 0x82, 0xB9, + // Bytes 1e00 - 1e3f + 0x44, 0x32, 0xE6, 0x97, 0xA5, 0x44, 0x32, 0xE6, + 0x9C, 0x88, 0x44, 0x32, 0xE7, 0x82, 0xB9, 0x44, + 0x33, 0xE6, 0x97, 0xA5, 0x44, 0x33, 0xE6, 0x9C, + 0x88, 0x44, 0x33, 0xE7, 0x82, 0xB9, 0x44, 0x34, + 0xE6, 0x97, 0xA5, 0x44, 0x34, 0xE6, 0x9C, 0x88, + 0x44, 0x34, 0xE7, 0x82, 0xB9, 0x44, 0x35, 0xE6, + 0x97, 0xA5, 0x44, 0x35, 0xE6, 0x9C, 0x88, 0x44, + 0x35, 0xE7, 0x82, 0xB9, 0x44, 0x36, 0xE6, 0x97, + // Bytes 1e40 - 1e7f + 0xA5, 0x44, 0x36, 0xE6, 0x9C, 0x88, 0x44, 0x36, + 0xE7, 0x82, 0xB9, 0x44, 0x37, 0xE6, 0x97, 0xA5, + 0x44, 0x37, 0xE6, 0x9C, 0x88, 0x44, 0x37, 0xE7, + 0x82, 0xB9, 0x44, 0x38, 0xE6, 0x97, 0xA5, 0x44, + 0x38, 0xE6, 0x9C, 0x88, 0x44, 0x38, 0xE7, 0x82, + 0xB9, 0x44, 0x39, 0xE6, 0x97, 0xA5, 0x44, 0x39, + 0xE6, 0x9C, 0x88, 0x44, 0x39, 0xE7, 0x82, 0xB9, + 0x44, 0x56, 0x49, 0x49, 0x49, 0x44, 0x61, 0x2E, + // Bytes 1e80 - 1ebf + 0x6D, 0x2E, 0x44, 0x6B, 0x63, 0x61, 0x6C, 0x44, + 0x70, 0x2E, 0x6D, 0x2E, 0x44, 0x76, 0x69, 0x69, + 0x69, 0x44, 0xD5, 0xA5, 0xD6, 0x82, 0x44, 0xD5, + 0xB4, 0xD5, 0xA5, 0x44, 0xD5, 0xB4, 0xD5, 0xAB, + 0x44, 0xD5, 0xB4, 0xD5, 0xAD, 0x44, 0xD5, 0xB4, + 0xD5, 0xB6, 0x44, 0xD5, 0xBE, 0xD5, 0xB6, 0x44, + 0xD7, 0x90, 0xD7, 0x9C, 0x44, 0xD8, 0xA7, 0xD9, + 0xB4, 0x44, 0xD8, 0xA8, 0xD8, 0xAC, 0x44, 0xD8, + // Bytes 1ec0 - 1eff + 0xA8, 0xD8, 0xAD, 0x44, 0xD8, 0xA8, 0xD8, 0xAE, + 0x44, 0xD8, 0xA8, 0xD8, 0xB1, 0x44, 0xD8, 0xA8, + 0xD8, 0xB2, 0x44, 0xD8, 0xA8, 0xD9, 0x85, 0x44, + 0xD8, 0xA8, 0xD9, 0x86, 0x44, 0xD8, 0xA8, 0xD9, + 0x87, 0x44, 0xD8, 0xA8, 0xD9, 0x89, 0x44, 0xD8, + 0xA8, 0xD9, 0x8A, 0x44, 0xD8, 0xAA, 0xD8, 0xAC, + 0x44, 0xD8, 0xAA, 0xD8, 0xAD, 0x44, 0xD8, 0xAA, + 0xD8, 0xAE, 0x44, 0xD8, 0xAA, 0xD8, 0xB1, 0x44, + // Bytes 1f00 - 1f3f + 0xD8, 0xAA, 0xD8, 0xB2, 0x44, 0xD8, 0xAA, 0xD9, + 0x85, 0x44, 0xD8, 0xAA, 0xD9, 0x86, 0x44, 0xD8, + 0xAA, 0xD9, 0x87, 0x44, 0xD8, 0xAA, 0xD9, 0x89, + 0x44, 0xD8, 0xAA, 0xD9, 0x8A, 0x44, 0xD8, 0xAB, + 0xD8, 0xAC, 0x44, 0xD8, 0xAB, 0xD8, 0xB1, 0x44, + 0xD8, 0xAB, 0xD8, 0xB2, 0x44, 0xD8, 0xAB, 0xD9, + 0x85, 0x44, 0xD8, 0xAB, 0xD9, 0x86, 0x44, 0xD8, + 0xAB, 0xD9, 0x87, 0x44, 0xD8, 0xAB, 0xD9, 0x89, + // Bytes 1f40 - 1f7f + 0x44, 0xD8, 0xAB, 0xD9, 0x8A, 0x44, 0xD8, 0xAC, + 0xD8, 0xAD, 0x44, 0xD8, 0xAC, 0xD9, 0x85, 0x44, + 0xD8, 0xAC, 0xD9, 0x89, 0x44, 0xD8, 0xAC, 0xD9, + 0x8A, 0x44, 0xD8, 0xAD, 0xD8, 0xAC, 0x44, 0xD8, + 0xAD, 0xD9, 0x85, 0x44, 0xD8, 0xAD, 0xD9, 0x89, + 0x44, 0xD8, 0xAD, 0xD9, 0x8A, 0x44, 0xD8, 0xAE, + 0xD8, 0xAC, 0x44, 0xD8, 0xAE, 0xD8, 0xAD, 0x44, + 0xD8, 0xAE, 0xD9, 0x85, 0x44, 0xD8, 0xAE, 0xD9, + // Bytes 1f80 - 1fbf + 0x89, 0x44, 0xD8, 0xAE, 0xD9, 0x8A, 0x44, 0xD8, + 0xB3, 0xD8, 0xAC, 0x44, 0xD8, 0xB3, 0xD8, 0xAD, + 0x44, 0xD8, 0xB3, 0xD8, 0xAE, 0x44, 0xD8, 0xB3, + 0xD8, 0xB1, 0x44, 0xD8, 0xB3, 0xD9, 0x85, 0x44, + 0xD8, 0xB3, 0xD9, 0x87, 0x44, 0xD8, 0xB3, 0xD9, + 0x89, 0x44, 0xD8, 0xB3, 0xD9, 0x8A, 0x44, 0xD8, + 0xB4, 0xD8, 0xAC, 0x44, 0xD8, 0xB4, 0xD8, 0xAD, + 0x44, 0xD8, 0xB4, 0xD8, 0xAE, 0x44, 0xD8, 0xB4, + // Bytes 1fc0 - 1fff + 0xD8, 0xB1, 0x44, 0xD8, 0xB4, 0xD9, 0x85, 0x44, + 0xD8, 0xB4, 0xD9, 0x87, 0x44, 0xD8, 0xB4, 0xD9, + 0x89, 0x44, 0xD8, 0xB4, 0xD9, 0x8A, 0x44, 0xD8, + 0xB5, 0xD8, 0xAD, 0x44, 0xD8, 0xB5, 0xD8, 0xAE, + 0x44, 0xD8, 0xB5, 0xD8, 0xB1, 0x44, 0xD8, 0xB5, + 0xD9, 0x85, 0x44, 0xD8, 0xB5, 0xD9, 0x89, 0x44, + 0xD8, 0xB5, 0xD9, 0x8A, 0x44, 0xD8, 0xB6, 0xD8, + 0xAC, 0x44, 0xD8, 0xB6, 0xD8, 0xAD, 0x44, 0xD8, + // Bytes 2000 - 203f + 0xB6, 0xD8, 0xAE, 0x44, 0xD8, 0xB6, 0xD8, 0xB1, + 0x44, 0xD8, 0xB6, 0xD9, 0x85, 0x44, 0xD8, 0xB6, + 0xD9, 0x89, 0x44, 0xD8, 0xB6, 0xD9, 0x8A, 0x44, + 0xD8, 0xB7, 0xD8, 0xAD, 0x44, 0xD8, 0xB7, 0xD9, + 0x85, 0x44, 0xD8, 0xB7, 0xD9, 0x89, 0x44, 0xD8, + 0xB7, 0xD9, 0x8A, 0x44, 0xD8, 0xB8, 0xD9, 0x85, + 0x44, 0xD8, 0xB9, 0xD8, 0xAC, 0x44, 0xD8, 0xB9, + 0xD9, 0x85, 0x44, 0xD8, 0xB9, 0xD9, 0x89, 0x44, + // Bytes 2040 - 207f + 0xD8, 0xB9, 0xD9, 0x8A, 0x44, 0xD8, 0xBA, 0xD8, + 0xAC, 0x44, 0xD8, 0xBA, 0xD9, 0x85, 0x44, 0xD8, + 0xBA, 0xD9, 0x89, 0x44, 0xD8, 0xBA, 0xD9, 0x8A, + 0x44, 0xD9, 0x81, 0xD8, 0xAC, 0x44, 0xD9, 0x81, + 0xD8, 0xAD, 0x44, 0xD9, 0x81, 0xD8, 0xAE, 0x44, + 0xD9, 0x81, 0xD9, 0x85, 0x44, 0xD9, 0x81, 0xD9, + 0x89, 0x44, 0xD9, 0x81, 0xD9, 0x8A, 0x44, 0xD9, + 0x82, 0xD8, 0xAD, 0x44, 0xD9, 0x82, 0xD9, 0x85, + // Bytes 2080 - 20bf + 0x44, 0xD9, 0x82, 0xD9, 0x89, 0x44, 0xD9, 0x82, + 0xD9, 0x8A, 0x44, 0xD9, 0x83, 0xD8, 0xA7, 0x44, + 0xD9, 0x83, 0xD8, 0xAC, 0x44, 0xD9, 0x83, 0xD8, + 0xAD, 0x44, 0xD9, 0x83, 0xD8, 0xAE, 0x44, 0xD9, + 0x83, 0xD9, 0x84, 0x44, 0xD9, 0x83, 0xD9, 0x85, + 0x44, 0xD9, 0x83, 0xD9, 0x89, 0x44, 0xD9, 0x83, + 0xD9, 0x8A, 0x44, 0xD9, 0x84, 0xD8, 0xA7, 0x44, + 0xD9, 0x84, 0xD8, 0xAC, 0x44, 0xD9, 0x84, 0xD8, + // Bytes 20c0 - 20ff + 0xAD, 0x44, 0xD9, 0x84, 0xD8, 0xAE, 0x44, 0xD9, + 0x84, 0xD9, 0x85, 0x44, 0xD9, 0x84, 0xD9, 0x87, + 0x44, 0xD9, 0x84, 0xD9, 0x89, 0x44, 0xD9, 0x84, + 0xD9, 0x8A, 0x44, 0xD9, 0x85, 0xD8, 0xA7, 0x44, + 0xD9, 0x85, 0xD8, 0xAC, 0x44, 0xD9, 0x85, 0xD8, + 0xAD, 0x44, 0xD9, 0x85, 0xD8, 0xAE, 0x44, 0xD9, + 0x85, 0xD9, 0x85, 0x44, 0xD9, 0x85, 0xD9, 0x89, + 0x44, 0xD9, 0x85, 0xD9, 0x8A, 0x44, 0xD9, 0x86, + // Bytes 2100 - 213f + 0xD8, 0xAC, 0x44, 0xD9, 0x86, 0xD8, 0xAD, 0x44, + 0xD9, 0x86, 0xD8, 0xAE, 0x44, 0xD9, 0x86, 0xD8, + 0xB1, 0x44, 0xD9, 0x86, 0xD8, 0xB2, 0x44, 0xD9, + 0x86, 0xD9, 0x85, 0x44, 0xD9, 0x86, 0xD9, 0x86, + 0x44, 0xD9, 0x86, 0xD9, 0x87, 0x44, 0xD9, 0x86, + 0xD9, 0x89, 0x44, 0xD9, 0x86, 0xD9, 0x8A, 0x44, + 0xD9, 0x87, 0xD8, 0xAC, 0x44, 0xD9, 0x87, 0xD9, + 0x85, 0x44, 0xD9, 0x87, 0xD9, 0x89, 0x44, 0xD9, + // Bytes 2140 - 217f + 0x87, 0xD9, 0x8A, 0x44, 0xD9, 0x88, 0xD9, 0xB4, + 0x44, 0xD9, 0x8A, 0xD8, 0xAC, 0x44, 0xD9, 0x8A, + 0xD8, 0xAD, 0x44, 0xD9, 0x8A, 0xD8, 0xAE, 0x44, + 0xD9, 0x8A, 0xD8, 0xB1, 0x44, 0xD9, 0x8A, 0xD8, + 0xB2, 0x44, 0xD9, 0x8A, 0xD9, 0x85, 0x44, 0xD9, + 0x8A, 0xD9, 0x86, 0x44, 0xD9, 0x8A, 0xD9, 0x87, + 0x44, 0xD9, 0x8A, 0xD9, 0x89, 0x44, 0xD9, 0x8A, + 0xD9, 0x8A, 0x44, 0xD9, 0x8A, 0xD9, 0xB4, 0x44, + // Bytes 2180 - 21bf + 0xDB, 0x87, 0xD9, 0xB4, 0x45, 0x28, 0xE1, 0x84, + 0x80, 0x29, 0x45, 0x28, 0xE1, 0x84, 0x82, 0x29, + 0x45, 0x28, 0xE1, 0x84, 0x83, 0x29, 0x45, 0x28, + 0xE1, 0x84, 0x85, 0x29, 0x45, 0x28, 0xE1, 0x84, + 0x86, 0x29, 0x45, 0x28, 0xE1, 0x84, 0x87, 0x29, + 0x45, 0x28, 0xE1, 0x84, 0x89, 0x29, 0x45, 0x28, + 0xE1, 0x84, 0x8B, 0x29, 0x45, 0x28, 0xE1, 0x84, + 0x8C, 0x29, 0x45, 0x28, 0xE1, 0x84, 0x8E, 0x29, + // Bytes 21c0 - 21ff + 0x45, 0x28, 0xE1, 0x84, 0x8F, 0x29, 0x45, 0x28, + 0xE1, 0x84, 0x90, 0x29, 0x45, 0x28, 0xE1, 0x84, + 0x91, 0x29, 0x45, 0x28, 0xE1, 0x84, 0x92, 0x29, + 0x45, 0x28, 0xE4, 0xB8, 0x80, 0x29, 0x45, 0x28, + 0xE4, 0xB8, 0x83, 0x29, 0x45, 0x28, 0xE4, 0xB8, + 0x89, 0x29, 0x45, 0x28, 0xE4, 0xB9, 0x9D, 0x29, + 0x45, 0x28, 0xE4, 0xBA, 0x8C, 0x29, 0x45, 0x28, + 0xE4, 0xBA, 0x94, 0x29, 0x45, 0x28, 0xE4, 0xBB, + // Bytes 2200 - 223f + 0xA3, 0x29, 0x45, 0x28, 0xE4, 0xBC, 0x81, 0x29, + 0x45, 0x28, 0xE4, 0xBC, 0x91, 0x29, 0x45, 0x28, + 0xE5, 0x85, 0xAB, 0x29, 0x45, 0x28, 0xE5, 0x85, + 0xAD, 0x29, 0x45, 0x28, 0xE5, 0x8A, 0xB4, 0x29, + 0x45, 0x28, 0xE5, 0x8D, 0x81, 0x29, 0x45, 0x28, + 0xE5, 0x8D, 0x94, 0x29, 0x45, 0x28, 0xE5, 0x90, + 0x8D, 0x29, 0x45, 0x28, 0xE5, 0x91, 0xBC, 0x29, + 0x45, 0x28, 0xE5, 0x9B, 0x9B, 0x29, 0x45, 0x28, + // Bytes 2240 - 227f + 0xE5, 0x9C, 0x9F, 0x29, 0x45, 0x28, 0xE5, 0xAD, + 0xA6, 0x29, 0x45, 0x28, 0xE6, 0x97, 0xA5, 0x29, + 0x45, 0x28, 0xE6, 0x9C, 0x88, 0x29, 0x45, 0x28, + 0xE6, 0x9C, 0x89, 0x29, 0x45, 0x28, 0xE6, 0x9C, + 0xA8, 0x29, 0x45, 0x28, 0xE6, 0xA0, 0xAA, 0x29, + 0x45, 0x28, 0xE6, 0xB0, 0xB4, 0x29, 0x45, 0x28, + 0xE7, 0x81, 0xAB, 0x29, 0x45, 0x28, 0xE7, 0x89, + 0xB9, 0x29, 0x45, 0x28, 0xE7, 0x9B, 0xA3, 0x29, + // Bytes 2280 - 22bf + 0x45, 0x28, 0xE7, 0xA4, 0xBE, 0x29, 0x45, 0x28, + 0xE7, 0xA5, 0x9D, 0x29, 0x45, 0x28, 0xE7, 0xA5, + 0xAD, 0x29, 0x45, 0x28, 0xE8, 0x87, 0xAA, 0x29, + 0x45, 0x28, 0xE8, 0x87, 0xB3, 0x29, 0x45, 0x28, + 0xE8, 0xB2, 0xA1, 0x29, 0x45, 0x28, 0xE8, 0xB3, + 0x87, 0x29, 0x45, 0x28, 0xE9, 0x87, 0x91, 0x29, + 0x45, 0x30, 0xE2, 0x81, 0x84, 0x33, 0x45, 0x31, + 0x30, 0xE6, 0x97, 0xA5, 0x45, 0x31, 0x30, 0xE6, + // Bytes 22c0 - 22ff + 0x9C, 0x88, 0x45, 0x31, 0x30, 0xE7, 0x82, 0xB9, + 0x45, 0x31, 0x31, 0xE6, 0x97, 0xA5, 0x45, 0x31, + 0x31, 0xE6, 0x9C, 0x88, 0x45, 0x31, 0x31, 0xE7, + 0x82, 0xB9, 0x45, 0x31, 0x32, 0xE6, 0x97, 0xA5, + 0x45, 0x31, 0x32, 0xE6, 0x9C, 0x88, 0x45, 0x31, + 0x32, 0xE7, 0x82, 0xB9, 0x45, 0x31, 0x33, 0xE6, + 0x97, 0xA5, 0x45, 0x31, 0x33, 0xE7, 0x82, 0xB9, + 0x45, 0x31, 0x34, 0xE6, 0x97, 0xA5, 0x45, 0x31, + // Bytes 2300 - 233f + 0x34, 0xE7, 0x82, 0xB9, 0x45, 0x31, 0x35, 0xE6, + 0x97, 0xA5, 0x45, 0x31, 0x35, 0xE7, 0x82, 0xB9, + 0x45, 0x31, 0x36, 0xE6, 0x97, 0xA5, 0x45, 0x31, + 0x36, 0xE7, 0x82, 0xB9, 0x45, 0x31, 0x37, 0xE6, + 0x97, 0xA5, 0x45, 0x31, 0x37, 0xE7, 0x82, 0xB9, + 0x45, 0x31, 0x38, 0xE6, 0x97, 0xA5, 0x45, 0x31, + 0x38, 0xE7, 0x82, 0xB9, 0x45, 0x31, 0x39, 0xE6, + 0x97, 0xA5, 0x45, 0x31, 0x39, 0xE7, 0x82, 0xB9, + // Bytes 2340 - 237f + 0x45, 0x31, 0xE2, 0x81, 0x84, 0x32, 0x45, 0x31, + 0xE2, 0x81, 0x84, 0x33, 0x45, 0x31, 0xE2, 0x81, + 0x84, 0x34, 0x45, 0x31, 0xE2, 0x81, 0x84, 0x35, + 0x45, 0x31, 0xE2, 0x81, 0x84, 0x36, 0x45, 0x31, + 0xE2, 0x81, 0x84, 0x37, 0x45, 0x31, 0xE2, 0x81, + 0x84, 0x38, 0x45, 0x31, 0xE2, 0x81, 0x84, 0x39, + 0x45, 0x32, 0x30, 0xE6, 0x97, 0xA5, 0x45, 0x32, + 0x30, 0xE7, 0x82, 0xB9, 0x45, 0x32, 0x31, 0xE6, + // Bytes 2380 - 23bf + 0x97, 0xA5, 0x45, 0x32, 0x31, 0xE7, 0x82, 0xB9, + 0x45, 0x32, 0x32, 0xE6, 0x97, 0xA5, 0x45, 0x32, + 0x32, 0xE7, 0x82, 0xB9, 0x45, 0x32, 0x33, 0xE6, + 0x97, 0xA5, 0x45, 0x32, 0x33, 0xE7, 0x82, 0xB9, + 0x45, 0x32, 0x34, 0xE6, 0x97, 0xA5, 0x45, 0x32, + 0x34, 0xE7, 0x82, 0xB9, 0x45, 0x32, 0x35, 0xE6, + 0x97, 0xA5, 0x45, 0x32, 0x36, 0xE6, 0x97, 0xA5, + 0x45, 0x32, 0x37, 0xE6, 0x97, 0xA5, 0x45, 0x32, + // Bytes 23c0 - 23ff + 0x38, 0xE6, 0x97, 0xA5, 0x45, 0x32, 0x39, 0xE6, + 0x97, 0xA5, 0x45, 0x32, 0xE2, 0x81, 0x84, 0x33, + 0x45, 0x32, 0xE2, 0x81, 0x84, 0x35, 0x45, 0x33, + 0x30, 0xE6, 0x97, 0xA5, 0x45, 0x33, 0x31, 0xE6, + 0x97, 0xA5, 0x45, 0x33, 0xE2, 0x81, 0x84, 0x34, + 0x45, 0x33, 0xE2, 0x81, 0x84, 0x35, 0x45, 0x33, + 0xE2, 0x81, 0x84, 0x38, 0x45, 0x34, 0xE2, 0x81, + 0x84, 0x35, 0x45, 0x35, 0xE2, 0x81, 0x84, 0x36, + // Bytes 2400 - 243f + 0x45, 0x35, 0xE2, 0x81, 0x84, 0x38, 0x45, 0x37, + 0xE2, 0x81, 0x84, 0x38, 0x45, 0x41, 0xE2, 0x88, + 0x95, 0x6D, 0x45, 0x56, 0xE2, 0x88, 0x95, 0x6D, + 0x45, 0x6D, 0xE2, 0x88, 0x95, 0x73, 0x46, 0x31, + 0xE2, 0x81, 0x84, 0x31, 0x30, 0x46, 0x43, 0xE2, + 0x88, 0x95, 0x6B, 0x67, 0x46, 0x6D, 0xE2, 0x88, + 0x95, 0x73, 0x32, 0x46, 0xD8, 0xA8, 0xD8, 0xAD, + 0xD9, 0x8A, 0x46, 0xD8, 0xA8, 0xD8, 0xAE, 0xD9, + // Bytes 2440 - 247f + 0x8A, 0x46, 0xD8, 0xAA, 0xD8, 0xAC, 0xD9, 0x85, + 0x46, 0xD8, 0xAA, 0xD8, 0xAC, 0xD9, 0x89, 0x46, + 0xD8, 0xAA, 0xD8, 0xAC, 0xD9, 0x8A, 0x46, 0xD8, + 0xAA, 0xD8, 0xAD, 0xD8, 0xAC, 0x46, 0xD8, 0xAA, + 0xD8, 0xAD, 0xD9, 0x85, 0x46, 0xD8, 0xAA, 0xD8, + 0xAE, 0xD9, 0x85, 0x46, 0xD8, 0xAA, 0xD8, 0xAE, + 0xD9, 0x89, 0x46, 0xD8, 0xAA, 0xD8, 0xAE, 0xD9, + 0x8A, 0x46, 0xD8, 0xAA, 0xD9, 0x85, 0xD8, 0xAC, + // Bytes 2480 - 24bf + 0x46, 0xD8, 0xAA, 0xD9, 0x85, 0xD8, 0xAD, 0x46, + 0xD8, 0xAA, 0xD9, 0x85, 0xD8, 0xAE, 0x46, 0xD8, + 0xAA, 0xD9, 0x85, 0xD9, 0x89, 0x46, 0xD8, 0xAA, + 0xD9, 0x85, 0xD9, 0x8A, 0x46, 0xD8, 0xAC, 0xD8, + 0xAD, 0xD9, 0x89, 0x46, 0xD8, 0xAC, 0xD8, 0xAD, + 0xD9, 0x8A, 0x46, 0xD8, 0xAC, 0xD9, 0x85, 0xD8, + 0xAD, 0x46, 0xD8, 0xAC, 0xD9, 0x85, 0xD9, 0x89, + 0x46, 0xD8, 0xAC, 0xD9, 0x85, 0xD9, 0x8A, 0x46, + // Bytes 24c0 - 24ff + 0xD8, 0xAD, 0xD8, 0xAC, 0xD9, 0x8A, 0x46, 0xD8, + 0xAD, 0xD9, 0x85, 0xD9, 0x89, 0x46, 0xD8, 0xAD, + 0xD9, 0x85, 0xD9, 0x8A, 0x46, 0xD8, 0xB3, 0xD8, + 0xAC, 0xD8, 0xAD, 0x46, 0xD8, 0xB3, 0xD8, 0xAC, + 0xD9, 0x89, 0x46, 0xD8, 0xB3, 0xD8, 0xAD, 0xD8, + 0xAC, 0x46, 0xD8, 0xB3, 0xD8, 0xAE, 0xD9, 0x89, + 0x46, 0xD8, 0xB3, 0xD8, 0xAE, 0xD9, 0x8A, 0x46, + 0xD8, 0xB3, 0xD9, 0x85, 0xD8, 0xAC, 0x46, 0xD8, + // Bytes 2500 - 253f + 0xB3, 0xD9, 0x85, 0xD8, 0xAD, 0x46, 0xD8, 0xB3, + 0xD9, 0x85, 0xD9, 0x85, 0x46, 0xD8, 0xB4, 0xD8, + 0xAC, 0xD9, 0x8A, 0x46, 0xD8, 0xB4, 0xD8, 0xAD, + 0xD9, 0x85, 0x46, 0xD8, 0xB4, 0xD8, 0xAD, 0xD9, + 0x8A, 0x46, 0xD8, 0xB4, 0xD9, 0x85, 0xD8, 0xAE, + 0x46, 0xD8, 0xB4, 0xD9, 0x85, 0xD9, 0x85, 0x46, + 0xD8, 0xB5, 0xD8, 0xAD, 0xD8, 0xAD, 0x46, 0xD8, + 0xB5, 0xD8, 0xAD, 0xD9, 0x8A, 0x46, 0xD8, 0xB5, + // Bytes 2540 - 257f + 0xD9, 0x84, 0xD9, 0x89, 0x46, 0xD8, 0xB5, 0xD9, + 0x84, 0xDB, 0x92, 0x46, 0xD8, 0xB5, 0xD9, 0x85, + 0xD9, 0x85, 0x46, 0xD8, 0xB6, 0xD8, 0xAD, 0xD9, + 0x89, 0x46, 0xD8, 0xB6, 0xD8, 0xAD, 0xD9, 0x8A, + 0x46, 0xD8, 0xB6, 0xD8, 0xAE, 0xD9, 0x85, 0x46, + 0xD8, 0xB7, 0xD9, 0x85, 0xD8, 0xAD, 0x46, 0xD8, + 0xB7, 0xD9, 0x85, 0xD9, 0x85, 0x46, 0xD8, 0xB7, + 0xD9, 0x85, 0xD9, 0x8A, 0x46, 0xD8, 0xB9, 0xD8, + // Bytes 2580 - 25bf + 0xAC, 0xD9, 0x85, 0x46, 0xD8, 0xB9, 0xD9, 0x85, + 0xD9, 0x85, 0x46, 0xD8, 0xB9, 0xD9, 0x85, 0xD9, + 0x89, 0x46, 0xD8, 0xB9, 0xD9, 0x85, 0xD9, 0x8A, + 0x46, 0xD8, 0xBA, 0xD9, 0x85, 0xD9, 0x85, 0x46, + 0xD8, 0xBA, 0xD9, 0x85, 0xD9, 0x89, 0x46, 0xD8, + 0xBA, 0xD9, 0x85, 0xD9, 0x8A, 0x46, 0xD9, 0x81, + 0xD8, 0xAE, 0xD9, 0x85, 0x46, 0xD9, 0x81, 0xD9, + 0x85, 0xD9, 0x8A, 0x46, 0xD9, 0x82, 0xD9, 0x84, + // Bytes 25c0 - 25ff + 0xDB, 0x92, 0x46, 0xD9, 0x82, 0xD9, 0x85, 0xD8, + 0xAD, 0x46, 0xD9, 0x82, 0xD9, 0x85, 0xD9, 0x85, + 0x46, 0xD9, 0x82, 0xD9, 0x85, 0xD9, 0x8A, 0x46, + 0xD9, 0x83, 0xD9, 0x85, 0xD9, 0x85, 0x46, 0xD9, + 0x83, 0xD9, 0x85, 0xD9, 0x8A, 0x46, 0xD9, 0x84, + 0xD8, 0xAC, 0xD8, 0xAC, 0x46, 0xD9, 0x84, 0xD8, + 0xAC, 0xD9, 0x85, 0x46, 0xD9, 0x84, 0xD8, 0xAC, + 0xD9, 0x8A, 0x46, 0xD9, 0x84, 0xD8, 0xAD, 0xD9, + // Bytes 2600 - 263f + 0x85, 0x46, 0xD9, 0x84, 0xD8, 0xAD, 0xD9, 0x89, + 0x46, 0xD9, 0x84, 0xD8, 0xAD, 0xD9, 0x8A, 0x46, + 0xD9, 0x84, 0xD8, 0xAE, 0xD9, 0x85, 0x46, 0xD9, + 0x84, 0xD9, 0x85, 0xD8, 0xAD, 0x46, 0xD9, 0x84, + 0xD9, 0x85, 0xD9, 0x8A, 0x46, 0xD9, 0x85, 0xD8, + 0xAC, 0xD8, 0xAD, 0x46, 0xD9, 0x85, 0xD8, 0xAC, + 0xD8, 0xAE, 0x46, 0xD9, 0x85, 0xD8, 0xAC, 0xD9, + 0x85, 0x46, 0xD9, 0x85, 0xD8, 0xAC, 0xD9, 0x8A, + // Bytes 2640 - 267f + 0x46, 0xD9, 0x85, 0xD8, 0xAD, 0xD8, 0xAC, 0x46, + 0xD9, 0x85, 0xD8, 0xAD, 0xD9, 0x85, 0x46, 0xD9, + 0x85, 0xD8, 0xAD, 0xD9, 0x8A, 0x46, 0xD9, 0x85, + 0xD8, 0xAE, 0xD8, 0xAC, 0x46, 0xD9, 0x85, 0xD8, + 0xAE, 0xD9, 0x85, 0x46, 0xD9, 0x85, 0xD8, 0xAE, + 0xD9, 0x8A, 0x46, 0xD9, 0x85, 0xD9, 0x85, 0xD9, + 0x8A, 0x46, 0xD9, 0x86, 0xD8, 0xAC, 0xD8, 0xAD, + 0x46, 0xD9, 0x86, 0xD8, 0xAC, 0xD9, 0x85, 0x46, + // Bytes 2680 - 26bf + 0xD9, 0x86, 0xD8, 0xAC, 0xD9, 0x89, 0x46, 0xD9, + 0x86, 0xD8, 0xAC, 0xD9, 0x8A, 0x46, 0xD9, 0x86, + 0xD8, 0xAD, 0xD9, 0x85, 0x46, 0xD9, 0x86, 0xD8, + 0xAD, 0xD9, 0x89, 0x46, 0xD9, 0x86, 0xD8, 0xAD, + 0xD9, 0x8A, 0x46, 0xD9, 0x86, 0xD9, 0x85, 0xD9, + 0x89, 0x46, 0xD9, 0x86, 0xD9, 0x85, 0xD9, 0x8A, + 0x46, 0xD9, 0x87, 0xD9, 0x85, 0xD8, 0xAC, 0x46, + 0xD9, 0x87, 0xD9, 0x85, 0xD9, 0x85, 0x46, 0xD9, + // Bytes 26c0 - 26ff + 0x8A, 0xD8, 0xAC, 0xD9, 0x8A, 0x46, 0xD9, 0x8A, + 0xD8, 0xAD, 0xD9, 0x8A, 0x46, 0xD9, 0x8A, 0xD9, + 0x85, 0xD9, 0x85, 0x46, 0xD9, 0x8A, 0xD9, 0x85, + 0xD9, 0x8A, 0x46, 0xD9, 0x8A, 0xD9, 0x94, 0xD8, + 0xA7, 0x46, 0xD9, 0x8A, 0xD9, 0x94, 0xD8, 0xAC, + 0x46, 0xD9, 0x8A, 0xD9, 0x94, 0xD8, 0xAD, 0x46, + 0xD9, 0x8A, 0xD9, 0x94, 0xD8, 0xAE, 0x46, 0xD9, + 0x8A, 0xD9, 0x94, 0xD8, 0xB1, 0x46, 0xD9, 0x8A, + // Bytes 2700 - 273f + 0xD9, 0x94, 0xD8, 0xB2, 0x46, 0xD9, 0x8A, 0xD9, + 0x94, 0xD9, 0x85, 0x46, 0xD9, 0x8A, 0xD9, 0x94, + 0xD9, 0x86, 0x46, 0xD9, 0x8A, 0xD9, 0x94, 0xD9, + 0x87, 0x46, 0xD9, 0x8A, 0xD9, 0x94, 0xD9, 0x88, + 0x46, 0xD9, 0x8A, 0xD9, 0x94, 0xD9, 0x89, 0x46, + 0xD9, 0x8A, 0xD9, 0x94, 0xD9, 0x8A, 0x46, 0xD9, + 0x8A, 0xD9, 0x94, 0xDB, 0x86, 0x46, 0xD9, 0x8A, + 0xD9, 0x94, 0xDB, 0x87, 0x46, 0xD9, 0x8A, 0xD9, + // Bytes 2740 - 277f + 0x94, 0xDB, 0x88, 0x46, 0xD9, 0x8A, 0xD9, 0x94, + 0xDB, 0x90, 0x46, 0xD9, 0x8A, 0xD9, 0x94, 0xDB, + 0x95, 0x46, 0xE0, 0xB9, 0x8D, 0xE0, 0xB8, 0xB2, + 0x46, 0xE0, 0xBA, 0xAB, 0xE0, 0xBA, 0x99, 0x46, + 0xE0, 0xBA, 0xAB, 0xE0, 0xBA, 0xA1, 0x46, 0xE0, + 0xBB, 0x8D, 0xE0, 0xBA, 0xB2, 0x46, 0xE0, 0xBD, + 0x80, 0xE0, 0xBE, 0xB5, 0x46, 0xE0, 0xBD, 0x82, + 0xE0, 0xBE, 0xB7, 0x46, 0xE0, 0xBD, 0x8C, 0xE0, + // Bytes 2780 - 27bf + 0xBE, 0xB7, 0x46, 0xE0, 0xBD, 0x91, 0xE0, 0xBE, + 0xB7, 0x46, 0xE0, 0xBD, 0x96, 0xE0, 0xBE, 0xB7, + 0x46, 0xE0, 0xBD, 0x9B, 0xE0, 0xBE, 0xB7, 0x46, + 0xE0, 0xBE, 0x90, 0xE0, 0xBE, 0xB5, 0x46, 0xE0, + 0xBE, 0x92, 0xE0, 0xBE, 0xB7, 0x46, 0xE0, 0xBE, + 0x9C, 0xE0, 0xBE, 0xB7, 0x46, 0xE0, 0xBE, 0xA1, + 0xE0, 0xBE, 0xB7, 0x46, 0xE0, 0xBE, 0xA6, 0xE0, + 0xBE, 0xB7, 0x46, 0xE0, 0xBE, 0xAB, 0xE0, 0xBE, + // Bytes 27c0 - 27ff + 0xB7, 0x46, 0xE2, 0x80, 0xB2, 0xE2, 0x80, 0xB2, + 0x46, 0xE2, 0x80, 0xB5, 0xE2, 0x80, 0xB5, 0x46, + 0xE2, 0x88, 0xAB, 0xE2, 0x88, 0xAB, 0x46, 0xE2, + 0x88, 0xAE, 0xE2, 0x88, 0xAE, 0x46, 0xE3, 0x81, + 0xBB, 0xE3, 0x81, 0x8B, 0x46, 0xE3, 0x82, 0x88, + 0xE3, 0x82, 0x8A, 0x46, 0xE3, 0x82, 0xAD, 0xE3, + 0x83, 0xAD, 0x46, 0xE3, 0x82, 0xB3, 0xE3, 0x82, + 0xB3, 0x46, 0xE3, 0x82, 0xB3, 0xE3, 0x83, 0x88, + // Bytes 2800 - 283f + 0x46, 0xE3, 0x83, 0x88, 0xE3, 0x83, 0xB3, 0x46, + 0xE3, 0x83, 0x8A, 0xE3, 0x83, 0x8E, 0x46, 0xE3, + 0x83, 0x9B, 0xE3, 0x83, 0xB3, 0x46, 0xE3, 0x83, + 0x9F, 0xE3, 0x83, 0xAA, 0x46, 0xE3, 0x83, 0xAA, + 0xE3, 0x83, 0xA9, 0x46, 0xE3, 0x83, 0xAC, 0xE3, + 0x83, 0xA0, 0x46, 0xE4, 0xBB, 0xA4, 0xE5, 0x92, + 0x8C, 0x46, 0xE5, 0xA4, 0xA7, 0xE6, 0xAD, 0xA3, + 0x46, 0xE5, 0xB9, 0xB3, 0xE6, 0x88, 0x90, 0x46, + // Bytes 2840 - 287f + 0xE6, 0x98, 0x8E, 0xE6, 0xB2, 0xBB, 0x46, 0xE6, + 0x98, 0xAD, 0xE5, 0x92, 0x8C, 0x47, 0x72, 0x61, + 0x64, 0xE2, 0x88, 0x95, 0x73, 0x47, 0xE3, 0x80, + 0x94, 0x53, 0xE3, 0x80, 0x95, 0x48, 0x28, 0xE1, + 0x84, 0x80, 0xE1, 0x85, 0xA1, 0x29, 0x48, 0x28, + 0xE1, 0x84, 0x82, 0xE1, 0x85, 0xA1, 0x29, 0x48, + 0x28, 0xE1, 0x84, 0x83, 0xE1, 0x85, 0xA1, 0x29, + 0x48, 0x28, 0xE1, 0x84, 0x85, 0xE1, 0x85, 0xA1, + // Bytes 2880 - 28bf + 0x29, 0x48, 0x28, 0xE1, 0x84, 0x86, 0xE1, 0x85, + 0xA1, 0x29, 0x48, 0x28, 0xE1, 0x84, 0x87, 0xE1, + 0x85, 0xA1, 0x29, 0x48, 0x28, 0xE1, 0x84, 0x89, + 0xE1, 0x85, 0xA1, 0x29, 0x48, 0x28, 0xE1, 0x84, + 0x8B, 0xE1, 0x85, 0xA1, 0x29, 0x48, 0x28, 0xE1, + 0x84, 0x8C, 0xE1, 0x85, 0xA1, 0x29, 0x48, 0x28, + 0xE1, 0x84, 0x8C, 0xE1, 0x85, 0xAE, 0x29, 0x48, + 0x28, 0xE1, 0x84, 0x8E, 0xE1, 0x85, 0xA1, 0x29, + // Bytes 28c0 - 28ff + 0x48, 0x28, 0xE1, 0x84, 0x8F, 0xE1, 0x85, 0xA1, + 0x29, 0x48, 0x28, 0xE1, 0x84, 0x90, 0xE1, 0x85, + 0xA1, 0x29, 0x48, 0x28, 0xE1, 0x84, 0x91, 0xE1, + 0x85, 0xA1, 0x29, 0x48, 0x28, 0xE1, 0x84, 0x92, + 0xE1, 0x85, 0xA1, 0x29, 0x48, 0x72, 0x61, 0x64, + 0xE2, 0x88, 0x95, 0x73, 0x32, 0x48, 0xD8, 0xA7, + 0xD9, 0x83, 0xD8, 0xA8, 0xD8, 0xB1, 0x48, 0xD8, + 0xA7, 0xD9, 0x84, 0xD9, 0x84, 0xD9, 0x87, 0x48, + // Bytes 2900 - 293f + 0xD8, 0xB1, 0xD8, 0xB3, 0xD9, 0x88, 0xD9, 0x84, + 0x48, 0xD8, 0xB1, 0xDB, 0x8C, 0xD8, 0xA7, 0xD9, + 0x84, 0x48, 0xD8, 0xB5, 0xD9, 0x84, 0xD8, 0xB9, + 0xD9, 0x85, 0x48, 0xD8, 0xB9, 0xD9, 0x84, 0xD9, + 0x8A, 0xD9, 0x87, 0x48, 0xD9, 0x85, 0xD8, 0xAD, + 0xD9, 0x85, 0xD8, 0xAF, 0x48, 0xD9, 0x88, 0xD8, + 0xB3, 0xD9, 0x84, 0xD9, 0x85, 0x49, 0xE2, 0x80, + 0xB2, 0xE2, 0x80, 0xB2, 0xE2, 0x80, 0xB2, 0x49, + // Bytes 2940 - 297f + 0xE2, 0x80, 0xB5, 0xE2, 0x80, 0xB5, 0xE2, 0x80, + 0xB5, 0x49, 0xE2, 0x88, 0xAB, 0xE2, 0x88, 0xAB, + 0xE2, 0x88, 0xAB, 0x49, 0xE2, 0x88, 0xAE, 0xE2, + 0x88, 0xAE, 0xE2, 0x88, 0xAE, 0x49, 0xE3, 0x80, + 0x94, 0xE4, 0xB8, 0x89, 0xE3, 0x80, 0x95, 0x49, + 0xE3, 0x80, 0x94, 0xE4, 0xBA, 0x8C, 0xE3, 0x80, + 0x95, 0x49, 0xE3, 0x80, 0x94, 0xE5, 0x8B, 0x9D, + 0xE3, 0x80, 0x95, 0x49, 0xE3, 0x80, 0x94, 0xE5, + // Bytes 2980 - 29bf + 0xAE, 0x89, 0xE3, 0x80, 0x95, 0x49, 0xE3, 0x80, + 0x94, 0xE6, 0x89, 0x93, 0xE3, 0x80, 0x95, 0x49, + 0xE3, 0x80, 0x94, 0xE6, 0x95, 0x97, 0xE3, 0x80, + 0x95, 0x49, 0xE3, 0x80, 0x94, 0xE6, 0x9C, 0xAC, + 0xE3, 0x80, 0x95, 0x49, 0xE3, 0x80, 0x94, 0xE7, + 0x82, 0xB9, 0xE3, 0x80, 0x95, 0x49, 0xE3, 0x80, + 0x94, 0xE7, 0x9B, 0x97, 0xE3, 0x80, 0x95, 0x49, + 0xE3, 0x82, 0xA2, 0xE3, 0x83, 0xBC, 0xE3, 0x83, + // Bytes 29c0 - 29ff + 0xAB, 0x49, 0xE3, 0x82, 0xA4, 0xE3, 0x83, 0xB3, + 0xE3, 0x83, 0x81, 0x49, 0xE3, 0x82, 0xA6, 0xE3, + 0x82, 0xA9, 0xE3, 0x83, 0xB3, 0x49, 0xE3, 0x82, + 0xAA, 0xE3, 0x83, 0xB3, 0xE3, 0x82, 0xB9, 0x49, + 0xE3, 0x82, 0xAA, 0xE3, 0x83, 0xBC, 0xE3, 0x83, + 0xA0, 0x49, 0xE3, 0x82, 0xAB, 0xE3, 0x82, 0xA4, + 0xE3, 0x83, 0xAA, 0x49, 0xE3, 0x82, 0xB1, 0xE3, + 0x83, 0xBC, 0xE3, 0x82, 0xB9, 0x49, 0xE3, 0x82, + // Bytes 2a00 - 2a3f + 0xB3, 0xE3, 0x83, 0xAB, 0xE3, 0x83, 0x8A, 0x49, + 0xE3, 0x82, 0xBB, 0xE3, 0x83, 0xB3, 0xE3, 0x83, + 0x81, 0x49, 0xE3, 0x82, 0xBB, 0xE3, 0x83, 0xB3, + 0xE3, 0x83, 0x88, 0x49, 0xE3, 0x83, 0x86, 0xE3, + 0x82, 0x99, 0xE3, 0x82, 0xB7, 0x49, 0xE3, 0x83, + 0x88, 0xE3, 0x82, 0x99, 0xE3, 0x83, 0xAB, 0x49, + 0xE3, 0x83, 0x8E, 0xE3, 0x83, 0x83, 0xE3, 0x83, + 0x88, 0x49, 0xE3, 0x83, 0x8F, 0xE3, 0x82, 0xA4, + // Bytes 2a40 - 2a7f + 0xE3, 0x83, 0x84, 0x49, 0xE3, 0x83, 0x92, 0xE3, + 0x82, 0x99, 0xE3, 0x83, 0xAB, 0x49, 0xE3, 0x83, + 0x92, 0xE3, 0x82, 0x9A, 0xE3, 0x82, 0xB3, 0x49, + 0xE3, 0x83, 0x95, 0xE3, 0x83, 0xA9, 0xE3, 0x83, + 0xB3, 0x49, 0xE3, 0x83, 0x98, 0xE3, 0x82, 0x9A, + 0xE3, 0x82, 0xBD, 0x49, 0xE3, 0x83, 0x98, 0xE3, + 0x83, 0xAB, 0xE3, 0x83, 0x84, 0x49, 0xE3, 0x83, + 0x9B, 0xE3, 0x83, 0xBC, 0xE3, 0x83, 0xAB, 0x49, + // Bytes 2a80 - 2abf + 0xE3, 0x83, 0x9B, 0xE3, 0x83, 0xBC, 0xE3, 0x83, + 0xB3, 0x49, 0xE3, 0x83, 0x9E, 0xE3, 0x82, 0xA4, + 0xE3, 0x83, 0xAB, 0x49, 0xE3, 0x83, 0x9E, 0xE3, + 0x83, 0x83, 0xE3, 0x83, 0x8F, 0x49, 0xE3, 0x83, + 0x9E, 0xE3, 0x83, 0xAB, 0xE3, 0x82, 0xAF, 0x49, + 0xE3, 0x83, 0xA4, 0xE3, 0x83, 0xBC, 0xE3, 0x83, + 0xAB, 0x49, 0xE3, 0x83, 0xA6, 0xE3, 0x82, 0xA2, + 0xE3, 0x83, 0xB3, 0x49, 0xE3, 0x83, 0xAF, 0xE3, + // Bytes 2ac0 - 2aff + 0x83, 0x83, 0xE3, 0x83, 0x88, 0x4C, 0xE2, 0x80, + 0xB2, 0xE2, 0x80, 0xB2, 0xE2, 0x80, 0xB2, 0xE2, + 0x80, 0xB2, 0x4C, 0xE2, 0x88, 0xAB, 0xE2, 0x88, + 0xAB, 0xE2, 0x88, 0xAB, 0xE2, 0x88, 0xAB, 0x4C, + 0xE3, 0x82, 0xA2, 0xE3, 0x83, 0xAB, 0xE3, 0x83, + 0x95, 0xE3, 0x82, 0xA1, 0x4C, 0xE3, 0x82, 0xA8, + 0xE3, 0x83, 0xBC, 0xE3, 0x82, 0xAB, 0xE3, 0x83, + 0xBC, 0x4C, 0xE3, 0x82, 0xAB, 0xE3, 0x82, 0x99, + // Bytes 2b00 - 2b3f + 0xE3, 0x83, 0xAD, 0xE3, 0x83, 0xB3, 0x4C, 0xE3, + 0x82, 0xAB, 0xE3, 0x82, 0x99, 0xE3, 0x83, 0xB3, + 0xE3, 0x83, 0x9E, 0x4C, 0xE3, 0x82, 0xAB, 0xE3, + 0x83, 0xA9, 0xE3, 0x83, 0x83, 0xE3, 0x83, 0x88, + 0x4C, 0xE3, 0x82, 0xAB, 0xE3, 0x83, 0xAD, 0xE3, + 0x83, 0xAA, 0xE3, 0x83, 0xBC, 0x4C, 0xE3, 0x82, + 0xAD, 0xE3, 0x82, 0x99, 0xE3, 0x83, 0x8B, 0xE3, + 0x83, 0xBC, 0x4C, 0xE3, 0x82, 0xAD, 0xE3, 0x83, + // Bytes 2b40 - 2b7f + 0xA5, 0xE3, 0x83, 0xAA, 0xE3, 0x83, 0xBC, 0x4C, + 0xE3, 0x82, 0xAF, 0xE3, 0x82, 0x99, 0xE3, 0x83, + 0xA9, 0xE3, 0x83, 0xA0, 0x4C, 0xE3, 0x82, 0xAF, + 0xE3, 0x83, 0xAD, 0xE3, 0x83, 0xBC, 0xE3, 0x83, + 0x8D, 0x4C, 0xE3, 0x82, 0xB5, 0xE3, 0x82, 0xA4, + 0xE3, 0x82, 0xAF, 0xE3, 0x83, 0xAB, 0x4C, 0xE3, + 0x82, 0xBF, 0xE3, 0x82, 0x99, 0xE3, 0x83, 0xBC, + 0xE3, 0x82, 0xB9, 0x4C, 0xE3, 0x83, 0x8F, 0xE3, + // Bytes 2b80 - 2bbf + 0x82, 0x9A, 0xE3, 0x83, 0xBC, 0xE3, 0x83, 0x84, + 0x4C, 0xE3, 0x83, 0x92, 0xE3, 0x82, 0x9A, 0xE3, + 0x82, 0xAF, 0xE3, 0x83, 0xAB, 0x4C, 0xE3, 0x83, + 0x95, 0xE3, 0x82, 0xA3, 0xE3, 0x83, 0xBC, 0xE3, + 0x83, 0x88, 0x4C, 0xE3, 0x83, 0x98, 0xE3, 0x82, + 0x99, 0xE3, 0x83, 0xBC, 0xE3, 0x82, 0xBF, 0x4C, + 0xE3, 0x83, 0x98, 0xE3, 0x82, 0x9A, 0xE3, 0x83, + 0x8B, 0xE3, 0x83, 0x92, 0x4C, 0xE3, 0x83, 0x98, + // Bytes 2bc0 - 2bff + 0xE3, 0x82, 0x9A, 0xE3, 0x83, 0xB3, 0xE3, 0x82, + 0xB9, 0x4C, 0xE3, 0x83, 0x9B, 0xE3, 0x82, 0x99, + 0xE3, 0x83, 0xAB, 0xE3, 0x83, 0x88, 0x4C, 0xE3, + 0x83, 0x9E, 0xE3, 0x82, 0xA4, 0xE3, 0x82, 0xAF, + 0xE3, 0x83, 0xAD, 0x4C, 0xE3, 0x83, 0x9F, 0xE3, + 0x82, 0xAF, 0xE3, 0x83, 0xAD, 0xE3, 0x83, 0xB3, + 0x4C, 0xE3, 0x83, 0xA1, 0xE3, 0x83, 0xBC, 0xE3, + 0x83, 0x88, 0xE3, 0x83, 0xAB, 0x4C, 0xE3, 0x83, + // Bytes 2c00 - 2c3f + 0xAA, 0xE3, 0x83, 0x83, 0xE3, 0x83, 0x88, 0xE3, + 0x83, 0xAB, 0x4C, 0xE3, 0x83, 0xAB, 0xE3, 0x83, + 0x92, 0xE3, 0x82, 0x9A, 0xE3, 0x83, 0xBC, 0x4C, + 0xE6, 0xA0, 0xAA, 0xE5, 0xBC, 0x8F, 0xE4, 0xBC, + 0x9A, 0xE7, 0xA4, 0xBE, 0x4E, 0x28, 0xE1, 0x84, + 0x8B, 0xE1, 0x85, 0xA9, 0xE1, 0x84, 0x92, 0xE1, + 0x85, 0xAE, 0x29, 0x4F, 0xD8, 0xAC, 0xD9, 0x84, + 0x20, 0xD8, 0xAC, 0xD9, 0x84, 0xD8, 0xA7, 0xD9, + // Bytes 2c40 - 2c7f + 0x84, 0xD9, 0x87, 0x4F, 0xE3, 0x82, 0xA2, 0xE3, + 0x83, 0x8F, 0xE3, 0x82, 0x9A, 0xE3, 0x83, 0xBC, + 0xE3, 0x83, 0x88, 0x4F, 0xE3, 0x82, 0xA2, 0xE3, + 0x83, 0xB3, 0xE3, 0x83, 0x98, 0xE3, 0x82, 0x9A, + 0xE3, 0x82, 0xA2, 0x4F, 0xE3, 0x82, 0xAD, 0xE3, + 0x83, 0xAD, 0xE3, 0x83, 0xAF, 0xE3, 0x83, 0x83, + 0xE3, 0x83, 0x88, 0x4F, 0xE3, 0x82, 0xB5, 0xE3, + 0x83, 0xB3, 0xE3, 0x83, 0x81, 0xE3, 0x83, 0xBC, + // Bytes 2c80 - 2cbf + 0xE3, 0x83, 0xA0, 0x4F, 0xE3, 0x83, 0x8F, 0xE3, + 0x82, 0x99, 0xE3, 0x83, 0xBC, 0xE3, 0x83, 0xAC, + 0xE3, 0x83, 0xAB, 0x4F, 0xE3, 0x83, 0x98, 0xE3, + 0x82, 0xAF, 0xE3, 0x82, 0xBF, 0xE3, 0x83, 0xBC, + 0xE3, 0x83, 0xAB, 0x4F, 0xE3, 0x83, 0x9B, 0xE3, + 0x82, 0x9A, 0xE3, 0x82, 0xA4, 0xE3, 0x83, 0xB3, + 0xE3, 0x83, 0x88, 0x4F, 0xE3, 0x83, 0x9E, 0xE3, + 0x83, 0xB3, 0xE3, 0x82, 0xB7, 0xE3, 0x83, 0xA7, + // Bytes 2cc0 - 2cff + 0xE3, 0x83, 0xB3, 0x4F, 0xE3, 0x83, 0xA1, 0xE3, + 0x82, 0xAB, 0xE3, 0x82, 0x99, 0xE3, 0x83, 0x88, + 0xE3, 0x83, 0xB3, 0x4F, 0xE3, 0x83, 0xAB, 0xE3, + 0x83, 0xBC, 0xE3, 0x83, 0x95, 0xE3, 0x82, 0x99, + 0xE3, 0x83, 0xAB, 0x51, 0x28, 0xE1, 0x84, 0x8B, + 0xE1, 0x85, 0xA9, 0xE1, 0x84, 0x8C, 0xE1, 0x85, + 0xA5, 0xE1, 0x86, 0xAB, 0x29, 0x52, 0xE3, 0x82, + 0xAD, 0xE3, 0x82, 0x99, 0xE3, 0x83, 0xAB, 0xE3, + // Bytes 2d00 - 2d3f + 0x82, 0xBF, 0xE3, 0x82, 0x99, 0xE3, 0x83, 0xBC, + 0x52, 0xE3, 0x82, 0xAD, 0xE3, 0x83, 0xAD, 0xE3, + 0x82, 0xAF, 0xE3, 0x82, 0x99, 0xE3, 0x83, 0xA9, + 0xE3, 0x83, 0xA0, 0x52, 0xE3, 0x82, 0xAD, 0xE3, + 0x83, 0xAD, 0xE3, 0x83, 0xA1, 0xE3, 0x83, 0xBC, + 0xE3, 0x83, 0x88, 0xE3, 0x83, 0xAB, 0x52, 0xE3, + 0x82, 0xAF, 0xE3, 0x82, 0x99, 0xE3, 0x83, 0xA9, + 0xE3, 0x83, 0xA0, 0xE3, 0x83, 0x88, 0xE3, 0x83, + // Bytes 2d40 - 2d7f + 0xB3, 0x52, 0xE3, 0x82, 0xAF, 0xE3, 0x83, 0xAB, + 0xE3, 0x82, 0xBB, 0xE3, 0x82, 0x99, 0xE3, 0x82, + 0xA4, 0xE3, 0x83, 0xAD, 0x52, 0xE3, 0x83, 0x8F, + 0xE3, 0x82, 0x9A, 0xE3, 0x83, 0xBC, 0xE3, 0x82, + 0xBB, 0xE3, 0x83, 0xB3, 0xE3, 0x83, 0x88, 0x52, + 0xE3, 0x83, 0x92, 0xE3, 0x82, 0x9A, 0xE3, 0x82, + 0xA2, 0xE3, 0x82, 0xB9, 0xE3, 0x83, 0x88, 0xE3, + 0x83, 0xAB, 0x52, 0xE3, 0x83, 0x95, 0xE3, 0x82, + // Bytes 2d80 - 2dbf + 0x99, 0xE3, 0x83, 0x83, 0xE3, 0x82, 0xB7, 0xE3, + 0x82, 0xA7, 0xE3, 0x83, 0xAB, 0x52, 0xE3, 0x83, + 0x9F, 0xE3, 0x83, 0xAA, 0xE3, 0x83, 0x8F, 0xE3, + 0x82, 0x99, 0xE3, 0x83, 0xBC, 0xE3, 0x83, 0xAB, + 0x52, 0xE3, 0x83, 0xAC, 0xE3, 0x83, 0xB3, 0xE3, + 0x83, 0x88, 0xE3, 0x82, 0xB1, 0xE3, 0x82, 0x99, + 0xE3, 0x83, 0xB3, 0x61, 0xD8, 0xB5, 0xD9, 0x84, + 0xD9, 0x89, 0x20, 0xD8, 0xA7, 0xD9, 0x84, 0xD9, + // Bytes 2dc0 - 2dff + 0x84, 0xD9, 0x87, 0x20, 0xD8, 0xB9, 0xD9, 0x84, + 0xD9, 0x8A, 0xD9, 0x87, 0x20, 0xD9, 0x88, 0xD8, + 0xB3, 0xD9, 0x84, 0xD9, 0x85, 0x06, 0xE0, 0xA7, + 0x87, 0xE0, 0xA6, 0xBE, 0x01, 0x06, 0xE0, 0xA7, + 0x87, 0xE0, 0xA7, 0x97, 0x01, 0x06, 0xE0, 0xAD, + 0x87, 0xE0, 0xAC, 0xBE, 0x01, 0x06, 0xE0, 0xAD, + 0x87, 0xE0, 0xAD, 0x96, 0x01, 0x06, 0xE0, 0xAD, + 0x87, 0xE0, 0xAD, 0x97, 0x01, 0x06, 0xE0, 0xAE, + // Bytes 2e00 - 2e3f + 0x92, 0xE0, 0xAF, 0x97, 0x01, 0x06, 0xE0, 0xAF, + 0x86, 0xE0, 0xAE, 0xBE, 0x01, 0x06, 0xE0, 0xAF, + 0x86, 0xE0, 0xAF, 0x97, 0x01, 0x06, 0xE0, 0xAF, + 0x87, 0xE0, 0xAE, 0xBE, 0x01, 0x06, 0xE0, 0xB2, + 0xBF, 0xE0, 0xB3, 0x95, 0x01, 0x06, 0xE0, 0xB3, + 0x86, 0xE0, 0xB3, 0x95, 0x01, 0x06, 0xE0, 0xB3, + 0x86, 0xE0, 0xB3, 0x96, 0x01, 0x06, 0xE0, 0xB5, + 0x86, 0xE0, 0xB4, 0xBE, 0x01, 0x06, 0xE0, 0xB5, + // Bytes 2e40 - 2e7f + 0x86, 0xE0, 0xB5, 0x97, 0x01, 0x06, 0xE0, 0xB5, + 0x87, 0xE0, 0xB4, 0xBE, 0x01, 0x06, 0xE0, 0xB7, + 0x99, 0xE0, 0xB7, 0x9F, 0x01, 0x06, 0xE1, 0x80, + 0xA5, 0xE1, 0x80, 0xAE, 0x01, 0x06, 0xE1, 0xAC, + 0x85, 0xE1, 0xAC, 0xB5, 0x01, 0x06, 0xE1, 0xAC, + 0x87, 0xE1, 0xAC, 0xB5, 0x01, 0x06, 0xE1, 0xAC, + 0x89, 0xE1, 0xAC, 0xB5, 0x01, 0x06, 0xE1, 0xAC, + 0x8B, 0xE1, 0xAC, 0xB5, 0x01, 0x06, 0xE1, 0xAC, + // Bytes 2e80 - 2ebf + 0x8D, 0xE1, 0xAC, 0xB5, 0x01, 0x06, 0xE1, 0xAC, + 0x91, 0xE1, 0xAC, 0xB5, 0x01, 0x06, 0xE1, 0xAC, + 0xBA, 0xE1, 0xAC, 0xB5, 0x01, 0x06, 0xE1, 0xAC, + 0xBC, 0xE1, 0xAC, 0xB5, 0x01, 0x06, 0xE1, 0xAC, + 0xBE, 0xE1, 0xAC, 0xB5, 0x01, 0x06, 0xE1, 0xAC, + 0xBF, 0xE1, 0xAC, 0xB5, 0x01, 0x06, 0xE1, 0xAD, + 0x82, 0xE1, 0xAC, 0xB5, 0x01, 0x08, 0xF0, 0x91, + 0x84, 0xB1, 0xF0, 0x91, 0x84, 0xA7, 0x01, 0x08, + // Bytes 2ec0 - 2eff + 0xF0, 0x91, 0x84, 0xB2, 0xF0, 0x91, 0x84, 0xA7, + 0x01, 0x08, 0xF0, 0x91, 0x8D, 0x87, 0xF0, 0x91, + 0x8C, 0xBE, 0x01, 0x08, 0xF0, 0x91, 0x8D, 0x87, + 0xF0, 0x91, 0x8D, 0x97, 0x01, 0x08, 0xF0, 0x91, + 0x92, 0xB9, 0xF0, 0x91, 0x92, 0xB0, 0x01, 0x08, + 0xF0, 0x91, 0x92, 0xB9, 0xF0, 0x91, 0x92, 0xBA, + 0x01, 0x08, 0xF0, 0x91, 0x92, 0xB9, 0xF0, 0x91, + 0x92, 0xBD, 0x01, 0x08, 0xF0, 0x91, 0x96, 0xB8, + // Bytes 2f00 - 2f3f + 0xF0, 0x91, 0x96, 0xAF, 0x01, 0x08, 0xF0, 0x91, + 0x96, 0xB9, 0xF0, 0x91, 0x96, 0xAF, 0x01, 0x08, + 0xF0, 0x91, 0xA4, 0xB5, 0xF0, 0x91, 0xA4, 0xB0, + 0x01, 0x09, 0xE0, 0xB3, 0x86, 0xE0, 0xB3, 0x82, + 0xE0, 0xB3, 0x95, 0x02, 0x09, 0xE0, 0xB7, 0x99, + 0xE0, 0xB7, 0x8F, 0xE0, 0xB7, 0x8A, 0x16, 0x44, + 0x44, 0x5A, 0xCC, 0x8C, 0xCD, 0x44, 0x44, 0x7A, + 0xCC, 0x8C, 0xCD, 0x44, 0x64, 0x7A, 0xCC, 0x8C, + // Bytes 2f40 - 2f7f + 0xCD, 0x46, 0xD9, 0x84, 0xD8, 0xA7, 0xD9, 0x93, + 0xCD, 0x46, 0xD9, 0x84, 0xD8, 0xA7, 0xD9, 0x94, + 0xCD, 0x46, 0xD9, 0x84, 0xD8, 0xA7, 0xD9, 0x95, + 0xB9, 0x46, 0xE1, 0x84, 0x80, 0xE1, 0x85, 0xA1, + 0x01, 0x46, 0xE1, 0x84, 0x82, 0xE1, 0x85, 0xA1, + 0x01, 0x46, 0xE1, 0x84, 0x83, 0xE1, 0x85, 0xA1, + 0x01, 0x46, 0xE1, 0x84, 0x85, 0xE1, 0x85, 0xA1, + 0x01, 0x46, 0xE1, 0x84, 0x86, 0xE1, 0x85, 0xA1, + // Bytes 2f80 - 2fbf + 0x01, 0x46, 0xE1, 0x84, 0x87, 0xE1, 0x85, 0xA1, + 0x01, 0x46, 0xE1, 0x84, 0x89, 0xE1, 0x85, 0xA1, + 0x01, 0x46, 0xE1, 0x84, 0x8B, 0xE1, 0x85, 0xA1, + 0x01, 0x46, 0xE1, 0x84, 0x8B, 0xE1, 0x85, 0xAE, + 0x01, 0x46, 0xE1, 0x84, 0x8C, 0xE1, 0x85, 0xA1, + 0x01, 0x46, 0xE1, 0x84, 0x8E, 0xE1, 0x85, 0xA1, + 0x01, 0x46, 0xE1, 0x84, 0x8F, 0xE1, 0x85, 0xA1, + 0x01, 0x46, 0xE1, 0x84, 0x90, 0xE1, 0x85, 0xA1, + // Bytes 2fc0 - 2fff + 0x01, 0x46, 0xE1, 0x84, 0x91, 0xE1, 0x85, 0xA1, + 0x01, 0x46, 0xE1, 0x84, 0x92, 0xE1, 0x85, 0xA1, + 0x01, 0x49, 0xE3, 0x83, 0xA1, 0xE3, 0x82, 0xAB, + 0xE3, 0x82, 0x99, 0x11, 0x4C, 0xE1, 0x84, 0x8C, + 0xE1, 0x85, 0xAE, 0xE1, 0x84, 0x8B, 0xE1, 0x85, + 0xB4, 0x01, 0x4C, 0xE3, 0x82, 0xAD, 0xE3, 0x82, + 0x99, 0xE3, 0x82, 0xAB, 0xE3, 0x82, 0x99, 0x11, + 0x4C, 0xE3, 0x82, 0xB3, 0xE3, 0x83, 0xBC, 0xE3, + // Bytes 3000 - 303f + 0x83, 0x9B, 0xE3, 0x82, 0x9A, 0x11, 0x4C, 0xE3, + 0x83, 0xA4, 0xE3, 0x83, 0xBC, 0xE3, 0x83, 0x88, + 0xE3, 0x82, 0x99, 0x11, 0x4F, 0xE1, 0x84, 0x8E, + 0xE1, 0x85, 0xA1, 0xE1, 0x86, 0xB7, 0xE1, 0x84, + 0x80, 0xE1, 0x85, 0xA9, 0x01, 0x4F, 0xE3, 0x82, + 0xA4, 0xE3, 0x83, 0x8B, 0xE3, 0x83, 0xB3, 0xE3, + 0x82, 0xAF, 0xE3, 0x82, 0x99, 0x11, 0x4F, 0xE3, + 0x82, 0xB7, 0xE3, 0x83, 0xAA, 0xE3, 0x83, 0xB3, + // Bytes 3040 - 307f + 0xE3, 0x82, 0xAF, 0xE3, 0x82, 0x99, 0x11, 0x4F, + 0xE3, 0x83, 0x98, 0xE3, 0x82, 0x9A, 0xE3, 0x83, + 0xBC, 0xE3, 0x82, 0xB7, 0xE3, 0x82, 0x99, 0x11, + 0x4F, 0xE3, 0x83, 0x9B, 0xE3, 0x82, 0x9A, 0xE3, + 0x83, 0xB3, 0xE3, 0x83, 0x88, 0xE3, 0x82, 0x99, + 0x11, 0x52, 0xE3, 0x82, 0xA8, 0xE3, 0x82, 0xB9, + 0xE3, 0x82, 0xAF, 0xE3, 0x83, 0xBC, 0xE3, 0x83, + 0x88, 0xE3, 0x82, 0x99, 0x11, 0x52, 0xE3, 0x83, + // Bytes 3080 - 30bf + 0x95, 0xE3, 0x82, 0xA1, 0xE3, 0x83, 0xA9, 0xE3, + 0x83, 0x83, 0xE3, 0x83, 0x88, 0xE3, 0x82, 0x99, + 0x11, 0x86, 0xE0, 0xB3, 0x86, 0xE0, 0xB3, 0x82, + 0x01, 0x86, 0xE0, 0xB7, 0x99, 0xE0, 0xB7, 0x8F, + 0x01, 0x03, 0x3C, 0xCC, 0xB8, 0x05, 0x03, 0x3D, + 0xCC, 0xB8, 0x05, 0x03, 0x3E, 0xCC, 0xB8, 0x05, + 0x03, 0x41, 0xCC, 0x80, 0xCD, 0x03, 0x41, 0xCC, + 0x81, 0xCD, 0x03, 0x41, 0xCC, 0x83, 0xCD, 0x03, + // Bytes 30c0 - 30ff + 0x41, 0xCC, 0x84, 0xCD, 0x03, 0x41, 0xCC, 0x89, + 0xCD, 0x03, 0x41, 0xCC, 0x8C, 0xCD, 0x03, 0x41, + 0xCC, 0x8F, 0xCD, 0x03, 0x41, 0xCC, 0x91, 0xCD, + 0x03, 0x41, 0xCC, 0xA5, 0xB9, 0x03, 0x41, 0xCC, + 0xA8, 0xA9, 0x03, 0x42, 0xCC, 0x87, 0xCD, 0x03, + 0x42, 0xCC, 0xA3, 0xB9, 0x03, 0x42, 0xCC, 0xB1, + 0xB9, 0x03, 0x43, 0xCC, 0x81, 0xCD, 0x03, 0x43, + 0xCC, 0x82, 0xCD, 0x03, 0x43, 0xCC, 0x87, 0xCD, + // Bytes 3100 - 313f + 0x03, 0x43, 0xCC, 0x8C, 0xCD, 0x03, 0x44, 0xCC, + 0x87, 0xCD, 0x03, 0x44, 0xCC, 0x8C, 0xCD, 0x03, + 0x44, 0xCC, 0xA3, 0xB9, 0x03, 0x44, 0xCC, 0xA7, + 0xA9, 0x03, 0x44, 0xCC, 0xAD, 0xB9, 0x03, 0x44, + 0xCC, 0xB1, 0xB9, 0x03, 0x45, 0xCC, 0x80, 0xCD, + 0x03, 0x45, 0xCC, 0x81, 0xCD, 0x03, 0x45, 0xCC, + 0x83, 0xCD, 0x03, 0x45, 0xCC, 0x86, 0xCD, 0x03, + 0x45, 0xCC, 0x87, 0xCD, 0x03, 0x45, 0xCC, 0x88, + // Bytes 3140 - 317f + 0xCD, 0x03, 0x45, 0xCC, 0x89, 0xCD, 0x03, 0x45, + 0xCC, 0x8C, 0xCD, 0x03, 0x45, 0xCC, 0x8F, 0xCD, + 0x03, 0x45, 0xCC, 0x91, 0xCD, 0x03, 0x45, 0xCC, + 0xA8, 0xA9, 0x03, 0x45, 0xCC, 0xAD, 0xB9, 0x03, + 0x45, 0xCC, 0xB0, 0xB9, 0x03, 0x46, 0xCC, 0x87, + 0xCD, 0x03, 0x47, 0xCC, 0x81, 0xCD, 0x03, 0x47, + 0xCC, 0x82, 0xCD, 0x03, 0x47, 0xCC, 0x84, 0xCD, + 0x03, 0x47, 0xCC, 0x86, 0xCD, 0x03, 0x47, 0xCC, + // Bytes 3180 - 31bf + 0x87, 0xCD, 0x03, 0x47, 0xCC, 0x8C, 0xCD, 0x03, + 0x47, 0xCC, 0xA7, 0xA9, 0x03, 0x48, 0xCC, 0x82, + 0xCD, 0x03, 0x48, 0xCC, 0x87, 0xCD, 0x03, 0x48, + 0xCC, 0x88, 0xCD, 0x03, 0x48, 0xCC, 0x8C, 0xCD, + 0x03, 0x48, 0xCC, 0xA3, 0xB9, 0x03, 0x48, 0xCC, + 0xA7, 0xA9, 0x03, 0x48, 0xCC, 0xAE, 0xB9, 0x03, + 0x49, 0xCC, 0x80, 0xCD, 0x03, 0x49, 0xCC, 0x81, + 0xCD, 0x03, 0x49, 0xCC, 0x82, 0xCD, 0x03, 0x49, + // Bytes 31c0 - 31ff + 0xCC, 0x83, 0xCD, 0x03, 0x49, 0xCC, 0x84, 0xCD, + 0x03, 0x49, 0xCC, 0x86, 0xCD, 0x03, 0x49, 0xCC, + 0x87, 0xCD, 0x03, 0x49, 0xCC, 0x89, 0xCD, 0x03, + 0x49, 0xCC, 0x8C, 0xCD, 0x03, 0x49, 0xCC, 0x8F, + 0xCD, 0x03, 0x49, 0xCC, 0x91, 0xCD, 0x03, 0x49, + 0xCC, 0xA3, 0xB9, 0x03, 0x49, 0xCC, 0xA8, 0xA9, + 0x03, 0x49, 0xCC, 0xB0, 0xB9, 0x03, 0x4A, 0xCC, + 0x82, 0xCD, 0x03, 0x4B, 0xCC, 0x81, 0xCD, 0x03, + // Bytes 3200 - 323f + 0x4B, 0xCC, 0x8C, 0xCD, 0x03, 0x4B, 0xCC, 0xA3, + 0xB9, 0x03, 0x4B, 0xCC, 0xA7, 0xA9, 0x03, 0x4B, + 0xCC, 0xB1, 0xB9, 0x03, 0x4C, 0xCC, 0x81, 0xCD, + 0x03, 0x4C, 0xCC, 0x8C, 0xCD, 0x03, 0x4C, 0xCC, + 0xA7, 0xA9, 0x03, 0x4C, 0xCC, 0xAD, 0xB9, 0x03, + 0x4C, 0xCC, 0xB1, 0xB9, 0x03, 0x4D, 0xCC, 0x81, + 0xCD, 0x03, 0x4D, 0xCC, 0x87, 0xCD, 0x03, 0x4D, + 0xCC, 0xA3, 0xB9, 0x03, 0x4E, 0xCC, 0x80, 0xCD, + // Bytes 3240 - 327f + 0x03, 0x4E, 0xCC, 0x81, 0xCD, 0x03, 0x4E, 0xCC, + 0x83, 0xCD, 0x03, 0x4E, 0xCC, 0x87, 0xCD, 0x03, + 0x4E, 0xCC, 0x8C, 0xCD, 0x03, 0x4E, 0xCC, 0xA3, + 0xB9, 0x03, 0x4E, 0xCC, 0xA7, 0xA9, 0x03, 0x4E, + 0xCC, 0xAD, 0xB9, 0x03, 0x4E, 0xCC, 0xB1, 0xB9, + 0x03, 0x4F, 0xCC, 0x80, 0xCD, 0x03, 0x4F, 0xCC, + 0x81, 0xCD, 0x03, 0x4F, 0xCC, 0x86, 0xCD, 0x03, + 0x4F, 0xCC, 0x89, 0xCD, 0x03, 0x4F, 0xCC, 0x8B, + // Bytes 3280 - 32bf + 0xCD, 0x03, 0x4F, 0xCC, 0x8C, 0xCD, 0x03, 0x4F, + 0xCC, 0x8F, 0xCD, 0x03, 0x4F, 0xCC, 0x91, 0xCD, + 0x03, 0x50, 0xCC, 0x81, 0xCD, 0x03, 0x50, 0xCC, + 0x87, 0xCD, 0x03, 0x52, 0xCC, 0x81, 0xCD, 0x03, + 0x52, 0xCC, 0x87, 0xCD, 0x03, 0x52, 0xCC, 0x8C, + 0xCD, 0x03, 0x52, 0xCC, 0x8F, 0xCD, 0x03, 0x52, + 0xCC, 0x91, 0xCD, 0x03, 0x52, 0xCC, 0xA7, 0xA9, + 0x03, 0x52, 0xCC, 0xB1, 0xB9, 0x03, 0x53, 0xCC, + // Bytes 32c0 - 32ff + 0x82, 0xCD, 0x03, 0x53, 0xCC, 0x87, 0xCD, 0x03, + 0x53, 0xCC, 0xA6, 0xB9, 0x03, 0x53, 0xCC, 0xA7, + 0xA9, 0x03, 0x54, 0xCC, 0x87, 0xCD, 0x03, 0x54, + 0xCC, 0x8C, 0xCD, 0x03, 0x54, 0xCC, 0xA3, 0xB9, + 0x03, 0x54, 0xCC, 0xA6, 0xB9, 0x03, 0x54, 0xCC, + 0xA7, 0xA9, 0x03, 0x54, 0xCC, 0xAD, 0xB9, 0x03, + 0x54, 0xCC, 0xB1, 0xB9, 0x03, 0x55, 0xCC, 0x80, + 0xCD, 0x03, 0x55, 0xCC, 0x81, 0xCD, 0x03, 0x55, + // Bytes 3300 - 333f + 0xCC, 0x82, 0xCD, 0x03, 0x55, 0xCC, 0x86, 0xCD, + 0x03, 0x55, 0xCC, 0x89, 0xCD, 0x03, 0x55, 0xCC, + 0x8A, 0xCD, 0x03, 0x55, 0xCC, 0x8B, 0xCD, 0x03, + 0x55, 0xCC, 0x8C, 0xCD, 0x03, 0x55, 0xCC, 0x8F, + 0xCD, 0x03, 0x55, 0xCC, 0x91, 0xCD, 0x03, 0x55, + 0xCC, 0xA3, 0xB9, 0x03, 0x55, 0xCC, 0xA4, 0xB9, + 0x03, 0x55, 0xCC, 0xA8, 0xA9, 0x03, 0x55, 0xCC, + 0xAD, 0xB9, 0x03, 0x55, 0xCC, 0xB0, 0xB9, 0x03, + // Bytes 3340 - 337f + 0x56, 0xCC, 0x83, 0xCD, 0x03, 0x56, 0xCC, 0xA3, + 0xB9, 0x03, 0x57, 0xCC, 0x80, 0xCD, 0x03, 0x57, + 0xCC, 0x81, 0xCD, 0x03, 0x57, 0xCC, 0x82, 0xCD, + 0x03, 0x57, 0xCC, 0x87, 0xCD, 0x03, 0x57, 0xCC, + 0x88, 0xCD, 0x03, 0x57, 0xCC, 0xA3, 0xB9, 0x03, + 0x58, 0xCC, 0x87, 0xCD, 0x03, 0x58, 0xCC, 0x88, + 0xCD, 0x03, 0x59, 0xCC, 0x80, 0xCD, 0x03, 0x59, + 0xCC, 0x81, 0xCD, 0x03, 0x59, 0xCC, 0x82, 0xCD, + // Bytes 3380 - 33bf + 0x03, 0x59, 0xCC, 0x83, 0xCD, 0x03, 0x59, 0xCC, + 0x84, 0xCD, 0x03, 0x59, 0xCC, 0x87, 0xCD, 0x03, + 0x59, 0xCC, 0x88, 0xCD, 0x03, 0x59, 0xCC, 0x89, + 0xCD, 0x03, 0x59, 0xCC, 0xA3, 0xB9, 0x03, 0x5A, + 0xCC, 0x81, 0xCD, 0x03, 0x5A, 0xCC, 0x82, 0xCD, + 0x03, 0x5A, 0xCC, 0x87, 0xCD, 0x03, 0x5A, 0xCC, + 0x8C, 0xCD, 0x03, 0x5A, 0xCC, 0xA3, 0xB9, 0x03, + 0x5A, 0xCC, 0xB1, 0xB9, 0x03, 0x61, 0xCC, 0x80, + // Bytes 33c0 - 33ff + 0xCD, 0x03, 0x61, 0xCC, 0x81, 0xCD, 0x03, 0x61, + 0xCC, 0x83, 0xCD, 0x03, 0x61, 0xCC, 0x84, 0xCD, + 0x03, 0x61, 0xCC, 0x89, 0xCD, 0x03, 0x61, 0xCC, + 0x8C, 0xCD, 0x03, 0x61, 0xCC, 0x8F, 0xCD, 0x03, + 0x61, 0xCC, 0x91, 0xCD, 0x03, 0x61, 0xCC, 0xA5, + 0xB9, 0x03, 0x61, 0xCC, 0xA8, 0xA9, 0x03, 0x62, + 0xCC, 0x87, 0xCD, 0x03, 0x62, 0xCC, 0xA3, 0xB9, + 0x03, 0x62, 0xCC, 0xB1, 0xB9, 0x03, 0x63, 0xCC, + // Bytes 3400 - 343f + 0x81, 0xCD, 0x03, 0x63, 0xCC, 0x82, 0xCD, 0x03, + 0x63, 0xCC, 0x87, 0xCD, 0x03, 0x63, 0xCC, 0x8C, + 0xCD, 0x03, 0x64, 0xCC, 0x87, 0xCD, 0x03, 0x64, + 0xCC, 0x8C, 0xCD, 0x03, 0x64, 0xCC, 0xA3, 0xB9, + 0x03, 0x64, 0xCC, 0xA7, 0xA9, 0x03, 0x64, 0xCC, + 0xAD, 0xB9, 0x03, 0x64, 0xCC, 0xB1, 0xB9, 0x03, + 0x65, 0xCC, 0x80, 0xCD, 0x03, 0x65, 0xCC, 0x81, + 0xCD, 0x03, 0x65, 0xCC, 0x83, 0xCD, 0x03, 0x65, + // Bytes 3440 - 347f + 0xCC, 0x86, 0xCD, 0x03, 0x65, 0xCC, 0x87, 0xCD, + 0x03, 0x65, 0xCC, 0x88, 0xCD, 0x03, 0x65, 0xCC, + 0x89, 0xCD, 0x03, 0x65, 0xCC, 0x8C, 0xCD, 0x03, + 0x65, 0xCC, 0x8F, 0xCD, 0x03, 0x65, 0xCC, 0x91, + 0xCD, 0x03, 0x65, 0xCC, 0xA8, 0xA9, 0x03, 0x65, + 0xCC, 0xAD, 0xB9, 0x03, 0x65, 0xCC, 0xB0, 0xB9, + 0x03, 0x66, 0xCC, 0x87, 0xCD, 0x03, 0x67, 0xCC, + 0x81, 0xCD, 0x03, 0x67, 0xCC, 0x82, 0xCD, 0x03, + // Bytes 3480 - 34bf + 0x67, 0xCC, 0x84, 0xCD, 0x03, 0x67, 0xCC, 0x86, + 0xCD, 0x03, 0x67, 0xCC, 0x87, 0xCD, 0x03, 0x67, + 0xCC, 0x8C, 0xCD, 0x03, 0x67, 0xCC, 0xA7, 0xA9, + 0x03, 0x68, 0xCC, 0x82, 0xCD, 0x03, 0x68, 0xCC, + 0x87, 0xCD, 0x03, 0x68, 0xCC, 0x88, 0xCD, 0x03, + 0x68, 0xCC, 0x8C, 0xCD, 0x03, 0x68, 0xCC, 0xA3, + 0xB9, 0x03, 0x68, 0xCC, 0xA7, 0xA9, 0x03, 0x68, + 0xCC, 0xAE, 0xB9, 0x03, 0x68, 0xCC, 0xB1, 0xB9, + // Bytes 34c0 - 34ff + 0x03, 0x69, 0xCC, 0x80, 0xCD, 0x03, 0x69, 0xCC, + 0x81, 0xCD, 0x03, 0x69, 0xCC, 0x82, 0xCD, 0x03, + 0x69, 0xCC, 0x83, 0xCD, 0x03, 0x69, 0xCC, 0x84, + 0xCD, 0x03, 0x69, 0xCC, 0x86, 0xCD, 0x03, 0x69, + 0xCC, 0x89, 0xCD, 0x03, 0x69, 0xCC, 0x8C, 0xCD, + 0x03, 0x69, 0xCC, 0x8F, 0xCD, 0x03, 0x69, 0xCC, + 0x91, 0xCD, 0x03, 0x69, 0xCC, 0xA3, 0xB9, 0x03, + 0x69, 0xCC, 0xA8, 0xA9, 0x03, 0x69, 0xCC, 0xB0, + // Bytes 3500 - 353f + 0xB9, 0x03, 0x6A, 0xCC, 0x82, 0xCD, 0x03, 0x6A, + 0xCC, 0x8C, 0xCD, 0x03, 0x6B, 0xCC, 0x81, 0xCD, + 0x03, 0x6B, 0xCC, 0x8C, 0xCD, 0x03, 0x6B, 0xCC, + 0xA3, 0xB9, 0x03, 0x6B, 0xCC, 0xA7, 0xA9, 0x03, + 0x6B, 0xCC, 0xB1, 0xB9, 0x03, 0x6C, 0xCC, 0x81, + 0xCD, 0x03, 0x6C, 0xCC, 0x8C, 0xCD, 0x03, 0x6C, + 0xCC, 0xA7, 0xA9, 0x03, 0x6C, 0xCC, 0xAD, 0xB9, + 0x03, 0x6C, 0xCC, 0xB1, 0xB9, 0x03, 0x6D, 0xCC, + // Bytes 3540 - 357f + 0x81, 0xCD, 0x03, 0x6D, 0xCC, 0x87, 0xCD, 0x03, + 0x6D, 0xCC, 0xA3, 0xB9, 0x03, 0x6E, 0xCC, 0x80, + 0xCD, 0x03, 0x6E, 0xCC, 0x81, 0xCD, 0x03, 0x6E, + 0xCC, 0x83, 0xCD, 0x03, 0x6E, 0xCC, 0x87, 0xCD, + 0x03, 0x6E, 0xCC, 0x8C, 0xCD, 0x03, 0x6E, 0xCC, + 0xA3, 0xB9, 0x03, 0x6E, 0xCC, 0xA7, 0xA9, 0x03, + 0x6E, 0xCC, 0xAD, 0xB9, 0x03, 0x6E, 0xCC, 0xB1, + 0xB9, 0x03, 0x6F, 0xCC, 0x80, 0xCD, 0x03, 0x6F, + // Bytes 3580 - 35bf + 0xCC, 0x81, 0xCD, 0x03, 0x6F, 0xCC, 0x86, 0xCD, + 0x03, 0x6F, 0xCC, 0x89, 0xCD, 0x03, 0x6F, 0xCC, + 0x8B, 0xCD, 0x03, 0x6F, 0xCC, 0x8C, 0xCD, 0x03, + 0x6F, 0xCC, 0x8F, 0xCD, 0x03, 0x6F, 0xCC, 0x91, + 0xCD, 0x03, 0x70, 0xCC, 0x81, 0xCD, 0x03, 0x70, + 0xCC, 0x87, 0xCD, 0x03, 0x72, 0xCC, 0x81, 0xCD, + 0x03, 0x72, 0xCC, 0x87, 0xCD, 0x03, 0x72, 0xCC, + 0x8C, 0xCD, 0x03, 0x72, 0xCC, 0x8F, 0xCD, 0x03, + // Bytes 35c0 - 35ff + 0x72, 0xCC, 0x91, 0xCD, 0x03, 0x72, 0xCC, 0xA7, + 0xA9, 0x03, 0x72, 0xCC, 0xB1, 0xB9, 0x03, 0x73, + 0xCC, 0x82, 0xCD, 0x03, 0x73, 0xCC, 0x87, 0xCD, + 0x03, 0x73, 0xCC, 0xA6, 0xB9, 0x03, 0x73, 0xCC, + 0xA7, 0xA9, 0x03, 0x74, 0xCC, 0x87, 0xCD, 0x03, + 0x74, 0xCC, 0x88, 0xCD, 0x03, 0x74, 0xCC, 0x8C, + 0xCD, 0x03, 0x74, 0xCC, 0xA3, 0xB9, 0x03, 0x74, + 0xCC, 0xA6, 0xB9, 0x03, 0x74, 0xCC, 0xA7, 0xA9, + // Bytes 3600 - 363f + 0x03, 0x74, 0xCC, 0xAD, 0xB9, 0x03, 0x74, 0xCC, + 0xB1, 0xB9, 0x03, 0x75, 0xCC, 0x80, 0xCD, 0x03, + 0x75, 0xCC, 0x81, 0xCD, 0x03, 0x75, 0xCC, 0x82, + 0xCD, 0x03, 0x75, 0xCC, 0x86, 0xCD, 0x03, 0x75, + 0xCC, 0x89, 0xCD, 0x03, 0x75, 0xCC, 0x8A, 0xCD, + 0x03, 0x75, 0xCC, 0x8B, 0xCD, 0x03, 0x75, 0xCC, + 0x8C, 0xCD, 0x03, 0x75, 0xCC, 0x8F, 0xCD, 0x03, + 0x75, 0xCC, 0x91, 0xCD, 0x03, 0x75, 0xCC, 0xA3, + // Bytes 3640 - 367f + 0xB9, 0x03, 0x75, 0xCC, 0xA4, 0xB9, 0x03, 0x75, + 0xCC, 0xA8, 0xA9, 0x03, 0x75, 0xCC, 0xAD, 0xB9, + 0x03, 0x75, 0xCC, 0xB0, 0xB9, 0x03, 0x76, 0xCC, + 0x83, 0xCD, 0x03, 0x76, 0xCC, 0xA3, 0xB9, 0x03, + 0x77, 0xCC, 0x80, 0xCD, 0x03, 0x77, 0xCC, 0x81, + 0xCD, 0x03, 0x77, 0xCC, 0x82, 0xCD, 0x03, 0x77, + 0xCC, 0x87, 0xCD, 0x03, 0x77, 0xCC, 0x88, 0xCD, + 0x03, 0x77, 0xCC, 0x8A, 0xCD, 0x03, 0x77, 0xCC, + // Bytes 3680 - 36bf + 0xA3, 0xB9, 0x03, 0x78, 0xCC, 0x87, 0xCD, 0x03, + 0x78, 0xCC, 0x88, 0xCD, 0x03, 0x79, 0xCC, 0x80, + 0xCD, 0x03, 0x79, 0xCC, 0x81, 0xCD, 0x03, 0x79, + 0xCC, 0x82, 0xCD, 0x03, 0x79, 0xCC, 0x83, 0xCD, + 0x03, 0x79, 0xCC, 0x84, 0xCD, 0x03, 0x79, 0xCC, + 0x87, 0xCD, 0x03, 0x79, 0xCC, 0x88, 0xCD, 0x03, + 0x79, 0xCC, 0x89, 0xCD, 0x03, 0x79, 0xCC, 0x8A, + 0xCD, 0x03, 0x79, 0xCC, 0xA3, 0xB9, 0x03, 0x7A, + // Bytes 36c0 - 36ff + 0xCC, 0x81, 0xCD, 0x03, 0x7A, 0xCC, 0x82, 0xCD, + 0x03, 0x7A, 0xCC, 0x87, 0xCD, 0x03, 0x7A, 0xCC, + 0x8C, 0xCD, 0x03, 0x7A, 0xCC, 0xA3, 0xB9, 0x03, + 0x7A, 0xCC, 0xB1, 0xB9, 0x04, 0xC2, 0xA8, 0xCC, + 0x80, 0xCE, 0x04, 0xC2, 0xA8, 0xCC, 0x81, 0xCE, + 0x04, 0xC2, 0xA8, 0xCD, 0x82, 0xCE, 0x04, 0xC3, + 0x86, 0xCC, 0x81, 0xCD, 0x04, 0xC3, 0x86, 0xCC, + 0x84, 0xCD, 0x04, 0xC3, 0x98, 0xCC, 0x81, 0xCD, + // Bytes 3700 - 373f + 0x04, 0xC3, 0xA6, 0xCC, 0x81, 0xCD, 0x04, 0xC3, + 0xA6, 0xCC, 0x84, 0xCD, 0x04, 0xC3, 0xB8, 0xCC, + 0x81, 0xCD, 0x04, 0xC5, 0xBF, 0xCC, 0x87, 0xCD, + 0x04, 0xC6, 0xB7, 0xCC, 0x8C, 0xCD, 0x04, 0xCA, + 0x92, 0xCC, 0x8C, 0xCD, 0x04, 0xCE, 0x91, 0xCC, + 0x80, 0xCD, 0x04, 0xCE, 0x91, 0xCC, 0x81, 0xCD, + 0x04, 0xCE, 0x91, 0xCC, 0x84, 0xCD, 0x04, 0xCE, + 0x91, 0xCC, 0x86, 0xCD, 0x04, 0xCE, 0x91, 0xCD, + // Bytes 3740 - 377f + 0x85, 0xDD, 0x04, 0xCE, 0x95, 0xCC, 0x80, 0xCD, + 0x04, 0xCE, 0x95, 0xCC, 0x81, 0xCD, 0x04, 0xCE, + 0x97, 0xCC, 0x80, 0xCD, 0x04, 0xCE, 0x97, 0xCC, + 0x81, 0xCD, 0x04, 0xCE, 0x97, 0xCD, 0x85, 0xDD, + 0x04, 0xCE, 0x99, 0xCC, 0x80, 0xCD, 0x04, 0xCE, + 0x99, 0xCC, 0x81, 0xCD, 0x04, 0xCE, 0x99, 0xCC, + 0x84, 0xCD, 0x04, 0xCE, 0x99, 0xCC, 0x86, 0xCD, + 0x04, 0xCE, 0x99, 0xCC, 0x88, 0xCD, 0x04, 0xCE, + // Bytes 3780 - 37bf + 0x9F, 0xCC, 0x80, 0xCD, 0x04, 0xCE, 0x9F, 0xCC, + 0x81, 0xCD, 0x04, 0xCE, 0xA1, 0xCC, 0x94, 0xCD, + 0x04, 0xCE, 0xA5, 0xCC, 0x80, 0xCD, 0x04, 0xCE, + 0xA5, 0xCC, 0x81, 0xCD, 0x04, 0xCE, 0xA5, 0xCC, + 0x84, 0xCD, 0x04, 0xCE, 0xA5, 0xCC, 0x86, 0xCD, + 0x04, 0xCE, 0xA5, 0xCC, 0x88, 0xCD, 0x04, 0xCE, + 0xA9, 0xCC, 0x80, 0xCD, 0x04, 0xCE, 0xA9, 0xCC, + 0x81, 0xCD, 0x04, 0xCE, 0xA9, 0xCD, 0x85, 0xDD, + // Bytes 37c0 - 37ff + 0x04, 0xCE, 0xB1, 0xCC, 0x84, 0xCD, 0x04, 0xCE, + 0xB1, 0xCC, 0x86, 0xCD, 0x04, 0xCE, 0xB1, 0xCD, + 0x85, 0xDD, 0x04, 0xCE, 0xB5, 0xCC, 0x80, 0xCD, + 0x04, 0xCE, 0xB5, 0xCC, 0x81, 0xCD, 0x04, 0xCE, + 0xB7, 0xCD, 0x85, 0xDD, 0x04, 0xCE, 0xB9, 0xCC, + 0x80, 0xCD, 0x04, 0xCE, 0xB9, 0xCC, 0x81, 0xCD, + 0x04, 0xCE, 0xB9, 0xCC, 0x84, 0xCD, 0x04, 0xCE, + 0xB9, 0xCC, 0x86, 0xCD, 0x04, 0xCE, 0xB9, 0xCD, + // Bytes 3800 - 383f + 0x82, 0xCD, 0x04, 0xCE, 0xBF, 0xCC, 0x80, 0xCD, + 0x04, 0xCE, 0xBF, 0xCC, 0x81, 0xCD, 0x04, 0xCF, + 0x81, 0xCC, 0x93, 0xCD, 0x04, 0xCF, 0x81, 0xCC, + 0x94, 0xCD, 0x04, 0xCF, 0x85, 0xCC, 0x80, 0xCD, + 0x04, 0xCF, 0x85, 0xCC, 0x81, 0xCD, 0x04, 0xCF, + 0x85, 0xCC, 0x84, 0xCD, 0x04, 0xCF, 0x85, 0xCC, + 0x86, 0xCD, 0x04, 0xCF, 0x85, 0xCD, 0x82, 0xCD, + 0x04, 0xCF, 0x89, 0xCD, 0x85, 0xDD, 0x04, 0xCF, + // Bytes 3840 - 387f + 0x92, 0xCC, 0x81, 0xCD, 0x04, 0xCF, 0x92, 0xCC, + 0x88, 0xCD, 0x04, 0xD0, 0x86, 0xCC, 0x88, 0xCD, + 0x04, 0xD0, 0x90, 0xCC, 0x86, 0xCD, 0x04, 0xD0, + 0x90, 0xCC, 0x88, 0xCD, 0x04, 0xD0, 0x93, 0xCC, + 0x81, 0xCD, 0x04, 0xD0, 0x95, 0xCC, 0x80, 0xCD, + 0x04, 0xD0, 0x95, 0xCC, 0x86, 0xCD, 0x04, 0xD0, + 0x95, 0xCC, 0x88, 0xCD, 0x04, 0xD0, 0x96, 0xCC, + 0x86, 0xCD, 0x04, 0xD0, 0x96, 0xCC, 0x88, 0xCD, + // Bytes 3880 - 38bf + 0x04, 0xD0, 0x97, 0xCC, 0x88, 0xCD, 0x04, 0xD0, + 0x98, 0xCC, 0x80, 0xCD, 0x04, 0xD0, 0x98, 0xCC, + 0x84, 0xCD, 0x04, 0xD0, 0x98, 0xCC, 0x86, 0xCD, + 0x04, 0xD0, 0x98, 0xCC, 0x88, 0xCD, 0x04, 0xD0, + 0x9A, 0xCC, 0x81, 0xCD, 0x04, 0xD0, 0x9E, 0xCC, + 0x88, 0xCD, 0x04, 0xD0, 0xA3, 0xCC, 0x84, 0xCD, + 0x04, 0xD0, 0xA3, 0xCC, 0x86, 0xCD, 0x04, 0xD0, + 0xA3, 0xCC, 0x88, 0xCD, 0x04, 0xD0, 0xA3, 0xCC, + // Bytes 38c0 - 38ff + 0x8B, 0xCD, 0x04, 0xD0, 0xA7, 0xCC, 0x88, 0xCD, + 0x04, 0xD0, 0xAB, 0xCC, 0x88, 0xCD, 0x04, 0xD0, + 0xAD, 0xCC, 0x88, 0xCD, 0x04, 0xD0, 0xB0, 0xCC, + 0x86, 0xCD, 0x04, 0xD0, 0xB0, 0xCC, 0x88, 0xCD, + 0x04, 0xD0, 0xB3, 0xCC, 0x81, 0xCD, 0x04, 0xD0, + 0xB5, 0xCC, 0x80, 0xCD, 0x04, 0xD0, 0xB5, 0xCC, + 0x86, 0xCD, 0x04, 0xD0, 0xB5, 0xCC, 0x88, 0xCD, + 0x04, 0xD0, 0xB6, 0xCC, 0x86, 0xCD, 0x04, 0xD0, + // Bytes 3900 - 393f + 0xB6, 0xCC, 0x88, 0xCD, 0x04, 0xD0, 0xB7, 0xCC, + 0x88, 0xCD, 0x04, 0xD0, 0xB8, 0xCC, 0x80, 0xCD, + 0x04, 0xD0, 0xB8, 0xCC, 0x84, 0xCD, 0x04, 0xD0, + 0xB8, 0xCC, 0x86, 0xCD, 0x04, 0xD0, 0xB8, 0xCC, + 0x88, 0xCD, 0x04, 0xD0, 0xBA, 0xCC, 0x81, 0xCD, + 0x04, 0xD0, 0xBE, 0xCC, 0x88, 0xCD, 0x04, 0xD1, + 0x83, 0xCC, 0x84, 0xCD, 0x04, 0xD1, 0x83, 0xCC, + 0x86, 0xCD, 0x04, 0xD1, 0x83, 0xCC, 0x88, 0xCD, + // Bytes 3940 - 397f + 0x04, 0xD1, 0x83, 0xCC, 0x8B, 0xCD, 0x04, 0xD1, + 0x87, 0xCC, 0x88, 0xCD, 0x04, 0xD1, 0x8B, 0xCC, + 0x88, 0xCD, 0x04, 0xD1, 0x8D, 0xCC, 0x88, 0xCD, + 0x04, 0xD1, 0x96, 0xCC, 0x88, 0xCD, 0x04, 0xD1, + 0xB4, 0xCC, 0x8F, 0xCD, 0x04, 0xD1, 0xB5, 0xCC, + 0x8F, 0xCD, 0x04, 0xD3, 0x98, 0xCC, 0x88, 0xCD, + 0x04, 0xD3, 0x99, 0xCC, 0x88, 0xCD, 0x04, 0xD3, + 0xA8, 0xCC, 0x88, 0xCD, 0x04, 0xD3, 0xA9, 0xCC, + // Bytes 3980 - 39bf + 0x88, 0xCD, 0x04, 0xD8, 0xA7, 0xD9, 0x93, 0xCD, + 0x04, 0xD8, 0xA7, 0xD9, 0x94, 0xCD, 0x04, 0xD8, + 0xA7, 0xD9, 0x95, 0xB9, 0x04, 0xD9, 0x88, 0xD9, + 0x94, 0xCD, 0x04, 0xD9, 0x8A, 0xD9, 0x94, 0xCD, + 0x04, 0xDB, 0x81, 0xD9, 0x94, 0xCD, 0x04, 0xDB, + 0x92, 0xD9, 0x94, 0xCD, 0x04, 0xDB, 0x95, 0xD9, + 0x94, 0xCD, 0x05, 0x41, 0xCC, 0x82, 0xCC, 0x80, + 0xCE, 0x05, 0x41, 0xCC, 0x82, 0xCC, 0x81, 0xCE, + // Bytes 39c0 - 39ff + 0x05, 0x41, 0xCC, 0x82, 0xCC, 0x83, 0xCE, 0x05, + 0x41, 0xCC, 0x82, 0xCC, 0x89, 0xCE, 0x05, 0x41, + 0xCC, 0x86, 0xCC, 0x80, 0xCE, 0x05, 0x41, 0xCC, + 0x86, 0xCC, 0x81, 0xCE, 0x05, 0x41, 0xCC, 0x86, + 0xCC, 0x83, 0xCE, 0x05, 0x41, 0xCC, 0x86, 0xCC, + 0x89, 0xCE, 0x05, 0x41, 0xCC, 0x87, 0xCC, 0x84, + 0xCE, 0x05, 0x41, 0xCC, 0x88, 0xCC, 0x84, 0xCE, + 0x05, 0x41, 0xCC, 0x8A, 0xCC, 0x81, 0xCE, 0x05, + // Bytes 3a00 - 3a3f + 0x41, 0xCC, 0xA3, 0xCC, 0x82, 0xCE, 0x05, 0x41, + 0xCC, 0xA3, 0xCC, 0x86, 0xCE, 0x05, 0x43, 0xCC, + 0xA7, 0xCC, 0x81, 0xCE, 0x05, 0x45, 0xCC, 0x82, + 0xCC, 0x80, 0xCE, 0x05, 0x45, 0xCC, 0x82, 0xCC, + 0x81, 0xCE, 0x05, 0x45, 0xCC, 0x82, 0xCC, 0x83, + 0xCE, 0x05, 0x45, 0xCC, 0x82, 0xCC, 0x89, 0xCE, + 0x05, 0x45, 0xCC, 0x84, 0xCC, 0x80, 0xCE, 0x05, + 0x45, 0xCC, 0x84, 0xCC, 0x81, 0xCE, 0x05, 0x45, + // Bytes 3a40 - 3a7f + 0xCC, 0xA3, 0xCC, 0x82, 0xCE, 0x05, 0x45, 0xCC, + 0xA7, 0xCC, 0x86, 0xCE, 0x05, 0x49, 0xCC, 0x88, + 0xCC, 0x81, 0xCE, 0x05, 0x4C, 0xCC, 0xA3, 0xCC, + 0x84, 0xCE, 0x05, 0x4F, 0xCC, 0x82, 0xCC, 0x80, + 0xCE, 0x05, 0x4F, 0xCC, 0x82, 0xCC, 0x81, 0xCE, + 0x05, 0x4F, 0xCC, 0x82, 0xCC, 0x83, 0xCE, 0x05, + 0x4F, 0xCC, 0x82, 0xCC, 0x89, 0xCE, 0x05, 0x4F, + 0xCC, 0x83, 0xCC, 0x81, 0xCE, 0x05, 0x4F, 0xCC, + // Bytes 3a80 - 3abf + 0x83, 0xCC, 0x84, 0xCE, 0x05, 0x4F, 0xCC, 0x83, + 0xCC, 0x88, 0xCE, 0x05, 0x4F, 0xCC, 0x84, 0xCC, + 0x80, 0xCE, 0x05, 0x4F, 0xCC, 0x84, 0xCC, 0x81, + 0xCE, 0x05, 0x4F, 0xCC, 0x87, 0xCC, 0x84, 0xCE, + 0x05, 0x4F, 0xCC, 0x88, 0xCC, 0x84, 0xCE, 0x05, + 0x4F, 0xCC, 0x9B, 0xCC, 0x80, 0xCE, 0x05, 0x4F, + 0xCC, 0x9B, 0xCC, 0x81, 0xCE, 0x05, 0x4F, 0xCC, + 0x9B, 0xCC, 0x83, 0xCE, 0x05, 0x4F, 0xCC, 0x9B, + // Bytes 3ac0 - 3aff + 0xCC, 0x89, 0xCE, 0x05, 0x4F, 0xCC, 0x9B, 0xCC, + 0xA3, 0xBA, 0x05, 0x4F, 0xCC, 0xA3, 0xCC, 0x82, + 0xCE, 0x05, 0x4F, 0xCC, 0xA8, 0xCC, 0x84, 0xCE, + 0x05, 0x52, 0xCC, 0xA3, 0xCC, 0x84, 0xCE, 0x05, + 0x53, 0xCC, 0x81, 0xCC, 0x87, 0xCE, 0x05, 0x53, + 0xCC, 0x8C, 0xCC, 0x87, 0xCE, 0x05, 0x53, 0xCC, + 0xA3, 0xCC, 0x87, 0xCE, 0x05, 0x55, 0xCC, 0x83, + 0xCC, 0x81, 0xCE, 0x05, 0x55, 0xCC, 0x84, 0xCC, + // Bytes 3b00 - 3b3f + 0x88, 0xCE, 0x05, 0x55, 0xCC, 0x88, 0xCC, 0x80, + 0xCE, 0x05, 0x55, 0xCC, 0x88, 0xCC, 0x81, 0xCE, + 0x05, 0x55, 0xCC, 0x88, 0xCC, 0x84, 0xCE, 0x05, + 0x55, 0xCC, 0x88, 0xCC, 0x8C, 0xCE, 0x05, 0x55, + 0xCC, 0x9B, 0xCC, 0x80, 0xCE, 0x05, 0x55, 0xCC, + 0x9B, 0xCC, 0x81, 0xCE, 0x05, 0x55, 0xCC, 0x9B, + 0xCC, 0x83, 0xCE, 0x05, 0x55, 0xCC, 0x9B, 0xCC, + 0x89, 0xCE, 0x05, 0x55, 0xCC, 0x9B, 0xCC, 0xA3, + // Bytes 3b40 - 3b7f + 0xBA, 0x05, 0x61, 0xCC, 0x82, 0xCC, 0x80, 0xCE, + 0x05, 0x61, 0xCC, 0x82, 0xCC, 0x81, 0xCE, 0x05, + 0x61, 0xCC, 0x82, 0xCC, 0x83, 0xCE, 0x05, 0x61, + 0xCC, 0x82, 0xCC, 0x89, 0xCE, 0x05, 0x61, 0xCC, + 0x86, 0xCC, 0x80, 0xCE, 0x05, 0x61, 0xCC, 0x86, + 0xCC, 0x81, 0xCE, 0x05, 0x61, 0xCC, 0x86, 0xCC, + 0x83, 0xCE, 0x05, 0x61, 0xCC, 0x86, 0xCC, 0x89, + 0xCE, 0x05, 0x61, 0xCC, 0x87, 0xCC, 0x84, 0xCE, + // Bytes 3b80 - 3bbf + 0x05, 0x61, 0xCC, 0x88, 0xCC, 0x84, 0xCE, 0x05, + 0x61, 0xCC, 0x8A, 0xCC, 0x81, 0xCE, 0x05, 0x61, + 0xCC, 0xA3, 0xCC, 0x82, 0xCE, 0x05, 0x61, 0xCC, + 0xA3, 0xCC, 0x86, 0xCE, 0x05, 0x63, 0xCC, 0xA7, + 0xCC, 0x81, 0xCE, 0x05, 0x65, 0xCC, 0x82, 0xCC, + 0x80, 0xCE, 0x05, 0x65, 0xCC, 0x82, 0xCC, 0x81, + 0xCE, 0x05, 0x65, 0xCC, 0x82, 0xCC, 0x83, 0xCE, + 0x05, 0x65, 0xCC, 0x82, 0xCC, 0x89, 0xCE, 0x05, + // Bytes 3bc0 - 3bff + 0x65, 0xCC, 0x84, 0xCC, 0x80, 0xCE, 0x05, 0x65, + 0xCC, 0x84, 0xCC, 0x81, 0xCE, 0x05, 0x65, 0xCC, + 0xA3, 0xCC, 0x82, 0xCE, 0x05, 0x65, 0xCC, 0xA7, + 0xCC, 0x86, 0xCE, 0x05, 0x69, 0xCC, 0x88, 0xCC, + 0x81, 0xCE, 0x05, 0x6C, 0xCC, 0xA3, 0xCC, 0x84, + 0xCE, 0x05, 0x6F, 0xCC, 0x82, 0xCC, 0x80, 0xCE, + 0x05, 0x6F, 0xCC, 0x82, 0xCC, 0x81, 0xCE, 0x05, + 0x6F, 0xCC, 0x82, 0xCC, 0x83, 0xCE, 0x05, 0x6F, + // Bytes 3c00 - 3c3f + 0xCC, 0x82, 0xCC, 0x89, 0xCE, 0x05, 0x6F, 0xCC, + 0x83, 0xCC, 0x81, 0xCE, 0x05, 0x6F, 0xCC, 0x83, + 0xCC, 0x84, 0xCE, 0x05, 0x6F, 0xCC, 0x83, 0xCC, + 0x88, 0xCE, 0x05, 0x6F, 0xCC, 0x84, 0xCC, 0x80, + 0xCE, 0x05, 0x6F, 0xCC, 0x84, 0xCC, 0x81, 0xCE, + 0x05, 0x6F, 0xCC, 0x87, 0xCC, 0x84, 0xCE, 0x05, + 0x6F, 0xCC, 0x88, 0xCC, 0x84, 0xCE, 0x05, 0x6F, + 0xCC, 0x9B, 0xCC, 0x80, 0xCE, 0x05, 0x6F, 0xCC, + // Bytes 3c40 - 3c7f + 0x9B, 0xCC, 0x81, 0xCE, 0x05, 0x6F, 0xCC, 0x9B, + 0xCC, 0x83, 0xCE, 0x05, 0x6F, 0xCC, 0x9B, 0xCC, + 0x89, 0xCE, 0x05, 0x6F, 0xCC, 0x9B, 0xCC, 0xA3, + 0xBA, 0x05, 0x6F, 0xCC, 0xA3, 0xCC, 0x82, 0xCE, + 0x05, 0x6F, 0xCC, 0xA8, 0xCC, 0x84, 0xCE, 0x05, + 0x72, 0xCC, 0xA3, 0xCC, 0x84, 0xCE, 0x05, 0x73, + 0xCC, 0x81, 0xCC, 0x87, 0xCE, 0x05, 0x73, 0xCC, + 0x8C, 0xCC, 0x87, 0xCE, 0x05, 0x73, 0xCC, 0xA3, + // Bytes 3c80 - 3cbf + 0xCC, 0x87, 0xCE, 0x05, 0x75, 0xCC, 0x83, 0xCC, + 0x81, 0xCE, 0x05, 0x75, 0xCC, 0x84, 0xCC, 0x88, + 0xCE, 0x05, 0x75, 0xCC, 0x88, 0xCC, 0x80, 0xCE, + 0x05, 0x75, 0xCC, 0x88, 0xCC, 0x81, 0xCE, 0x05, + 0x75, 0xCC, 0x88, 0xCC, 0x84, 0xCE, 0x05, 0x75, + 0xCC, 0x88, 0xCC, 0x8C, 0xCE, 0x05, 0x75, 0xCC, + 0x9B, 0xCC, 0x80, 0xCE, 0x05, 0x75, 0xCC, 0x9B, + 0xCC, 0x81, 0xCE, 0x05, 0x75, 0xCC, 0x9B, 0xCC, + // Bytes 3cc0 - 3cff + 0x83, 0xCE, 0x05, 0x75, 0xCC, 0x9B, 0xCC, 0x89, + 0xCE, 0x05, 0x75, 0xCC, 0x9B, 0xCC, 0xA3, 0xBA, + 0x05, 0xE1, 0xBE, 0xBF, 0xCC, 0x80, 0xCE, 0x05, + 0xE1, 0xBE, 0xBF, 0xCC, 0x81, 0xCE, 0x05, 0xE1, + 0xBE, 0xBF, 0xCD, 0x82, 0xCE, 0x05, 0xE1, 0xBF, + 0xBE, 0xCC, 0x80, 0xCE, 0x05, 0xE1, 0xBF, 0xBE, + 0xCC, 0x81, 0xCE, 0x05, 0xE1, 0xBF, 0xBE, 0xCD, + 0x82, 0xCE, 0x05, 0xE2, 0x86, 0x90, 0xCC, 0xB8, + // Bytes 3d00 - 3d3f + 0x05, 0x05, 0xE2, 0x86, 0x92, 0xCC, 0xB8, 0x05, + 0x05, 0xE2, 0x86, 0x94, 0xCC, 0xB8, 0x05, 0x05, + 0xE2, 0x87, 0x90, 0xCC, 0xB8, 0x05, 0x05, 0xE2, + 0x87, 0x92, 0xCC, 0xB8, 0x05, 0x05, 0xE2, 0x87, + 0x94, 0xCC, 0xB8, 0x05, 0x05, 0xE2, 0x88, 0x83, + 0xCC, 0xB8, 0x05, 0x05, 0xE2, 0x88, 0x88, 0xCC, + 0xB8, 0x05, 0x05, 0xE2, 0x88, 0x8B, 0xCC, 0xB8, + 0x05, 0x05, 0xE2, 0x88, 0xA3, 0xCC, 0xB8, 0x05, + // Bytes 3d40 - 3d7f + 0x05, 0xE2, 0x88, 0xA5, 0xCC, 0xB8, 0x05, 0x05, + 0xE2, 0x88, 0xBC, 0xCC, 0xB8, 0x05, 0x05, 0xE2, + 0x89, 0x83, 0xCC, 0xB8, 0x05, 0x05, 0xE2, 0x89, + 0x85, 0xCC, 0xB8, 0x05, 0x05, 0xE2, 0x89, 0x88, + 0xCC, 0xB8, 0x05, 0x05, 0xE2, 0x89, 0x8D, 0xCC, + 0xB8, 0x05, 0x05, 0xE2, 0x89, 0xA1, 0xCC, 0xB8, + 0x05, 0x05, 0xE2, 0x89, 0xA4, 0xCC, 0xB8, 0x05, + 0x05, 0xE2, 0x89, 0xA5, 0xCC, 0xB8, 0x05, 0x05, + // Bytes 3d80 - 3dbf + 0xE2, 0x89, 0xB2, 0xCC, 0xB8, 0x05, 0x05, 0xE2, + 0x89, 0xB3, 0xCC, 0xB8, 0x05, 0x05, 0xE2, 0x89, + 0xB6, 0xCC, 0xB8, 0x05, 0x05, 0xE2, 0x89, 0xB7, + 0xCC, 0xB8, 0x05, 0x05, 0xE2, 0x89, 0xBA, 0xCC, + 0xB8, 0x05, 0x05, 0xE2, 0x89, 0xBB, 0xCC, 0xB8, + 0x05, 0x05, 0xE2, 0x89, 0xBC, 0xCC, 0xB8, 0x05, + 0x05, 0xE2, 0x89, 0xBD, 0xCC, 0xB8, 0x05, 0x05, + 0xE2, 0x8A, 0x82, 0xCC, 0xB8, 0x05, 0x05, 0xE2, + // Bytes 3dc0 - 3dff + 0x8A, 0x83, 0xCC, 0xB8, 0x05, 0x05, 0xE2, 0x8A, + 0x86, 0xCC, 0xB8, 0x05, 0x05, 0xE2, 0x8A, 0x87, + 0xCC, 0xB8, 0x05, 0x05, 0xE2, 0x8A, 0x91, 0xCC, + 0xB8, 0x05, 0x05, 0xE2, 0x8A, 0x92, 0xCC, 0xB8, + 0x05, 0x05, 0xE2, 0x8A, 0xA2, 0xCC, 0xB8, 0x05, + 0x05, 0xE2, 0x8A, 0xA8, 0xCC, 0xB8, 0x05, 0x05, + 0xE2, 0x8A, 0xA9, 0xCC, 0xB8, 0x05, 0x05, 0xE2, + 0x8A, 0xAB, 0xCC, 0xB8, 0x05, 0x05, 0xE2, 0x8A, + // Bytes 3e00 - 3e3f + 0xB2, 0xCC, 0xB8, 0x05, 0x05, 0xE2, 0x8A, 0xB3, + 0xCC, 0xB8, 0x05, 0x05, 0xE2, 0x8A, 0xB4, 0xCC, + 0xB8, 0x05, 0x05, 0xE2, 0x8A, 0xB5, 0xCC, 0xB8, + 0x05, 0x06, 0xCE, 0x91, 0xCC, 0x93, 0xCD, 0x85, + 0xDE, 0x06, 0xCE, 0x91, 0xCC, 0x94, 0xCD, 0x85, + 0xDE, 0x06, 0xCE, 0x95, 0xCC, 0x93, 0xCC, 0x80, + 0xCE, 0x06, 0xCE, 0x95, 0xCC, 0x93, 0xCC, 0x81, + 0xCE, 0x06, 0xCE, 0x95, 0xCC, 0x94, 0xCC, 0x80, + // Bytes 3e40 - 3e7f + 0xCE, 0x06, 0xCE, 0x95, 0xCC, 0x94, 0xCC, 0x81, + 0xCE, 0x06, 0xCE, 0x97, 0xCC, 0x93, 0xCD, 0x85, + 0xDE, 0x06, 0xCE, 0x97, 0xCC, 0x94, 0xCD, 0x85, + 0xDE, 0x06, 0xCE, 0x99, 0xCC, 0x93, 0xCC, 0x80, + 0xCE, 0x06, 0xCE, 0x99, 0xCC, 0x93, 0xCC, 0x81, + 0xCE, 0x06, 0xCE, 0x99, 0xCC, 0x93, 0xCD, 0x82, + 0xCE, 0x06, 0xCE, 0x99, 0xCC, 0x94, 0xCC, 0x80, + 0xCE, 0x06, 0xCE, 0x99, 0xCC, 0x94, 0xCC, 0x81, + // Bytes 3e80 - 3ebf + 0xCE, 0x06, 0xCE, 0x99, 0xCC, 0x94, 0xCD, 0x82, + 0xCE, 0x06, 0xCE, 0x9F, 0xCC, 0x93, 0xCC, 0x80, + 0xCE, 0x06, 0xCE, 0x9F, 0xCC, 0x93, 0xCC, 0x81, + 0xCE, 0x06, 0xCE, 0x9F, 0xCC, 0x94, 0xCC, 0x80, + 0xCE, 0x06, 0xCE, 0x9F, 0xCC, 0x94, 0xCC, 0x81, + 0xCE, 0x06, 0xCE, 0xA5, 0xCC, 0x94, 0xCC, 0x80, + 0xCE, 0x06, 0xCE, 0xA5, 0xCC, 0x94, 0xCC, 0x81, + 0xCE, 0x06, 0xCE, 0xA5, 0xCC, 0x94, 0xCD, 0x82, + // Bytes 3ec0 - 3eff + 0xCE, 0x06, 0xCE, 0xA9, 0xCC, 0x93, 0xCD, 0x85, + 0xDE, 0x06, 0xCE, 0xA9, 0xCC, 0x94, 0xCD, 0x85, + 0xDE, 0x06, 0xCE, 0xB1, 0xCC, 0x80, 0xCD, 0x85, + 0xDE, 0x06, 0xCE, 0xB1, 0xCC, 0x81, 0xCD, 0x85, + 0xDE, 0x06, 0xCE, 0xB1, 0xCC, 0x93, 0xCD, 0x85, + 0xDE, 0x06, 0xCE, 0xB1, 0xCC, 0x94, 0xCD, 0x85, + 0xDE, 0x06, 0xCE, 0xB1, 0xCD, 0x82, 0xCD, 0x85, + 0xDE, 0x06, 0xCE, 0xB5, 0xCC, 0x93, 0xCC, 0x80, + // Bytes 3f00 - 3f3f + 0xCE, 0x06, 0xCE, 0xB5, 0xCC, 0x93, 0xCC, 0x81, + 0xCE, 0x06, 0xCE, 0xB5, 0xCC, 0x94, 0xCC, 0x80, + 0xCE, 0x06, 0xCE, 0xB5, 0xCC, 0x94, 0xCC, 0x81, + 0xCE, 0x06, 0xCE, 0xB7, 0xCC, 0x80, 0xCD, 0x85, + 0xDE, 0x06, 0xCE, 0xB7, 0xCC, 0x81, 0xCD, 0x85, + 0xDE, 0x06, 0xCE, 0xB7, 0xCC, 0x93, 0xCD, 0x85, + 0xDE, 0x06, 0xCE, 0xB7, 0xCC, 0x94, 0xCD, 0x85, + 0xDE, 0x06, 0xCE, 0xB7, 0xCD, 0x82, 0xCD, 0x85, + // Bytes 3f40 - 3f7f + 0xDE, 0x06, 0xCE, 0xB9, 0xCC, 0x88, 0xCC, 0x80, + 0xCE, 0x06, 0xCE, 0xB9, 0xCC, 0x88, 0xCC, 0x81, + 0xCE, 0x06, 0xCE, 0xB9, 0xCC, 0x88, 0xCD, 0x82, + 0xCE, 0x06, 0xCE, 0xB9, 0xCC, 0x93, 0xCC, 0x80, + 0xCE, 0x06, 0xCE, 0xB9, 0xCC, 0x93, 0xCC, 0x81, + 0xCE, 0x06, 0xCE, 0xB9, 0xCC, 0x93, 0xCD, 0x82, + 0xCE, 0x06, 0xCE, 0xB9, 0xCC, 0x94, 0xCC, 0x80, + 0xCE, 0x06, 0xCE, 0xB9, 0xCC, 0x94, 0xCC, 0x81, + // Bytes 3f80 - 3fbf + 0xCE, 0x06, 0xCE, 0xB9, 0xCC, 0x94, 0xCD, 0x82, + 0xCE, 0x06, 0xCE, 0xBF, 0xCC, 0x93, 0xCC, 0x80, + 0xCE, 0x06, 0xCE, 0xBF, 0xCC, 0x93, 0xCC, 0x81, + 0xCE, 0x06, 0xCE, 0xBF, 0xCC, 0x94, 0xCC, 0x80, + 0xCE, 0x06, 0xCE, 0xBF, 0xCC, 0x94, 0xCC, 0x81, + 0xCE, 0x06, 0xCF, 0x85, 0xCC, 0x88, 0xCC, 0x80, + 0xCE, 0x06, 0xCF, 0x85, 0xCC, 0x88, 0xCC, 0x81, + 0xCE, 0x06, 0xCF, 0x85, 0xCC, 0x88, 0xCD, 0x82, + // Bytes 3fc0 - 3fff + 0xCE, 0x06, 0xCF, 0x85, 0xCC, 0x93, 0xCC, 0x80, + 0xCE, 0x06, 0xCF, 0x85, 0xCC, 0x93, 0xCC, 0x81, + 0xCE, 0x06, 0xCF, 0x85, 0xCC, 0x93, 0xCD, 0x82, + 0xCE, 0x06, 0xCF, 0x85, 0xCC, 0x94, 0xCC, 0x80, + 0xCE, 0x06, 0xCF, 0x85, 0xCC, 0x94, 0xCC, 0x81, + 0xCE, 0x06, 0xCF, 0x85, 0xCC, 0x94, 0xCD, 0x82, + 0xCE, 0x06, 0xCF, 0x89, 0xCC, 0x80, 0xCD, 0x85, + 0xDE, 0x06, 0xCF, 0x89, 0xCC, 0x81, 0xCD, 0x85, + // Bytes 4000 - 403f + 0xDE, 0x06, 0xCF, 0x89, 0xCC, 0x93, 0xCD, 0x85, + 0xDE, 0x06, 0xCF, 0x89, 0xCC, 0x94, 0xCD, 0x85, + 0xDE, 0x06, 0xCF, 0x89, 0xCD, 0x82, 0xCD, 0x85, + 0xDE, 0x06, 0xE0, 0xA4, 0xA8, 0xE0, 0xA4, 0xBC, + 0x0D, 0x06, 0xE0, 0xA4, 0xB0, 0xE0, 0xA4, 0xBC, + 0x0D, 0x06, 0xE0, 0xA4, 0xB3, 0xE0, 0xA4, 0xBC, + 0x0D, 0x06, 0xE0, 0xB1, 0x86, 0xE0, 0xB1, 0x96, + 0x89, 0x06, 0xE0, 0xB7, 0x99, 0xE0, 0xB7, 0x8A, + // Bytes 4040 - 407f + 0x15, 0x06, 0xE3, 0x81, 0x86, 0xE3, 0x82, 0x99, + 0x11, 0x06, 0xE3, 0x81, 0x8B, 0xE3, 0x82, 0x99, + 0x11, 0x06, 0xE3, 0x81, 0x8D, 0xE3, 0x82, 0x99, + 0x11, 0x06, 0xE3, 0x81, 0x8F, 0xE3, 0x82, 0x99, + 0x11, 0x06, 0xE3, 0x81, 0x91, 0xE3, 0x82, 0x99, + 0x11, 0x06, 0xE3, 0x81, 0x93, 0xE3, 0x82, 0x99, + 0x11, 0x06, 0xE3, 0x81, 0x95, 0xE3, 0x82, 0x99, + 0x11, 0x06, 0xE3, 0x81, 0x97, 0xE3, 0x82, 0x99, + // Bytes 4080 - 40bf + 0x11, 0x06, 0xE3, 0x81, 0x99, 0xE3, 0x82, 0x99, + 0x11, 0x06, 0xE3, 0x81, 0x9B, 0xE3, 0x82, 0x99, + 0x11, 0x06, 0xE3, 0x81, 0x9D, 0xE3, 0x82, 0x99, + 0x11, 0x06, 0xE3, 0x81, 0x9F, 0xE3, 0x82, 0x99, + 0x11, 0x06, 0xE3, 0x81, 0xA1, 0xE3, 0x82, 0x99, + 0x11, 0x06, 0xE3, 0x81, 0xA4, 0xE3, 0x82, 0x99, + 0x11, 0x06, 0xE3, 0x81, 0xA6, 0xE3, 0x82, 0x99, + 0x11, 0x06, 0xE3, 0x81, 0xA8, 0xE3, 0x82, 0x99, + // Bytes 40c0 - 40ff + 0x11, 0x06, 0xE3, 0x81, 0xAF, 0xE3, 0x82, 0x99, + 0x11, 0x06, 0xE3, 0x81, 0xAF, 0xE3, 0x82, 0x9A, + 0x11, 0x06, 0xE3, 0x81, 0xB2, 0xE3, 0x82, 0x99, + 0x11, 0x06, 0xE3, 0x81, 0xB2, 0xE3, 0x82, 0x9A, + 0x11, 0x06, 0xE3, 0x81, 0xB5, 0xE3, 0x82, 0x99, + 0x11, 0x06, 0xE3, 0x81, 0xB5, 0xE3, 0x82, 0x9A, + 0x11, 0x06, 0xE3, 0x81, 0xB8, 0xE3, 0x82, 0x99, + 0x11, 0x06, 0xE3, 0x81, 0xB8, 0xE3, 0x82, 0x9A, + // Bytes 4100 - 413f + 0x11, 0x06, 0xE3, 0x81, 0xBB, 0xE3, 0x82, 0x99, + 0x11, 0x06, 0xE3, 0x81, 0xBB, 0xE3, 0x82, 0x9A, + 0x11, 0x06, 0xE3, 0x82, 0x9D, 0xE3, 0x82, 0x99, + 0x11, 0x06, 0xE3, 0x82, 0xA6, 0xE3, 0x82, 0x99, + 0x11, 0x06, 0xE3, 0x82, 0xAB, 0xE3, 0x82, 0x99, + 0x11, 0x06, 0xE3, 0x82, 0xAD, 0xE3, 0x82, 0x99, + 0x11, 0x06, 0xE3, 0x82, 0xAF, 0xE3, 0x82, 0x99, + 0x11, 0x06, 0xE3, 0x82, 0xB1, 0xE3, 0x82, 0x99, + // Bytes 4140 - 417f + 0x11, 0x06, 0xE3, 0x82, 0xB3, 0xE3, 0x82, 0x99, + 0x11, 0x06, 0xE3, 0x82, 0xB5, 0xE3, 0x82, 0x99, + 0x11, 0x06, 0xE3, 0x82, 0xB7, 0xE3, 0x82, 0x99, + 0x11, 0x06, 0xE3, 0x82, 0xB9, 0xE3, 0x82, 0x99, + 0x11, 0x06, 0xE3, 0x82, 0xBB, 0xE3, 0x82, 0x99, + 0x11, 0x06, 0xE3, 0x82, 0xBD, 0xE3, 0x82, 0x99, + 0x11, 0x06, 0xE3, 0x82, 0xBF, 0xE3, 0x82, 0x99, + 0x11, 0x06, 0xE3, 0x83, 0x81, 0xE3, 0x82, 0x99, + // Bytes 4180 - 41bf + 0x11, 0x06, 0xE3, 0x83, 0x84, 0xE3, 0x82, 0x99, + 0x11, 0x06, 0xE3, 0x83, 0x86, 0xE3, 0x82, 0x99, + 0x11, 0x06, 0xE3, 0x83, 0x88, 0xE3, 0x82, 0x99, + 0x11, 0x06, 0xE3, 0x83, 0x8F, 0xE3, 0x82, 0x99, + 0x11, 0x06, 0xE3, 0x83, 0x8F, 0xE3, 0x82, 0x9A, + 0x11, 0x06, 0xE3, 0x83, 0x92, 0xE3, 0x82, 0x99, + 0x11, 0x06, 0xE3, 0x83, 0x92, 0xE3, 0x82, 0x9A, + 0x11, 0x06, 0xE3, 0x83, 0x95, 0xE3, 0x82, 0x99, + // Bytes 41c0 - 41ff + 0x11, 0x06, 0xE3, 0x83, 0x95, 0xE3, 0x82, 0x9A, + 0x11, 0x06, 0xE3, 0x83, 0x98, 0xE3, 0x82, 0x99, + 0x11, 0x06, 0xE3, 0x83, 0x98, 0xE3, 0x82, 0x9A, + 0x11, 0x06, 0xE3, 0x83, 0x9B, 0xE3, 0x82, 0x99, + 0x11, 0x06, 0xE3, 0x83, 0x9B, 0xE3, 0x82, 0x9A, + 0x11, 0x06, 0xE3, 0x83, 0xAF, 0xE3, 0x82, 0x99, + 0x11, 0x06, 0xE3, 0x83, 0xB0, 0xE3, 0x82, 0x99, + 0x11, 0x06, 0xE3, 0x83, 0xB1, 0xE3, 0x82, 0x99, + // Bytes 4200 - 423f + 0x11, 0x06, 0xE3, 0x83, 0xB2, 0xE3, 0x82, 0x99, + 0x11, 0x06, 0xE3, 0x83, 0xBD, 0xE3, 0x82, 0x99, + 0x11, 0x08, 0xCE, 0x91, 0xCC, 0x93, 0xCC, 0x80, + 0xCD, 0x85, 0xDF, 0x08, 0xCE, 0x91, 0xCC, 0x93, + 0xCC, 0x81, 0xCD, 0x85, 0xDF, 0x08, 0xCE, 0x91, + 0xCC, 0x93, 0xCD, 0x82, 0xCD, 0x85, 0xDF, 0x08, + 0xCE, 0x91, 0xCC, 0x94, 0xCC, 0x80, 0xCD, 0x85, + 0xDF, 0x08, 0xCE, 0x91, 0xCC, 0x94, 0xCC, 0x81, + // Bytes 4240 - 427f + 0xCD, 0x85, 0xDF, 0x08, 0xCE, 0x91, 0xCC, 0x94, + 0xCD, 0x82, 0xCD, 0x85, 0xDF, 0x08, 0xCE, 0x97, + 0xCC, 0x93, 0xCC, 0x80, 0xCD, 0x85, 0xDF, 0x08, + 0xCE, 0x97, 0xCC, 0x93, 0xCC, 0x81, 0xCD, 0x85, + 0xDF, 0x08, 0xCE, 0x97, 0xCC, 0x93, 0xCD, 0x82, + 0xCD, 0x85, 0xDF, 0x08, 0xCE, 0x97, 0xCC, 0x94, + 0xCC, 0x80, 0xCD, 0x85, 0xDF, 0x08, 0xCE, 0x97, + 0xCC, 0x94, 0xCC, 0x81, 0xCD, 0x85, 0xDF, 0x08, + // Bytes 4280 - 42bf + 0xCE, 0x97, 0xCC, 0x94, 0xCD, 0x82, 0xCD, 0x85, + 0xDF, 0x08, 0xCE, 0xA9, 0xCC, 0x93, 0xCC, 0x80, + 0xCD, 0x85, 0xDF, 0x08, 0xCE, 0xA9, 0xCC, 0x93, + 0xCC, 0x81, 0xCD, 0x85, 0xDF, 0x08, 0xCE, 0xA9, + 0xCC, 0x93, 0xCD, 0x82, 0xCD, 0x85, 0xDF, 0x08, + 0xCE, 0xA9, 0xCC, 0x94, 0xCC, 0x80, 0xCD, 0x85, + 0xDF, 0x08, 0xCE, 0xA9, 0xCC, 0x94, 0xCC, 0x81, + 0xCD, 0x85, 0xDF, 0x08, 0xCE, 0xA9, 0xCC, 0x94, + // Bytes 42c0 - 42ff + 0xCD, 0x82, 0xCD, 0x85, 0xDF, 0x08, 0xCE, 0xB1, + 0xCC, 0x93, 0xCC, 0x80, 0xCD, 0x85, 0xDF, 0x08, + 0xCE, 0xB1, 0xCC, 0x93, 0xCC, 0x81, 0xCD, 0x85, + 0xDF, 0x08, 0xCE, 0xB1, 0xCC, 0x93, 0xCD, 0x82, + 0xCD, 0x85, 0xDF, 0x08, 0xCE, 0xB1, 0xCC, 0x94, + 0xCC, 0x80, 0xCD, 0x85, 0xDF, 0x08, 0xCE, 0xB1, + 0xCC, 0x94, 0xCC, 0x81, 0xCD, 0x85, 0xDF, 0x08, + 0xCE, 0xB1, 0xCC, 0x94, 0xCD, 0x82, 0xCD, 0x85, + // Bytes 4300 - 433f + 0xDF, 0x08, 0xCE, 0xB7, 0xCC, 0x93, 0xCC, 0x80, + 0xCD, 0x85, 0xDF, 0x08, 0xCE, 0xB7, 0xCC, 0x93, + 0xCC, 0x81, 0xCD, 0x85, 0xDF, 0x08, 0xCE, 0xB7, + 0xCC, 0x93, 0xCD, 0x82, 0xCD, 0x85, 0xDF, 0x08, + 0xCE, 0xB7, 0xCC, 0x94, 0xCC, 0x80, 0xCD, 0x85, + 0xDF, 0x08, 0xCE, 0xB7, 0xCC, 0x94, 0xCC, 0x81, + 0xCD, 0x85, 0xDF, 0x08, 0xCE, 0xB7, 0xCC, 0x94, + 0xCD, 0x82, 0xCD, 0x85, 0xDF, 0x08, 0xCF, 0x89, + // Bytes 4340 - 437f + 0xCC, 0x93, 0xCC, 0x80, 0xCD, 0x85, 0xDF, 0x08, + 0xCF, 0x89, 0xCC, 0x93, 0xCC, 0x81, 0xCD, 0x85, + 0xDF, 0x08, 0xCF, 0x89, 0xCC, 0x93, 0xCD, 0x82, + 0xCD, 0x85, 0xDF, 0x08, 0xCF, 0x89, 0xCC, 0x94, + 0xCC, 0x80, 0xCD, 0x85, 0xDF, 0x08, 0xCF, 0x89, + 0xCC, 0x94, 0xCC, 0x81, 0xCD, 0x85, 0xDF, 0x08, + 0xCF, 0x89, 0xCC, 0x94, 0xCD, 0x82, 0xCD, 0x85, + 0xDF, 0x08, 0xF0, 0x91, 0x82, 0x99, 0xF0, 0x91, + // Bytes 4380 - 43bf + 0x82, 0xBA, 0x0D, 0x08, 0xF0, 0x91, 0x82, 0x9B, + 0xF0, 0x91, 0x82, 0xBA, 0x0D, 0x08, 0xF0, 0x91, + 0x82, 0xA5, 0xF0, 0x91, 0x82, 0xBA, 0x0D, 0x42, + 0xC2, 0xB4, 0x01, 0x43, 0x20, 0xCC, 0x81, 0xCD, + 0x43, 0x20, 0xCC, 0x83, 0xCD, 0x43, 0x20, 0xCC, + 0x84, 0xCD, 0x43, 0x20, 0xCC, 0x85, 0xCD, 0x43, + 0x20, 0xCC, 0x86, 0xCD, 0x43, 0x20, 0xCC, 0x87, + 0xCD, 0x43, 0x20, 0xCC, 0x88, 0xCD, 0x43, 0x20, + // Bytes 43c0 - 43ff + 0xCC, 0x8A, 0xCD, 0x43, 0x20, 0xCC, 0x8B, 0xCD, + 0x43, 0x20, 0xCC, 0x93, 0xCD, 0x43, 0x20, 0xCC, + 0x94, 0xCD, 0x43, 0x20, 0xCC, 0xA7, 0xA9, 0x43, + 0x20, 0xCC, 0xA8, 0xA9, 0x43, 0x20, 0xCC, 0xB3, + 0xB9, 0x43, 0x20, 0xCD, 0x82, 0xCD, 0x43, 0x20, + 0xCD, 0x85, 0xDD, 0x43, 0x20, 0xD9, 0x8B, 0x5D, + 0x43, 0x20, 0xD9, 0x8C, 0x61, 0x43, 0x20, 0xD9, + 0x8D, 0x65, 0x43, 0x20, 0xD9, 0x8E, 0x69, 0x43, + // Bytes 4400 - 443f + 0x20, 0xD9, 0x8F, 0x6D, 0x43, 0x20, 0xD9, 0x90, + 0x71, 0x43, 0x20, 0xD9, 0x91, 0x75, 0x43, 0x20, + 0xD9, 0x92, 0x79, 0x43, 0x41, 0xCC, 0x8A, 0xCD, + 0x43, 0x73, 0xCC, 0x87, 0xCD, 0x44, 0x20, 0xE3, + 0x82, 0x99, 0x11, 0x44, 0x20, 0xE3, 0x82, 0x9A, + 0x11, 0x44, 0xC2, 0xA8, 0xCC, 0x81, 0xCE, 0x44, + 0xCE, 0x91, 0xCC, 0x81, 0xCD, 0x44, 0xCE, 0x95, + 0xCC, 0x81, 0xCD, 0x44, 0xCE, 0x97, 0xCC, 0x81, + // Bytes 4440 - 447f + 0xCD, 0x44, 0xCE, 0x99, 0xCC, 0x81, 0xCD, 0x44, + 0xCE, 0x9F, 0xCC, 0x81, 0xCD, 0x44, 0xCE, 0xA5, + 0xCC, 0x81, 0xCD, 0x44, 0xCE, 0xA5, 0xCC, 0x88, + 0xCD, 0x44, 0xCE, 0xA9, 0xCC, 0x81, 0xCD, 0x44, + 0xCE, 0xB1, 0xCC, 0x81, 0xCD, 0x44, 0xCE, 0xB5, + 0xCC, 0x81, 0xCD, 0x44, 0xCE, 0xB7, 0xCC, 0x81, + 0xCD, 0x44, 0xCE, 0xB9, 0xCC, 0x81, 0xCD, 0x44, + 0xCE, 0xBF, 0xCC, 0x81, 0xCD, 0x44, 0xCF, 0x85, + // Bytes 4480 - 44bf + 0xCC, 0x81, 0xCD, 0x44, 0xCF, 0x89, 0xCC, 0x81, + 0xCD, 0x44, 0xD7, 0x90, 0xD6, 0xB7, 0x35, 0x44, + 0xD7, 0x90, 0xD6, 0xB8, 0x39, 0x44, 0xD7, 0x90, + 0xD6, 0xBC, 0x45, 0x44, 0xD7, 0x91, 0xD6, 0xBC, + 0x45, 0x44, 0xD7, 0x91, 0xD6, 0xBF, 0x4D, 0x44, + 0xD7, 0x92, 0xD6, 0xBC, 0x45, 0x44, 0xD7, 0x93, + 0xD6, 0xBC, 0x45, 0x44, 0xD7, 0x94, 0xD6, 0xBC, + 0x45, 0x44, 0xD7, 0x95, 0xD6, 0xB9, 0x3D, 0x44, + // Bytes 44c0 - 44ff + 0xD7, 0x95, 0xD6, 0xBC, 0x45, 0x44, 0xD7, 0x96, + 0xD6, 0xBC, 0x45, 0x44, 0xD7, 0x98, 0xD6, 0xBC, + 0x45, 0x44, 0xD7, 0x99, 0xD6, 0xB4, 0x29, 0x44, + 0xD7, 0x99, 0xD6, 0xBC, 0x45, 0x44, 0xD7, 0x9A, + 0xD6, 0xBC, 0x45, 0x44, 0xD7, 0x9B, 0xD6, 0xBC, + 0x45, 0x44, 0xD7, 0x9B, 0xD6, 0xBF, 0x4D, 0x44, + 0xD7, 0x9C, 0xD6, 0xBC, 0x45, 0x44, 0xD7, 0x9E, + 0xD6, 0xBC, 0x45, 0x44, 0xD7, 0xA0, 0xD6, 0xBC, + // Bytes 4500 - 453f + 0x45, 0x44, 0xD7, 0xA1, 0xD6, 0xBC, 0x45, 0x44, + 0xD7, 0xA3, 0xD6, 0xBC, 0x45, 0x44, 0xD7, 0xA4, + 0xD6, 0xBC, 0x45, 0x44, 0xD7, 0xA4, 0xD6, 0xBF, + 0x4D, 0x44, 0xD7, 0xA6, 0xD6, 0xBC, 0x45, 0x44, + 0xD7, 0xA7, 0xD6, 0xBC, 0x45, 0x44, 0xD7, 0xA8, + 0xD6, 0xBC, 0x45, 0x44, 0xD7, 0xA9, 0xD6, 0xBC, + 0x45, 0x44, 0xD7, 0xA9, 0xD7, 0x81, 0x51, 0x44, + 0xD7, 0xA9, 0xD7, 0x82, 0x55, 0x44, 0xD7, 0xAA, + // Bytes 4540 - 457f + 0xD6, 0xBC, 0x45, 0x44, 0xD7, 0xB2, 0xD6, 0xB7, + 0x35, 0x44, 0xD8, 0xA7, 0xD9, 0x8B, 0x5D, 0x44, + 0xD8, 0xA7, 0xD9, 0x93, 0xCD, 0x44, 0xD8, 0xA7, + 0xD9, 0x94, 0xCD, 0x44, 0xD8, 0xA7, 0xD9, 0x95, + 0xB9, 0x44, 0xD8, 0xB0, 0xD9, 0xB0, 0x7D, 0x44, + 0xD8, 0xB1, 0xD9, 0xB0, 0x7D, 0x44, 0xD9, 0x80, + 0xD9, 0x8B, 0x5D, 0x44, 0xD9, 0x80, 0xD9, 0x8E, + 0x69, 0x44, 0xD9, 0x80, 0xD9, 0x8F, 0x6D, 0x44, + // Bytes 4580 - 45bf + 0xD9, 0x80, 0xD9, 0x90, 0x71, 0x44, 0xD9, 0x80, + 0xD9, 0x91, 0x75, 0x44, 0xD9, 0x80, 0xD9, 0x92, + 0x79, 0x44, 0xD9, 0x87, 0xD9, 0xB0, 0x7D, 0x44, + 0xD9, 0x88, 0xD9, 0x94, 0xCD, 0x44, 0xD9, 0x89, + 0xD9, 0xB0, 0x7D, 0x44, 0xD9, 0x8A, 0xD9, 0x94, + 0xCD, 0x44, 0xDB, 0x92, 0xD9, 0x94, 0xCD, 0x44, + 0xDB, 0x95, 0xD9, 0x94, 0xCD, 0x45, 0x20, 0xCC, + 0x88, 0xCC, 0x80, 0xCE, 0x45, 0x20, 0xCC, 0x88, + // Bytes 45c0 - 45ff + 0xCC, 0x81, 0xCE, 0x45, 0x20, 0xCC, 0x88, 0xCD, + 0x82, 0xCE, 0x45, 0x20, 0xCC, 0x93, 0xCC, 0x80, + 0xCE, 0x45, 0x20, 0xCC, 0x93, 0xCC, 0x81, 0xCE, + 0x45, 0x20, 0xCC, 0x93, 0xCD, 0x82, 0xCE, 0x45, + 0x20, 0xCC, 0x94, 0xCC, 0x80, 0xCE, 0x45, 0x20, + 0xCC, 0x94, 0xCC, 0x81, 0xCE, 0x45, 0x20, 0xCC, + 0x94, 0xCD, 0x82, 0xCE, 0x45, 0x20, 0xD9, 0x8C, + 0xD9, 0x91, 0x76, 0x45, 0x20, 0xD9, 0x8D, 0xD9, + // Bytes 4600 - 463f + 0x91, 0x76, 0x45, 0x20, 0xD9, 0x8E, 0xD9, 0x91, + 0x76, 0x45, 0x20, 0xD9, 0x8F, 0xD9, 0x91, 0x76, + 0x45, 0x20, 0xD9, 0x90, 0xD9, 0x91, 0x76, 0x45, + 0x20, 0xD9, 0x91, 0xD9, 0xB0, 0x7E, 0x45, 0xE2, + 0xAB, 0x9D, 0xCC, 0xB8, 0x05, 0x46, 0xCE, 0xB9, + 0xCC, 0x88, 0xCC, 0x81, 0xCE, 0x46, 0xCF, 0x85, + 0xCC, 0x88, 0xCC, 0x81, 0xCE, 0x46, 0xD7, 0xA9, + 0xD6, 0xBC, 0xD7, 0x81, 0x52, 0x46, 0xD7, 0xA9, + // Bytes 4640 - 467f + 0xD6, 0xBC, 0xD7, 0x82, 0x56, 0x46, 0xD9, 0x80, + 0xD9, 0x8E, 0xD9, 0x91, 0x76, 0x46, 0xD9, 0x80, + 0xD9, 0x8F, 0xD9, 0x91, 0x76, 0x46, 0xD9, 0x80, + 0xD9, 0x90, 0xD9, 0x91, 0x76, 0x46, 0xE0, 0xA4, + 0x95, 0xE0, 0xA4, 0xBC, 0x0D, 0x46, 0xE0, 0xA4, + 0x96, 0xE0, 0xA4, 0xBC, 0x0D, 0x46, 0xE0, 0xA4, + 0x97, 0xE0, 0xA4, 0xBC, 0x0D, 0x46, 0xE0, 0xA4, + 0x9C, 0xE0, 0xA4, 0xBC, 0x0D, 0x46, 0xE0, 0xA4, + // Bytes 4680 - 46bf + 0xA1, 0xE0, 0xA4, 0xBC, 0x0D, 0x46, 0xE0, 0xA4, + 0xA2, 0xE0, 0xA4, 0xBC, 0x0D, 0x46, 0xE0, 0xA4, + 0xAB, 0xE0, 0xA4, 0xBC, 0x0D, 0x46, 0xE0, 0xA4, + 0xAF, 0xE0, 0xA4, 0xBC, 0x0D, 0x46, 0xE0, 0xA6, + 0xA1, 0xE0, 0xA6, 0xBC, 0x0D, 0x46, 0xE0, 0xA6, + 0xA2, 0xE0, 0xA6, 0xBC, 0x0D, 0x46, 0xE0, 0xA6, + 0xAF, 0xE0, 0xA6, 0xBC, 0x0D, 0x46, 0xE0, 0xA8, + 0x96, 0xE0, 0xA8, 0xBC, 0x0D, 0x46, 0xE0, 0xA8, + // Bytes 46c0 - 46ff + 0x97, 0xE0, 0xA8, 0xBC, 0x0D, 0x46, 0xE0, 0xA8, + 0x9C, 0xE0, 0xA8, 0xBC, 0x0D, 0x46, 0xE0, 0xA8, + 0xAB, 0xE0, 0xA8, 0xBC, 0x0D, 0x46, 0xE0, 0xA8, + 0xB2, 0xE0, 0xA8, 0xBC, 0x0D, 0x46, 0xE0, 0xA8, + 0xB8, 0xE0, 0xA8, 0xBC, 0x0D, 0x46, 0xE0, 0xAC, + 0xA1, 0xE0, 0xAC, 0xBC, 0x0D, 0x46, 0xE0, 0xAC, + 0xA2, 0xE0, 0xAC, 0xBC, 0x0D, 0x46, 0xE0, 0xBE, + 0xB2, 0xE0, 0xBE, 0x80, 0xA1, 0x46, 0xE0, 0xBE, + // Bytes 4700 - 473f + 0xB3, 0xE0, 0xBE, 0x80, 0xA1, 0x46, 0xE3, 0x83, + 0x86, 0xE3, 0x82, 0x99, 0x11, 0x48, 0xF0, 0x9D, + 0x85, 0x97, 0xF0, 0x9D, 0x85, 0xA5, 0xB1, 0x48, + 0xF0, 0x9D, 0x85, 0x98, 0xF0, 0x9D, 0x85, 0xA5, + 0xB1, 0x48, 0xF0, 0x9D, 0x86, 0xB9, 0xF0, 0x9D, + 0x85, 0xA5, 0xB1, 0x48, 0xF0, 0x9D, 0x86, 0xBA, + 0xF0, 0x9D, 0x85, 0xA5, 0xB1, 0x49, 0xE0, 0xBE, + 0xB2, 0xE0, 0xBD, 0xB1, 0xE0, 0xBE, 0x80, 0xA2, + // Bytes 4740 - 477f + 0x49, 0xE0, 0xBE, 0xB3, 0xE0, 0xBD, 0xB1, 0xE0, + 0xBE, 0x80, 0xA2, 0x4C, 0xF0, 0x9D, 0x85, 0x98, + 0xF0, 0x9D, 0x85, 0xA5, 0xF0, 0x9D, 0x85, 0xAE, + 0xB2, 0x4C, 0xF0, 0x9D, 0x85, 0x98, 0xF0, 0x9D, + 0x85, 0xA5, 0xF0, 0x9D, 0x85, 0xAF, 0xB2, 0x4C, + 0xF0, 0x9D, 0x85, 0x98, 0xF0, 0x9D, 0x85, 0xA5, + 0xF0, 0x9D, 0x85, 0xB0, 0xB2, 0x4C, 0xF0, 0x9D, + 0x85, 0x98, 0xF0, 0x9D, 0x85, 0xA5, 0xF0, 0x9D, + // Bytes 4780 - 47bf + 0x85, 0xB1, 0xB2, 0x4C, 0xF0, 0x9D, 0x85, 0x98, + 0xF0, 0x9D, 0x85, 0xA5, 0xF0, 0x9D, 0x85, 0xB2, + 0xB2, 0x4C, 0xF0, 0x9D, 0x86, 0xB9, 0xF0, 0x9D, + 0x85, 0xA5, 0xF0, 0x9D, 0x85, 0xAE, 0xB2, 0x4C, + 0xF0, 0x9D, 0x86, 0xB9, 0xF0, 0x9D, 0x85, 0xA5, + 0xF0, 0x9D, 0x85, 0xAF, 0xB2, 0x4C, 0xF0, 0x9D, + 0x86, 0xBA, 0xF0, 0x9D, 0x85, 0xA5, 0xF0, 0x9D, + 0x85, 0xAE, 0xB2, 0x4C, 0xF0, 0x9D, 0x86, 0xBA, + // Bytes 47c0 - 47ff + 0xF0, 0x9D, 0x85, 0xA5, 0xF0, 0x9D, 0x85, 0xAF, + 0xB2, 0x83, 0x41, 0xCC, 0x82, 0xCD, 0x83, 0x41, + 0xCC, 0x86, 0xCD, 0x83, 0x41, 0xCC, 0x87, 0xCD, + 0x83, 0x41, 0xCC, 0x88, 0xCD, 0x83, 0x41, 0xCC, + 0x8A, 0xCD, 0x83, 0x41, 0xCC, 0xA3, 0xB9, 0x83, + 0x43, 0xCC, 0xA7, 0xA9, 0x83, 0x45, 0xCC, 0x82, + 0xCD, 0x83, 0x45, 0xCC, 0x84, 0xCD, 0x83, 0x45, + 0xCC, 0xA3, 0xB9, 0x83, 0x45, 0xCC, 0xA7, 0xA9, + // Bytes 4800 - 483f + 0x83, 0x49, 0xCC, 0x88, 0xCD, 0x83, 0x4C, 0xCC, + 0xA3, 0xB9, 0x83, 0x4F, 0xCC, 0x82, 0xCD, 0x83, + 0x4F, 0xCC, 0x83, 0xCD, 0x83, 0x4F, 0xCC, 0x84, + 0xCD, 0x83, 0x4F, 0xCC, 0x87, 0xCD, 0x83, 0x4F, + 0xCC, 0x88, 0xCD, 0x83, 0x4F, 0xCC, 0x9B, 0xB1, + 0x83, 0x4F, 0xCC, 0xA3, 0xB9, 0x83, 0x4F, 0xCC, + 0xA8, 0xA9, 0x83, 0x52, 0xCC, 0xA3, 0xB9, 0x83, + 0x53, 0xCC, 0x81, 0xCD, 0x83, 0x53, 0xCC, 0x8C, + // Bytes 4840 - 487f + 0xCD, 0x83, 0x53, 0xCC, 0xA3, 0xB9, 0x83, 0x55, + 0xCC, 0x83, 0xCD, 0x83, 0x55, 0xCC, 0x84, 0xCD, + 0x83, 0x55, 0xCC, 0x88, 0xCD, 0x83, 0x55, 0xCC, + 0x9B, 0xB1, 0x83, 0x61, 0xCC, 0x82, 0xCD, 0x83, + 0x61, 0xCC, 0x86, 0xCD, 0x83, 0x61, 0xCC, 0x87, + 0xCD, 0x83, 0x61, 0xCC, 0x88, 0xCD, 0x83, 0x61, + 0xCC, 0x8A, 0xCD, 0x83, 0x61, 0xCC, 0xA3, 0xB9, + 0x83, 0x63, 0xCC, 0xA7, 0xA9, 0x83, 0x65, 0xCC, + // Bytes 4880 - 48bf + 0x82, 0xCD, 0x83, 0x65, 0xCC, 0x84, 0xCD, 0x83, + 0x65, 0xCC, 0xA3, 0xB9, 0x83, 0x65, 0xCC, 0xA7, + 0xA9, 0x83, 0x69, 0xCC, 0x88, 0xCD, 0x83, 0x6C, + 0xCC, 0xA3, 0xB9, 0x83, 0x6F, 0xCC, 0x82, 0xCD, + 0x83, 0x6F, 0xCC, 0x83, 0xCD, 0x83, 0x6F, 0xCC, + 0x84, 0xCD, 0x83, 0x6F, 0xCC, 0x87, 0xCD, 0x83, + 0x6F, 0xCC, 0x88, 0xCD, 0x83, 0x6F, 0xCC, 0x9B, + 0xB1, 0x83, 0x6F, 0xCC, 0xA3, 0xB9, 0x83, 0x6F, + // Bytes 48c0 - 48ff + 0xCC, 0xA8, 0xA9, 0x83, 0x72, 0xCC, 0xA3, 0xB9, + 0x83, 0x73, 0xCC, 0x81, 0xCD, 0x83, 0x73, 0xCC, + 0x8C, 0xCD, 0x83, 0x73, 0xCC, 0xA3, 0xB9, 0x83, + 0x75, 0xCC, 0x83, 0xCD, 0x83, 0x75, 0xCC, 0x84, + 0xCD, 0x83, 0x75, 0xCC, 0x88, 0xCD, 0x83, 0x75, + 0xCC, 0x9B, 0xB1, 0x84, 0xCE, 0x91, 0xCC, 0x93, + 0xCD, 0x84, 0xCE, 0x91, 0xCC, 0x94, 0xCD, 0x84, + 0xCE, 0x95, 0xCC, 0x93, 0xCD, 0x84, 0xCE, 0x95, + // Bytes 4900 - 493f + 0xCC, 0x94, 0xCD, 0x84, 0xCE, 0x97, 0xCC, 0x93, + 0xCD, 0x84, 0xCE, 0x97, 0xCC, 0x94, 0xCD, 0x84, + 0xCE, 0x99, 0xCC, 0x93, 0xCD, 0x84, 0xCE, 0x99, + 0xCC, 0x94, 0xCD, 0x84, 0xCE, 0x9F, 0xCC, 0x93, + 0xCD, 0x84, 0xCE, 0x9F, 0xCC, 0x94, 0xCD, 0x84, + 0xCE, 0xA5, 0xCC, 0x94, 0xCD, 0x84, 0xCE, 0xA9, + 0xCC, 0x93, 0xCD, 0x84, 0xCE, 0xA9, 0xCC, 0x94, + 0xCD, 0x84, 0xCE, 0xB1, 0xCC, 0x80, 0xCD, 0x84, + // Bytes 4940 - 497f + 0xCE, 0xB1, 0xCC, 0x81, 0xCD, 0x84, 0xCE, 0xB1, + 0xCC, 0x93, 0xCD, 0x84, 0xCE, 0xB1, 0xCC, 0x94, + 0xCD, 0x84, 0xCE, 0xB1, 0xCD, 0x82, 0xCD, 0x84, + 0xCE, 0xB5, 0xCC, 0x93, 0xCD, 0x84, 0xCE, 0xB5, + 0xCC, 0x94, 0xCD, 0x84, 0xCE, 0xB7, 0xCC, 0x80, + 0xCD, 0x84, 0xCE, 0xB7, 0xCC, 0x81, 0xCD, 0x84, + 0xCE, 0xB7, 0xCC, 0x93, 0xCD, 0x84, 0xCE, 0xB7, + 0xCC, 0x94, 0xCD, 0x84, 0xCE, 0xB7, 0xCD, 0x82, + // Bytes 4980 - 49bf + 0xCD, 0x84, 0xCE, 0xB9, 0xCC, 0x88, 0xCD, 0x84, + 0xCE, 0xB9, 0xCC, 0x93, 0xCD, 0x84, 0xCE, 0xB9, + 0xCC, 0x94, 0xCD, 0x84, 0xCE, 0xBF, 0xCC, 0x93, + 0xCD, 0x84, 0xCE, 0xBF, 0xCC, 0x94, 0xCD, 0x84, + 0xCF, 0x85, 0xCC, 0x88, 0xCD, 0x84, 0xCF, 0x85, + 0xCC, 0x93, 0xCD, 0x84, 0xCF, 0x85, 0xCC, 0x94, + 0xCD, 0x84, 0xCF, 0x89, 0xCC, 0x80, 0xCD, 0x84, + 0xCF, 0x89, 0xCC, 0x81, 0xCD, 0x84, 0xCF, 0x89, + // Bytes 49c0 - 49ff + 0xCC, 0x93, 0xCD, 0x84, 0xCF, 0x89, 0xCC, 0x94, + 0xCD, 0x84, 0xCF, 0x89, 0xCD, 0x82, 0xCD, 0x86, + 0xCE, 0x91, 0xCC, 0x93, 0xCC, 0x80, 0xCE, 0x86, + 0xCE, 0x91, 0xCC, 0x93, 0xCC, 0x81, 0xCE, 0x86, + 0xCE, 0x91, 0xCC, 0x93, 0xCD, 0x82, 0xCE, 0x86, + 0xCE, 0x91, 0xCC, 0x94, 0xCC, 0x80, 0xCE, 0x86, + 0xCE, 0x91, 0xCC, 0x94, 0xCC, 0x81, 0xCE, 0x86, + 0xCE, 0x91, 0xCC, 0x94, 0xCD, 0x82, 0xCE, 0x86, + // Bytes 4a00 - 4a3f + 0xCE, 0x97, 0xCC, 0x93, 0xCC, 0x80, 0xCE, 0x86, + 0xCE, 0x97, 0xCC, 0x93, 0xCC, 0x81, 0xCE, 0x86, + 0xCE, 0x97, 0xCC, 0x93, 0xCD, 0x82, 0xCE, 0x86, + 0xCE, 0x97, 0xCC, 0x94, 0xCC, 0x80, 0xCE, 0x86, + 0xCE, 0x97, 0xCC, 0x94, 0xCC, 0x81, 0xCE, 0x86, + 0xCE, 0x97, 0xCC, 0x94, 0xCD, 0x82, 0xCE, 0x86, + 0xCE, 0xA9, 0xCC, 0x93, 0xCC, 0x80, 0xCE, 0x86, + 0xCE, 0xA9, 0xCC, 0x93, 0xCC, 0x81, 0xCE, 0x86, + // Bytes 4a40 - 4a7f + 0xCE, 0xA9, 0xCC, 0x93, 0xCD, 0x82, 0xCE, 0x86, + 0xCE, 0xA9, 0xCC, 0x94, 0xCC, 0x80, 0xCE, 0x86, + 0xCE, 0xA9, 0xCC, 0x94, 0xCC, 0x81, 0xCE, 0x86, + 0xCE, 0xA9, 0xCC, 0x94, 0xCD, 0x82, 0xCE, 0x86, + 0xCE, 0xB1, 0xCC, 0x93, 0xCC, 0x80, 0xCE, 0x86, + 0xCE, 0xB1, 0xCC, 0x93, 0xCC, 0x81, 0xCE, 0x86, + 0xCE, 0xB1, 0xCC, 0x93, 0xCD, 0x82, 0xCE, 0x86, + 0xCE, 0xB1, 0xCC, 0x94, 0xCC, 0x80, 0xCE, 0x86, + // Bytes 4a80 - 4abf + 0xCE, 0xB1, 0xCC, 0x94, 0xCC, 0x81, 0xCE, 0x86, + 0xCE, 0xB1, 0xCC, 0x94, 0xCD, 0x82, 0xCE, 0x86, + 0xCE, 0xB7, 0xCC, 0x93, 0xCC, 0x80, 0xCE, 0x86, + 0xCE, 0xB7, 0xCC, 0x93, 0xCC, 0x81, 0xCE, 0x86, + 0xCE, 0xB7, 0xCC, 0x93, 0xCD, 0x82, 0xCE, 0x86, + 0xCE, 0xB7, 0xCC, 0x94, 0xCC, 0x80, 0xCE, 0x86, + 0xCE, 0xB7, 0xCC, 0x94, 0xCC, 0x81, 0xCE, 0x86, + 0xCE, 0xB7, 0xCC, 0x94, 0xCD, 0x82, 0xCE, 0x86, + // Bytes 4ac0 - 4aff + 0xCF, 0x89, 0xCC, 0x93, 0xCC, 0x80, 0xCE, 0x86, + 0xCF, 0x89, 0xCC, 0x93, 0xCC, 0x81, 0xCE, 0x86, + 0xCF, 0x89, 0xCC, 0x93, 0xCD, 0x82, 0xCE, 0x86, + 0xCF, 0x89, 0xCC, 0x94, 0xCC, 0x80, 0xCE, 0x86, + 0xCF, 0x89, 0xCC, 0x94, 0xCC, 0x81, 0xCE, 0x86, + 0xCF, 0x89, 0xCC, 0x94, 0xCD, 0x82, 0xCE, 0x42, + 0xCC, 0x80, 0xCD, 0x33, 0x42, 0xCC, 0x81, 0xCD, + 0x33, 0x42, 0xCC, 0x93, 0xCD, 0x33, 0x43, 0xE1, + // Bytes 4b00 - 4b3f + 0x85, 0xA1, 0x01, 0x00, 0x43, 0xE1, 0x85, 0xA2, + 0x01, 0x00, 0x43, 0xE1, 0x85, 0xA3, 0x01, 0x00, + 0x43, 0xE1, 0x85, 0xA4, 0x01, 0x00, 0x43, 0xE1, + 0x85, 0xA5, 0x01, 0x00, 0x43, 0xE1, 0x85, 0xA6, + 0x01, 0x00, 0x43, 0xE1, 0x85, 0xA7, 0x01, 0x00, + 0x43, 0xE1, 0x85, 0xA8, 0x01, 0x00, 0x43, 0xE1, + 0x85, 0xA9, 0x01, 0x00, 0x43, 0xE1, 0x85, 0xAA, + 0x01, 0x00, 0x43, 0xE1, 0x85, 0xAB, 0x01, 0x00, + // Bytes 4b40 - 4b7f + 0x43, 0xE1, 0x85, 0xAC, 0x01, 0x00, 0x43, 0xE1, + 0x85, 0xAD, 0x01, 0x00, 0x43, 0xE1, 0x85, 0xAE, + 0x01, 0x00, 0x43, 0xE1, 0x85, 0xAF, 0x01, 0x00, + 0x43, 0xE1, 0x85, 0xB0, 0x01, 0x00, 0x43, 0xE1, + 0x85, 0xB1, 0x01, 0x00, 0x43, 0xE1, 0x85, 0xB2, + 0x01, 0x00, 0x43, 0xE1, 0x85, 0xB3, 0x01, 0x00, + 0x43, 0xE1, 0x85, 0xB4, 0x01, 0x00, 0x43, 0xE1, + 0x85, 0xB5, 0x01, 0x00, 0x43, 0xE1, 0x86, 0xAA, + // Bytes 4b80 - 4bbf + 0x01, 0x00, 0x43, 0xE1, 0x86, 0xAC, 0x01, 0x00, + 0x43, 0xE1, 0x86, 0xAD, 0x01, 0x00, 0x43, 0xE1, + 0x86, 0xB0, 0x01, 0x00, 0x43, 0xE1, 0x86, 0xB1, + 0x01, 0x00, 0x43, 0xE1, 0x86, 0xB2, 0x01, 0x00, + 0x43, 0xE1, 0x86, 0xB3, 0x01, 0x00, 0x43, 0xE1, + 0x86, 0xB4, 0x01, 0x00, 0x43, 0xE1, 0x86, 0xB5, + 0x01, 0x00, 0x44, 0xCC, 0x88, 0xCC, 0x81, 0xCE, + 0x33, 0x43, 0xE3, 0x82, 0x99, 0x11, 0x04, 0x43, + // Bytes 4bc0 - 4bff + 0xE3, 0x82, 0x9A, 0x11, 0x04, 0x46, 0xE0, 0xBD, + 0xB1, 0xE0, 0xBD, 0xB2, 0xA2, 0x27, 0x46, 0xE0, + 0xBD, 0xB1, 0xE0, 0xBD, 0xB4, 0xA6, 0x27, 0x46, + 0xE0, 0xBD, 0xB1, 0xE0, 0xBE, 0x80, 0xA2, 0x27, + 0x00, 0x01, +} + +// lookup returns the trie value for the first UTF-8 encoding in s and +// the width in bytes of this encoding. The size will be 0 if s does not +// hold enough bytes to complete the encoding. len(s) must be greater than 0. +func (t *nfcTrie) lookup(s []byte) (v uint16, sz int) { + c0 := s[0] + switch { + case c0 < 0x80: // is ASCII + return nfcValues[c0], 1 + case c0 < 0xC2: + return 0, 1 // Illegal UTF-8: not a starter, not ASCII. + case c0 < 0xE0: // 2-byte UTF-8 + if len(s) < 2 { + return 0, 0 + } + i := nfcIndex[c0] + c1 := s[1] + if c1 < 0x80 || 0xC0 <= c1 { + return 0, 1 // Illegal UTF-8: not a continuation byte. + } + return t.lookupValue(uint32(i), c1), 2 + case c0 < 0xF0: // 3-byte UTF-8 + if len(s) < 3 { + return 0, 0 + } + i := nfcIndex[c0] + c1 := s[1] + if c1 < 0x80 || 0xC0 <= c1 { + return 0, 1 // Illegal UTF-8: not a continuation byte. + } + o := uint32(i)<<6 + uint32(c1) + i = nfcIndex[o] + c2 := s[2] + if c2 < 0x80 || 0xC0 <= c2 { + return 0, 2 // Illegal UTF-8: not a continuation byte. + } + return t.lookupValue(uint32(i), c2), 3 + case c0 < 0xF8: // 4-byte UTF-8 + if len(s) < 4 { + return 0, 0 + } + i := nfcIndex[c0] + c1 := s[1] + if c1 < 0x80 || 0xC0 <= c1 { + return 0, 1 // Illegal UTF-8: not a continuation byte. + } + o := uint32(i)<<6 + uint32(c1) + i = nfcIndex[o] + c2 := s[2] + if c2 < 0x80 || 0xC0 <= c2 { + return 0, 2 // Illegal UTF-8: not a continuation byte. + } + o = uint32(i)<<6 + uint32(c2) + i = nfcIndex[o] + c3 := s[3] + if c3 < 0x80 || 0xC0 <= c3 { + return 0, 3 // Illegal UTF-8: not a continuation byte. + } + return t.lookupValue(uint32(i), c3), 4 + } + // Illegal rune + return 0, 1 +} + +// lookupUnsafe returns the trie value for the first UTF-8 encoding in s. +// s must start with a full and valid UTF-8 encoded rune. +func (t *nfcTrie) lookupUnsafe(s []byte) uint16 { + c0 := s[0] + if c0 < 0x80 { // is ASCII + return nfcValues[c0] + } + i := nfcIndex[c0] + if c0 < 0xE0 { // 2-byte UTF-8 + return t.lookupValue(uint32(i), s[1]) + } + i = nfcIndex[uint32(i)<<6+uint32(s[1])] + if c0 < 0xF0 { // 3-byte UTF-8 + return t.lookupValue(uint32(i), s[2]) + } + i = nfcIndex[uint32(i)<<6+uint32(s[2])] + if c0 < 0xF8 { // 4-byte UTF-8 + return t.lookupValue(uint32(i), s[3]) + } + return 0 +} + +// lookupString returns the trie value for the first UTF-8 encoding in s and +// the width in bytes of this encoding. The size will be 0 if s does not +// hold enough bytes to complete the encoding. len(s) must be greater than 0. +func (t *nfcTrie) lookupString(s string) (v uint16, sz int) { + c0 := s[0] + switch { + case c0 < 0x80: // is ASCII + return nfcValues[c0], 1 + case c0 < 0xC2: + return 0, 1 // Illegal UTF-8: not a starter, not ASCII. + case c0 < 0xE0: // 2-byte UTF-8 + if len(s) < 2 { + return 0, 0 + } + i := nfcIndex[c0] + c1 := s[1] + if c1 < 0x80 || 0xC0 <= c1 { + return 0, 1 // Illegal UTF-8: not a continuation byte. + } + return t.lookupValue(uint32(i), c1), 2 + case c0 < 0xF0: // 3-byte UTF-8 + if len(s) < 3 { + return 0, 0 + } + i := nfcIndex[c0] + c1 := s[1] + if c1 < 0x80 || 0xC0 <= c1 { + return 0, 1 // Illegal UTF-8: not a continuation byte. + } + o := uint32(i)<<6 + uint32(c1) + i = nfcIndex[o] + c2 := s[2] + if c2 < 0x80 || 0xC0 <= c2 { + return 0, 2 // Illegal UTF-8: not a continuation byte. + } + return t.lookupValue(uint32(i), c2), 3 + case c0 < 0xF8: // 4-byte UTF-8 + if len(s) < 4 { + return 0, 0 + } + i := nfcIndex[c0] + c1 := s[1] + if c1 < 0x80 || 0xC0 <= c1 { + return 0, 1 // Illegal UTF-8: not a continuation byte. + } + o := uint32(i)<<6 + uint32(c1) + i = nfcIndex[o] + c2 := s[2] + if c2 < 0x80 || 0xC0 <= c2 { + return 0, 2 // Illegal UTF-8: not a continuation byte. + } + o = uint32(i)<<6 + uint32(c2) + i = nfcIndex[o] + c3 := s[3] + if c3 < 0x80 || 0xC0 <= c3 { + return 0, 3 // Illegal UTF-8: not a continuation byte. + } + return t.lookupValue(uint32(i), c3), 4 + } + // Illegal rune + return 0, 1 +} + +// lookupStringUnsafe returns the trie value for the first UTF-8 encoding in s. +// s must start with a full and valid UTF-8 encoded rune. +func (t *nfcTrie) lookupStringUnsafe(s string) uint16 { + c0 := s[0] + if c0 < 0x80 { // is ASCII + return nfcValues[c0] + } + i := nfcIndex[c0] + if c0 < 0xE0 { // 2-byte UTF-8 + return t.lookupValue(uint32(i), s[1]) + } + i = nfcIndex[uint32(i)<<6+uint32(s[1])] + if c0 < 0xF0 { // 3-byte UTF-8 + return t.lookupValue(uint32(i), s[2]) + } + i = nfcIndex[uint32(i)<<6+uint32(s[2])] + if c0 < 0xF8 { // 4-byte UTF-8 + return t.lookupValue(uint32(i), s[3]) + } + return 0 +} + +// nfcTrie. Total size: 10798 bytes (10.54 KiB). Checksum: b5981cc85e3bd14. +type nfcTrie struct{} + +func newNfcTrie(i int) *nfcTrie { + return &nfcTrie{} +} + +// lookupValue determines the type of block n and looks up the value for b. +func (t *nfcTrie) lookupValue(n uint32, b byte) uint16 { + switch { + case n < 46: + return uint16(nfcValues[n<<6+uint32(b)]) + default: + n -= 46 + return uint16(nfcSparse.lookup(n, b)) + } +} + +// nfcValues: 48 blocks, 3072 entries, 6144 bytes +// The third block is the zero block. +var nfcValues = [3072]uint16{ + // Block 0x0, offset 0x0 + 0x3c: 0xa000, 0x3d: 0xa000, 0x3e: 0xa000, + // Block 0x1, offset 0x40 + 0x41: 0xa000, 0x42: 0xa000, 0x43: 0xa000, 0x44: 0xa000, 0x45: 0xa000, + 0x46: 0xa000, 0x47: 0xa000, 0x48: 0xa000, 0x49: 0xa000, 0x4a: 0xa000, 0x4b: 0xa000, + 0x4c: 0xa000, 0x4d: 0xa000, 0x4e: 0xa000, 0x4f: 0xa000, 0x50: 0xa000, + 0x52: 0xa000, 0x53: 0xa000, 0x54: 0xa000, 0x55: 0xa000, 0x56: 0xa000, 0x57: 0xa000, + 0x58: 0xa000, 0x59: 0xa000, 0x5a: 0xa000, + 0x61: 0xa000, 0x62: 0xa000, 0x63: 0xa000, + 0x64: 0xa000, 0x65: 0xa000, 0x66: 0xa000, 0x67: 0xa000, 0x68: 0xa000, 0x69: 0xa000, + 0x6a: 0xa000, 0x6b: 0xa000, 0x6c: 0xa000, 0x6d: 0xa000, 0x6e: 0xa000, 0x6f: 0xa000, + 0x70: 0xa000, 0x72: 0xa000, 0x73: 0xa000, 0x74: 0xa000, 0x75: 0xa000, + 0x76: 0xa000, 0x77: 0xa000, 0x78: 0xa000, 0x79: 0xa000, 0x7a: 0xa000, + // Block 0x2, offset 0x80 + // Block 0x3, offset 0xc0 + 0xc0: 0x30b0, 0xc1: 0x30b5, 0xc2: 0x47c9, 0xc3: 0x30ba, 0xc4: 0x47d8, 0xc5: 0x47dd, + 0xc6: 0xa000, 0xc7: 0x47e7, 0xc8: 0x3123, 0xc9: 0x3128, 0xca: 0x47ec, 0xcb: 0x313c, + 0xcc: 0x31af, 0xcd: 0x31b4, 0xce: 0x31b9, 0xcf: 0x4800, 0xd1: 0x3245, + 0xd2: 0x3268, 0xd3: 0x326d, 0xd4: 0x480a, 0xd5: 0x480f, 0xd6: 0x481e, + 0xd8: 0xa000, 0xd9: 0x32f4, 0xda: 0x32f9, 0xdb: 0x32fe, 0xdc: 0x4850, 0xdd: 0x3376, + 0xe0: 0x33bc, 0xe1: 0x33c1, 0xe2: 0x485a, 0xe3: 0x33c6, + 0xe4: 0x4869, 0xe5: 0x486e, 0xe6: 0xa000, 0xe7: 0x4878, 0xe8: 0x342f, 0xe9: 0x3434, + 0xea: 0x487d, 0xeb: 0x3448, 0xec: 0x34c0, 0xed: 0x34c5, 0xee: 0x34ca, 0xef: 0x4891, + 0xf1: 0x3556, 0xf2: 0x3579, 0xf3: 0x357e, 0xf4: 0x489b, 0xf5: 0x48a0, + 0xf6: 0x48af, 0xf8: 0xa000, 0xf9: 0x360a, 0xfa: 0x360f, 0xfb: 0x3614, + 0xfc: 0x48e1, 0xfd: 0x3691, 0xff: 0x36aa, + // Block 0x4, offset 0x100 + 0x100: 0x30bf, 0x101: 0x33cb, 0x102: 0x47ce, 0x103: 0x485f, 0x104: 0x30dd, 0x105: 0x33e9, + 0x106: 0x30f1, 0x107: 0x33fd, 0x108: 0x30f6, 0x109: 0x3402, 0x10a: 0x30fb, 0x10b: 0x3407, + 0x10c: 0x3100, 0x10d: 0x340c, 0x10e: 0x310a, 0x10f: 0x3416, + 0x112: 0x47f1, 0x113: 0x4882, 0x114: 0x3132, 0x115: 0x343e, 0x116: 0x3137, 0x117: 0x3443, + 0x118: 0x3155, 0x119: 0x3461, 0x11a: 0x3146, 0x11b: 0x3452, 0x11c: 0x316e, 0x11d: 0x347a, + 0x11e: 0x3178, 0x11f: 0x3484, 0x120: 0x317d, 0x121: 0x3489, 0x122: 0x3187, 0x123: 0x3493, + 0x124: 0x318c, 0x125: 0x3498, 0x128: 0x31be, 0x129: 0x34cf, + 0x12a: 0x31c3, 0x12b: 0x34d4, 0x12c: 0x31c8, 0x12d: 0x34d9, 0x12e: 0x31eb, 0x12f: 0x34f7, + 0x130: 0x31cd, 0x134: 0x31f5, 0x135: 0x3501, + 0x136: 0x3209, 0x137: 0x351a, 0x139: 0x3213, 0x13a: 0x3524, 0x13b: 0x321d, + 0x13c: 0x352e, 0x13d: 0x3218, 0x13e: 0x3529, + // Block 0x5, offset 0x140 + 0x143: 0x3240, 0x144: 0x3551, 0x145: 0x3259, + 0x146: 0x356a, 0x147: 0x324f, 0x148: 0x3560, + 0x14c: 0x4814, 0x14d: 0x48a5, 0x14e: 0x3272, 0x14f: 0x3583, 0x150: 0x327c, 0x151: 0x358d, + 0x154: 0x329a, 0x155: 0x35ab, 0x156: 0x32b3, 0x157: 0x35c4, + 0x158: 0x32a4, 0x159: 0x35b5, 0x15a: 0x4837, 0x15b: 0x48c8, 0x15c: 0x32bd, 0x15d: 0x35ce, + 0x15e: 0x32cc, 0x15f: 0x35dd, 0x160: 0x483c, 0x161: 0x48cd, 0x162: 0x32e5, 0x163: 0x35fb, + 0x164: 0x32d6, 0x165: 0x35ec, 0x168: 0x4846, 0x169: 0x48d7, + 0x16a: 0x484b, 0x16b: 0x48dc, 0x16c: 0x3303, 0x16d: 0x3619, 0x16e: 0x330d, 0x16f: 0x3623, + 0x170: 0x3312, 0x171: 0x3628, 0x172: 0x3330, 0x173: 0x3646, 0x174: 0x3353, 0x175: 0x3669, + 0x176: 0x337b, 0x177: 0x3696, 0x178: 0x338f, 0x179: 0x339e, 0x17a: 0x36be, 0x17b: 0x33a8, + 0x17c: 0x36c8, 0x17d: 0x33ad, 0x17e: 0x36cd, 0x17f: 0xa000, + // Block 0x6, offset 0x180 + 0x184: 0x8100, 0x185: 0x8100, + 0x186: 0x8100, + 0x18d: 0x30c9, 0x18e: 0x33d5, 0x18f: 0x31d7, 0x190: 0x34e3, 0x191: 0x3281, + 0x192: 0x3592, 0x193: 0x3317, 0x194: 0x362d, 0x195: 0x3b10, 0x196: 0x3c9f, 0x197: 0x3b09, + 0x198: 0x3c98, 0x199: 0x3b17, 0x19a: 0x3ca6, 0x19b: 0x3b02, 0x19c: 0x3c91, + 0x19e: 0x39f1, 0x19f: 0x3b80, 0x1a0: 0x39ea, 0x1a1: 0x3b79, 0x1a2: 0x36f4, 0x1a3: 0x3706, + 0x1a6: 0x3182, 0x1a7: 0x348e, 0x1a8: 0x31ff, 0x1a9: 0x3510, + 0x1aa: 0x482d, 0x1ab: 0x48be, 0x1ac: 0x3ad1, 0x1ad: 0x3c60, 0x1ae: 0x3718, 0x1af: 0x371e, + 0x1b0: 0x3506, 0x1b4: 0x3169, 0x1b5: 0x3475, + 0x1b8: 0x323b, 0x1b9: 0x354c, 0x1ba: 0x39f8, 0x1bb: 0x3b87, + 0x1bc: 0x36ee, 0x1bd: 0x3700, 0x1be: 0x36fa, 0x1bf: 0x370c, + // Block 0x7, offset 0x1c0 + 0x1c0: 0x30ce, 0x1c1: 0x33da, 0x1c2: 0x30d3, 0x1c3: 0x33df, 0x1c4: 0x314b, 0x1c5: 0x3457, + 0x1c6: 0x3150, 0x1c7: 0x345c, 0x1c8: 0x31dc, 0x1c9: 0x34e8, 0x1ca: 0x31e1, 0x1cb: 0x34ed, + 0x1cc: 0x3286, 0x1cd: 0x3597, 0x1ce: 0x328b, 0x1cf: 0x359c, 0x1d0: 0x32a9, 0x1d1: 0x35ba, + 0x1d2: 0x32ae, 0x1d3: 0x35bf, 0x1d4: 0x331c, 0x1d5: 0x3632, 0x1d6: 0x3321, 0x1d7: 0x3637, + 0x1d8: 0x32c7, 0x1d9: 0x35d8, 0x1da: 0x32e0, 0x1db: 0x35f6, + 0x1de: 0x319b, 0x1df: 0x34a7, + 0x1e6: 0x47d3, 0x1e7: 0x4864, 0x1e8: 0x47fb, 0x1e9: 0x488c, + 0x1ea: 0x3aa0, 0x1eb: 0x3c2f, 0x1ec: 0x3a7d, 0x1ed: 0x3c0c, 0x1ee: 0x4819, 0x1ef: 0x48aa, + 0x1f0: 0x3a99, 0x1f1: 0x3c28, 0x1f2: 0x3385, 0x1f3: 0x36a0, + // Block 0x8, offset 0x200 + 0x200: 0x9933, 0x201: 0x9933, 0x202: 0x9933, 0x203: 0x9933, 0x204: 0x9933, 0x205: 0x8133, + 0x206: 0x9933, 0x207: 0x9933, 0x208: 0x9933, 0x209: 0x9933, 0x20a: 0x9933, 0x20b: 0x9933, + 0x20c: 0x9933, 0x20d: 0x8133, 0x20e: 0x8133, 0x20f: 0x9933, 0x210: 0x8133, 0x211: 0x9933, + 0x212: 0x8133, 0x213: 0x9933, 0x214: 0x9933, 0x215: 0x8134, 0x216: 0x812e, 0x217: 0x812e, + 0x218: 0x812e, 0x219: 0x812e, 0x21a: 0x8134, 0x21b: 0x992c, 0x21c: 0x812e, 0x21d: 0x812e, + 0x21e: 0x812e, 0x21f: 0x812e, 0x220: 0x812e, 0x221: 0x812a, 0x222: 0x812a, 0x223: 0x992e, + 0x224: 0x992e, 0x225: 0x992e, 0x226: 0x992e, 0x227: 0x992a, 0x228: 0x992a, 0x229: 0x812e, + 0x22a: 0x812e, 0x22b: 0x812e, 0x22c: 0x812e, 0x22d: 0x992e, 0x22e: 0x992e, 0x22f: 0x812e, + 0x230: 0x992e, 0x231: 0x992e, 0x232: 0x812e, 0x233: 0x812e, 0x234: 0x8101, 0x235: 0x8101, + 0x236: 0x8101, 0x237: 0x8101, 0x238: 0x9901, 0x239: 0x812e, 0x23a: 0x812e, 0x23b: 0x812e, + 0x23c: 0x812e, 0x23d: 0x8133, 0x23e: 0x8133, 0x23f: 0x8133, + // Block 0x9, offset 0x240 + 0x240: 0x4aef, 0x241: 0x4af4, 0x242: 0x9933, 0x243: 0x4af9, 0x244: 0x4bb2, 0x245: 0x9937, + 0x246: 0x8133, 0x247: 0x812e, 0x248: 0x812e, 0x249: 0x812e, 0x24a: 0x8133, 0x24b: 0x8133, + 0x24c: 0x8133, 0x24d: 0x812e, 0x24e: 0x812e, 0x250: 0x8133, 0x251: 0x8133, + 0x252: 0x8133, 0x253: 0x812e, 0x254: 0x812e, 0x255: 0x812e, 0x256: 0x812e, 0x257: 0x8133, + 0x258: 0x8134, 0x259: 0x812e, 0x25a: 0x812e, 0x25b: 0x8133, 0x25c: 0x8135, 0x25d: 0x8136, + 0x25e: 0x8136, 0x25f: 0x8135, 0x260: 0x8136, 0x261: 0x8136, 0x262: 0x8135, 0x263: 0x8133, + 0x264: 0x8133, 0x265: 0x8133, 0x266: 0x8133, 0x267: 0x8133, 0x268: 0x8133, 0x269: 0x8133, + 0x26a: 0x8133, 0x26b: 0x8133, 0x26c: 0x8133, 0x26d: 0x8133, 0x26e: 0x8133, 0x26f: 0x8133, + 0x274: 0x01ee, + 0x27a: 0x8100, + 0x27e: 0x0037, + // Block 0xa, offset 0x280 + 0x284: 0x8100, 0x285: 0x36e2, + 0x286: 0x372a, 0x287: 0x00ce, 0x288: 0x3748, 0x289: 0x3754, 0x28a: 0x3766, + 0x28c: 0x3784, 0x28e: 0x3796, 0x28f: 0x37b4, 0x290: 0x3f49, 0x291: 0xa000, + 0x295: 0xa000, 0x297: 0xa000, + 0x299: 0xa000, + 0x29f: 0xa000, 0x2a1: 0xa000, + 0x2a5: 0xa000, 0x2a9: 0xa000, + 0x2aa: 0x3778, 0x2ab: 0x37a8, 0x2ac: 0x493f, 0x2ad: 0x37d8, 0x2ae: 0x4969, 0x2af: 0x37ea, + 0x2b0: 0x3fb1, 0x2b1: 0xa000, 0x2b5: 0xa000, + 0x2b7: 0xa000, 0x2b9: 0xa000, + 0x2bf: 0xa000, + // Block 0xb, offset 0x2c0 + 0x2c0: 0x3862, 0x2c1: 0x386e, 0x2c3: 0x385c, + 0x2c6: 0xa000, 0x2c7: 0x384a, + 0x2cc: 0x389e, 0x2cd: 0x3886, 0x2ce: 0x38b0, 0x2d0: 0xa000, + 0x2d3: 0xa000, 0x2d5: 0xa000, 0x2d6: 0xa000, 0x2d7: 0xa000, + 0x2d8: 0xa000, 0x2d9: 0x3892, 0x2da: 0xa000, + 0x2de: 0xa000, 0x2e3: 0xa000, + 0x2e7: 0xa000, + 0x2eb: 0xa000, 0x2ed: 0xa000, + 0x2f0: 0xa000, 0x2f3: 0xa000, 0x2f5: 0xa000, + 0x2f6: 0xa000, 0x2f7: 0xa000, 0x2f8: 0xa000, 0x2f9: 0x3916, 0x2fa: 0xa000, + 0x2fe: 0xa000, + // Block 0xc, offset 0x300 + 0x301: 0x3874, 0x302: 0x38f8, + 0x310: 0x3850, 0x311: 0x38d4, + 0x312: 0x3856, 0x313: 0x38da, 0x316: 0x3868, 0x317: 0x38ec, + 0x318: 0xa000, 0x319: 0xa000, 0x31a: 0x396a, 0x31b: 0x3970, 0x31c: 0x387a, 0x31d: 0x38fe, + 0x31e: 0x3880, 0x31f: 0x3904, 0x322: 0x388c, 0x323: 0x3910, + 0x324: 0x3898, 0x325: 0x391c, 0x326: 0x38a4, 0x327: 0x3928, 0x328: 0xa000, 0x329: 0xa000, + 0x32a: 0x3976, 0x32b: 0x397c, 0x32c: 0x38ce, 0x32d: 0x3952, 0x32e: 0x38aa, 0x32f: 0x392e, + 0x330: 0x38b6, 0x331: 0x393a, 0x332: 0x38bc, 0x333: 0x3940, 0x334: 0x38c2, 0x335: 0x3946, + 0x338: 0x38c8, 0x339: 0x394c, + // Block 0xd, offset 0x340 + 0x351: 0x812e, + 0x352: 0x8133, 0x353: 0x8133, 0x354: 0x8133, 0x355: 0x8133, 0x356: 0x812e, 0x357: 0x8133, + 0x358: 0x8133, 0x359: 0x8133, 0x35a: 0x812f, 0x35b: 0x812e, 0x35c: 0x8133, 0x35d: 0x8133, + 0x35e: 0x8133, 0x35f: 0x8133, 0x360: 0x8133, 0x361: 0x8133, 0x362: 0x812e, 0x363: 0x812e, + 0x364: 0x812e, 0x365: 0x812e, 0x366: 0x812e, 0x367: 0x812e, 0x368: 0x8133, 0x369: 0x8133, + 0x36a: 0x812e, 0x36b: 0x8133, 0x36c: 0x8133, 0x36d: 0x812f, 0x36e: 0x8132, 0x36f: 0x8133, + 0x370: 0x8106, 0x371: 0x8107, 0x372: 0x8108, 0x373: 0x8109, 0x374: 0x810a, 0x375: 0x810b, + 0x376: 0x810c, 0x377: 0x810d, 0x378: 0x810e, 0x379: 0x810f, 0x37a: 0x810f, 0x37b: 0x8110, + 0x37c: 0x8111, 0x37d: 0x8112, 0x37f: 0x8113, + // Block 0xe, offset 0x380 + 0x388: 0xa000, 0x38a: 0xa000, 0x38b: 0x8117, + 0x38c: 0x8118, 0x38d: 0x8119, 0x38e: 0x811a, 0x38f: 0x811b, 0x390: 0x811c, 0x391: 0x811d, + 0x392: 0x811e, 0x393: 0x9933, 0x394: 0x9933, 0x395: 0x992e, 0x396: 0x812e, 0x397: 0x8133, + 0x398: 0x8133, 0x399: 0x8133, 0x39a: 0x8133, 0x39b: 0x8133, 0x39c: 0x812e, 0x39d: 0x8133, + 0x39e: 0x8133, 0x39f: 0x812e, + 0x3b0: 0x811f, + // Block 0xf, offset 0x3c0 + 0x3ca: 0x8133, 0x3cb: 0x8133, + 0x3cc: 0x8133, 0x3cd: 0x8133, 0x3ce: 0x8133, 0x3cf: 0x812e, 0x3d0: 0x812e, 0x3d1: 0x812e, + 0x3d2: 0x812e, 0x3d3: 0x812e, 0x3d4: 0x8133, 0x3d5: 0x8133, 0x3d6: 0x8133, 0x3d7: 0x8133, + 0x3d8: 0x8133, 0x3d9: 0x8133, 0x3da: 0x8133, 0x3db: 0x8133, 0x3dc: 0x8133, 0x3dd: 0x8133, + 0x3de: 0x8133, 0x3df: 0x8133, 0x3e0: 0x8133, 0x3e1: 0x8133, 0x3e3: 0x812e, + 0x3e4: 0x8133, 0x3e5: 0x8133, 0x3e6: 0x812e, 0x3e7: 0x8133, 0x3e8: 0x8133, 0x3e9: 0x812e, + 0x3ea: 0x8133, 0x3eb: 0x8133, 0x3ec: 0x8133, 0x3ed: 0x812e, 0x3ee: 0x812e, 0x3ef: 0x812e, + 0x3f0: 0x8117, 0x3f1: 0x8118, 0x3f2: 0x8119, 0x3f3: 0x8133, 0x3f4: 0x8133, 0x3f5: 0x8133, + 0x3f6: 0x812e, 0x3f7: 0x8133, 0x3f8: 0x8133, 0x3f9: 0x812e, 0x3fa: 0x812e, 0x3fb: 0x8133, + 0x3fc: 0x8133, 0x3fd: 0x8133, 0x3fe: 0x8133, 0x3ff: 0x8133, + // Block 0x10, offset 0x400 + 0x405: 0xa000, + 0x406: 0x2e5d, 0x407: 0xa000, 0x408: 0x2e65, 0x409: 0xa000, 0x40a: 0x2e6d, 0x40b: 0xa000, + 0x40c: 0x2e75, 0x40d: 0xa000, 0x40e: 0x2e7d, 0x411: 0xa000, + 0x412: 0x2e85, + 0x434: 0x8103, 0x435: 0x9900, + 0x43a: 0xa000, 0x43b: 0x2e8d, + 0x43c: 0xa000, 0x43d: 0x2e95, 0x43e: 0xa000, 0x43f: 0xa000, + // Block 0x11, offset 0x440 + 0x440: 0x8133, 0x441: 0x8133, 0x442: 0x812e, 0x443: 0x8133, 0x444: 0x8133, 0x445: 0x8133, + 0x446: 0x8133, 0x447: 0x8133, 0x448: 0x8133, 0x449: 0x8133, 0x44a: 0x812e, 0x44b: 0x8133, + 0x44c: 0x8133, 0x44d: 0x8136, 0x44e: 0x812b, 0x44f: 0x812e, 0x450: 0x812a, 0x451: 0x8133, + 0x452: 0x8133, 0x453: 0x8133, 0x454: 0x8133, 0x455: 0x8133, 0x456: 0x8133, 0x457: 0x8133, + 0x458: 0x8133, 0x459: 0x8133, 0x45a: 0x8133, 0x45b: 0x8133, 0x45c: 0x8133, 0x45d: 0x8133, + 0x45e: 0x8133, 0x45f: 0x8133, 0x460: 0x8133, 0x461: 0x8133, 0x462: 0x8133, 0x463: 0x8133, + 0x464: 0x8133, 0x465: 0x8133, 0x466: 0x8133, 0x467: 0x8133, 0x468: 0x8133, 0x469: 0x8133, + 0x46a: 0x8133, 0x46b: 0x8133, 0x46c: 0x8133, 0x46d: 0x8133, 0x46e: 0x8133, 0x46f: 0x8133, + 0x470: 0x8133, 0x471: 0x8133, 0x472: 0x8133, 0x473: 0x8133, 0x474: 0x8133, 0x475: 0x8133, + 0x476: 0x8134, 0x477: 0x8132, 0x478: 0x8132, 0x479: 0x812e, 0x47a: 0x812d, 0x47b: 0x8133, + 0x47c: 0x8135, 0x47d: 0x812e, 0x47e: 0x8133, 0x47f: 0x812e, + // Block 0x12, offset 0x480 + 0x480: 0x30d8, 0x481: 0x33e4, 0x482: 0x30e2, 0x483: 0x33ee, 0x484: 0x30e7, 0x485: 0x33f3, + 0x486: 0x30ec, 0x487: 0x33f8, 0x488: 0x3a0d, 0x489: 0x3b9c, 0x48a: 0x3105, 0x48b: 0x3411, + 0x48c: 0x310f, 0x48d: 0x341b, 0x48e: 0x311e, 0x48f: 0x342a, 0x490: 0x3114, 0x491: 0x3420, + 0x492: 0x3119, 0x493: 0x3425, 0x494: 0x3a30, 0x495: 0x3bbf, 0x496: 0x3a37, 0x497: 0x3bc6, + 0x498: 0x315a, 0x499: 0x3466, 0x49a: 0x315f, 0x49b: 0x346b, 0x49c: 0x3a45, 0x49d: 0x3bd4, + 0x49e: 0x3164, 0x49f: 0x3470, 0x4a0: 0x3173, 0x4a1: 0x347f, 0x4a2: 0x3191, 0x4a3: 0x349d, + 0x4a4: 0x31a0, 0x4a5: 0x34ac, 0x4a6: 0x3196, 0x4a7: 0x34a2, 0x4a8: 0x31a5, 0x4a9: 0x34b1, + 0x4aa: 0x31aa, 0x4ab: 0x34b6, 0x4ac: 0x31f0, 0x4ad: 0x34fc, 0x4ae: 0x3a4c, 0x4af: 0x3bdb, + 0x4b0: 0x31fa, 0x4b1: 0x350b, 0x4b2: 0x3204, 0x4b3: 0x3515, 0x4b4: 0x320e, 0x4b5: 0x351f, + 0x4b6: 0x4805, 0x4b7: 0x4896, 0x4b8: 0x3a53, 0x4b9: 0x3be2, 0x4ba: 0x3227, 0x4bb: 0x3538, + 0x4bc: 0x3222, 0x4bd: 0x3533, 0x4be: 0x322c, 0x4bf: 0x353d, + // Block 0x13, offset 0x4c0 + 0x4c0: 0x3231, 0x4c1: 0x3542, 0x4c2: 0x3236, 0x4c3: 0x3547, 0x4c4: 0x324a, 0x4c5: 0x355b, + 0x4c6: 0x3254, 0x4c7: 0x3565, 0x4c8: 0x3263, 0x4c9: 0x3574, 0x4ca: 0x325e, 0x4cb: 0x356f, + 0x4cc: 0x3a76, 0x4cd: 0x3c05, 0x4ce: 0x3a84, 0x4cf: 0x3c13, 0x4d0: 0x3a8b, 0x4d1: 0x3c1a, + 0x4d2: 0x3a92, 0x4d3: 0x3c21, 0x4d4: 0x3290, 0x4d5: 0x35a1, 0x4d6: 0x3295, 0x4d7: 0x35a6, + 0x4d8: 0x329f, 0x4d9: 0x35b0, 0x4da: 0x4832, 0x4db: 0x48c3, 0x4dc: 0x3ad8, 0x4dd: 0x3c67, + 0x4de: 0x32b8, 0x4df: 0x35c9, 0x4e0: 0x32c2, 0x4e1: 0x35d3, 0x4e2: 0x4841, 0x4e3: 0x48d2, + 0x4e4: 0x3adf, 0x4e5: 0x3c6e, 0x4e6: 0x3ae6, 0x4e7: 0x3c75, 0x4e8: 0x3aed, 0x4e9: 0x3c7c, + 0x4ea: 0x32d1, 0x4eb: 0x35e2, 0x4ec: 0x32db, 0x4ed: 0x35f1, 0x4ee: 0x32ef, 0x4ef: 0x3605, + 0x4f0: 0x32ea, 0x4f1: 0x3600, 0x4f2: 0x332b, 0x4f3: 0x3641, 0x4f4: 0x333a, 0x4f5: 0x3650, + 0x4f6: 0x3335, 0x4f7: 0x364b, 0x4f8: 0x3af4, 0x4f9: 0x3c83, 0x4fa: 0x3afb, 0x4fb: 0x3c8a, + 0x4fc: 0x333f, 0x4fd: 0x3655, 0x4fe: 0x3344, 0x4ff: 0x365a, + // Block 0x14, offset 0x500 + 0x500: 0x3349, 0x501: 0x365f, 0x502: 0x334e, 0x503: 0x3664, 0x504: 0x335d, 0x505: 0x3673, + 0x506: 0x3358, 0x507: 0x366e, 0x508: 0x3362, 0x509: 0x367d, 0x50a: 0x3367, 0x50b: 0x3682, + 0x50c: 0x336c, 0x50d: 0x3687, 0x50e: 0x338a, 0x50f: 0x36a5, 0x510: 0x33a3, 0x511: 0x36c3, + 0x512: 0x33b2, 0x513: 0x36d2, 0x514: 0x33b7, 0x515: 0x36d7, 0x516: 0x34bb, 0x517: 0x35e7, + 0x518: 0x3678, 0x519: 0x36b4, 0x51b: 0x3712, + 0x520: 0x47e2, 0x521: 0x4873, 0x522: 0x30c4, 0x523: 0x33d0, + 0x524: 0x39b9, 0x525: 0x3b48, 0x526: 0x39b2, 0x527: 0x3b41, 0x528: 0x39c7, 0x529: 0x3b56, + 0x52a: 0x39c0, 0x52b: 0x3b4f, 0x52c: 0x39ff, 0x52d: 0x3b8e, 0x52e: 0x39d5, 0x52f: 0x3b64, + 0x530: 0x39ce, 0x531: 0x3b5d, 0x532: 0x39e3, 0x533: 0x3b72, 0x534: 0x39dc, 0x535: 0x3b6b, + 0x536: 0x3a06, 0x537: 0x3b95, 0x538: 0x47f6, 0x539: 0x4887, 0x53a: 0x3141, 0x53b: 0x344d, + 0x53c: 0x312d, 0x53d: 0x3439, 0x53e: 0x3a1b, 0x53f: 0x3baa, + // Block 0x15, offset 0x540 + 0x540: 0x3a14, 0x541: 0x3ba3, 0x542: 0x3a29, 0x543: 0x3bb8, 0x544: 0x3a22, 0x545: 0x3bb1, + 0x546: 0x3a3e, 0x547: 0x3bcd, 0x548: 0x31d2, 0x549: 0x34de, 0x54a: 0x31e6, 0x54b: 0x34f2, + 0x54c: 0x4828, 0x54d: 0x48b9, 0x54e: 0x3277, 0x54f: 0x3588, 0x550: 0x3a61, 0x551: 0x3bf0, + 0x552: 0x3a5a, 0x553: 0x3be9, 0x554: 0x3a6f, 0x555: 0x3bfe, 0x556: 0x3a68, 0x557: 0x3bf7, + 0x558: 0x3aca, 0x559: 0x3c59, 0x55a: 0x3aae, 0x55b: 0x3c3d, 0x55c: 0x3aa7, 0x55d: 0x3c36, + 0x55e: 0x3abc, 0x55f: 0x3c4b, 0x560: 0x3ab5, 0x561: 0x3c44, 0x562: 0x3ac3, 0x563: 0x3c52, + 0x564: 0x3326, 0x565: 0x363c, 0x566: 0x3308, 0x567: 0x361e, 0x568: 0x3b25, 0x569: 0x3cb4, + 0x56a: 0x3b1e, 0x56b: 0x3cad, 0x56c: 0x3b33, 0x56d: 0x3cc2, 0x56e: 0x3b2c, 0x56f: 0x3cbb, + 0x570: 0x3b3a, 0x571: 0x3cc9, 0x572: 0x3371, 0x573: 0x368c, 0x574: 0x3399, 0x575: 0x36b9, + 0x576: 0x3394, 0x577: 0x36af, 0x578: 0x3380, 0x579: 0x369b, + // Block 0x16, offset 0x580 + 0x580: 0x4945, 0x581: 0x494b, 0x582: 0x4a5f, 0x583: 0x4a77, 0x584: 0x4a67, 0x585: 0x4a7f, + 0x586: 0x4a6f, 0x587: 0x4a87, 0x588: 0x48eb, 0x589: 0x48f1, 0x58a: 0x49cf, 0x58b: 0x49e7, + 0x58c: 0x49d7, 0x58d: 0x49ef, 0x58e: 0x49df, 0x58f: 0x49f7, 0x590: 0x4957, 0x591: 0x495d, + 0x592: 0x3ef9, 0x593: 0x3f09, 0x594: 0x3f01, 0x595: 0x3f11, + 0x598: 0x48f7, 0x599: 0x48fd, 0x59a: 0x3e29, 0x59b: 0x3e39, 0x59c: 0x3e31, 0x59d: 0x3e41, + 0x5a0: 0x496f, 0x5a1: 0x4975, 0x5a2: 0x4a8f, 0x5a3: 0x4aa7, + 0x5a4: 0x4a97, 0x5a5: 0x4aaf, 0x5a6: 0x4a9f, 0x5a7: 0x4ab7, 0x5a8: 0x4903, 0x5a9: 0x4909, + 0x5aa: 0x49ff, 0x5ab: 0x4a17, 0x5ac: 0x4a07, 0x5ad: 0x4a1f, 0x5ae: 0x4a0f, 0x5af: 0x4a27, + 0x5b0: 0x4987, 0x5b1: 0x498d, 0x5b2: 0x3f59, 0x5b3: 0x3f71, 0x5b4: 0x3f61, 0x5b5: 0x3f79, + 0x5b6: 0x3f69, 0x5b7: 0x3f81, 0x5b8: 0x490f, 0x5b9: 0x4915, 0x5ba: 0x3e59, 0x5bb: 0x3e71, + 0x5bc: 0x3e61, 0x5bd: 0x3e79, 0x5be: 0x3e69, 0x5bf: 0x3e81, + // Block 0x17, offset 0x5c0 + 0x5c0: 0x4993, 0x5c1: 0x4999, 0x5c2: 0x3f89, 0x5c3: 0x3f99, 0x5c4: 0x3f91, 0x5c5: 0x3fa1, + 0x5c8: 0x491b, 0x5c9: 0x4921, 0x5ca: 0x3e89, 0x5cb: 0x3e99, + 0x5cc: 0x3e91, 0x5cd: 0x3ea1, 0x5d0: 0x49a5, 0x5d1: 0x49ab, + 0x5d2: 0x3fc1, 0x5d3: 0x3fd9, 0x5d4: 0x3fc9, 0x5d5: 0x3fe1, 0x5d6: 0x3fd1, 0x5d7: 0x3fe9, + 0x5d9: 0x4927, 0x5db: 0x3ea9, 0x5dd: 0x3eb1, + 0x5df: 0x3eb9, 0x5e0: 0x49bd, 0x5e1: 0x49c3, 0x5e2: 0x4abf, 0x5e3: 0x4ad7, + 0x5e4: 0x4ac7, 0x5e5: 0x4adf, 0x5e6: 0x4acf, 0x5e7: 0x4ae7, 0x5e8: 0x492d, 0x5e9: 0x4933, + 0x5ea: 0x4a2f, 0x5eb: 0x4a47, 0x5ec: 0x4a37, 0x5ed: 0x4a4f, 0x5ee: 0x4a3f, 0x5ef: 0x4a57, + 0x5f0: 0x4939, 0x5f1: 0x445f, 0x5f2: 0x37d2, 0x5f3: 0x4465, 0x5f4: 0x4963, 0x5f5: 0x446b, + 0x5f6: 0x37e4, 0x5f7: 0x4471, 0x5f8: 0x3802, 0x5f9: 0x4477, 0x5fa: 0x381a, 0x5fb: 0x447d, + 0x5fc: 0x49b1, 0x5fd: 0x4483, + // Block 0x18, offset 0x600 + 0x600: 0x3ee1, 0x601: 0x3ee9, 0x602: 0x42c5, 0x603: 0x42e3, 0x604: 0x42cf, 0x605: 0x42ed, + 0x606: 0x42d9, 0x607: 0x42f7, 0x608: 0x3e19, 0x609: 0x3e21, 0x60a: 0x4211, 0x60b: 0x422f, + 0x60c: 0x421b, 0x60d: 0x4239, 0x60e: 0x4225, 0x60f: 0x4243, 0x610: 0x3f29, 0x611: 0x3f31, + 0x612: 0x4301, 0x613: 0x431f, 0x614: 0x430b, 0x615: 0x4329, 0x616: 0x4315, 0x617: 0x4333, + 0x618: 0x3e49, 0x619: 0x3e51, 0x61a: 0x424d, 0x61b: 0x426b, 0x61c: 0x4257, 0x61d: 0x4275, + 0x61e: 0x4261, 0x61f: 0x427f, 0x620: 0x4001, 0x621: 0x4009, 0x622: 0x433d, 0x623: 0x435b, + 0x624: 0x4347, 0x625: 0x4365, 0x626: 0x4351, 0x627: 0x436f, 0x628: 0x3ec1, 0x629: 0x3ec9, + 0x62a: 0x4289, 0x62b: 0x42a7, 0x62c: 0x4293, 0x62d: 0x42b1, 0x62e: 0x429d, 0x62f: 0x42bb, + 0x630: 0x37c6, 0x631: 0x37c0, 0x632: 0x3ed1, 0x633: 0x37cc, 0x634: 0x3ed9, + 0x636: 0x4951, 0x637: 0x3ef1, 0x638: 0x3736, 0x639: 0x3730, 0x63a: 0x3724, 0x63b: 0x442f, + 0x63c: 0x373c, 0x63d: 0x8100, 0x63e: 0x0257, 0x63f: 0xa100, + // Block 0x19, offset 0x640 + 0x640: 0x8100, 0x641: 0x36e8, 0x642: 0x3f19, 0x643: 0x37de, 0x644: 0x3f21, + 0x646: 0x497b, 0x647: 0x3f39, 0x648: 0x3742, 0x649: 0x4435, 0x64a: 0x374e, 0x64b: 0x443b, + 0x64c: 0x375a, 0x64d: 0x3cd0, 0x64e: 0x3cd7, 0x64f: 0x3cde, 0x650: 0x37f6, 0x651: 0x37f0, + 0x652: 0x3f41, 0x653: 0x4625, 0x656: 0x37fc, 0x657: 0x3f51, + 0x658: 0x3772, 0x659: 0x376c, 0x65a: 0x3760, 0x65b: 0x4441, 0x65d: 0x3ce5, + 0x65e: 0x3cec, 0x65f: 0x3cf3, 0x660: 0x382c, 0x661: 0x3826, 0x662: 0x3fa9, 0x663: 0x462d, + 0x664: 0x380e, 0x665: 0x3814, 0x666: 0x3832, 0x667: 0x3fb9, 0x668: 0x37a2, 0x669: 0x379c, + 0x66a: 0x3790, 0x66b: 0x444d, 0x66c: 0x378a, 0x66d: 0x36dc, 0x66e: 0x4429, 0x66f: 0x0081, + 0x672: 0x3ff1, 0x673: 0x3838, 0x674: 0x3ff9, + 0x676: 0x49c9, 0x677: 0x4011, 0x678: 0x377e, 0x679: 0x4447, 0x67a: 0x37ae, 0x67b: 0x4459, + 0x67c: 0x37ba, 0x67d: 0x4397, 0x67e: 0xa100, + // Block 0x1a, offset 0x680 + 0x681: 0x3d47, 0x683: 0xa000, 0x684: 0x3d4e, 0x685: 0xa000, + 0x687: 0x3d55, 0x688: 0xa000, 0x689: 0x3d5c, + 0x68d: 0xa000, + 0x6a0: 0x30a6, 0x6a1: 0xa000, 0x6a2: 0x3d6a, + 0x6a4: 0xa000, 0x6a5: 0xa000, + 0x6ad: 0x3d63, 0x6ae: 0x30a1, 0x6af: 0x30ab, + 0x6b0: 0x3d71, 0x6b1: 0x3d78, 0x6b2: 0xa000, 0x6b3: 0xa000, 0x6b4: 0x3d7f, 0x6b5: 0x3d86, + 0x6b6: 0xa000, 0x6b7: 0xa000, 0x6b8: 0x3d8d, 0x6b9: 0x3d94, 0x6ba: 0xa000, 0x6bb: 0xa000, + 0x6bc: 0xa000, 0x6bd: 0xa000, + // Block 0x1b, offset 0x6c0 + 0x6c0: 0x3d9b, 0x6c1: 0x3da2, 0x6c2: 0xa000, 0x6c3: 0xa000, 0x6c4: 0x3db7, 0x6c5: 0x3dbe, + 0x6c6: 0xa000, 0x6c7: 0xa000, 0x6c8: 0x3dc5, 0x6c9: 0x3dcc, + 0x6d1: 0xa000, + 0x6d2: 0xa000, + 0x6e2: 0xa000, + 0x6e8: 0xa000, 0x6e9: 0xa000, + 0x6eb: 0xa000, 0x6ec: 0x3de1, 0x6ed: 0x3de8, 0x6ee: 0x3def, 0x6ef: 0x3df6, + 0x6f2: 0xa000, 0x6f3: 0xa000, 0x6f4: 0xa000, 0x6f5: 0xa000, + // Block 0x1c, offset 0x700 + 0x706: 0xa000, 0x70b: 0xa000, + 0x70c: 0x4049, 0x70d: 0xa000, 0x70e: 0x4051, 0x70f: 0xa000, 0x710: 0x4059, 0x711: 0xa000, + 0x712: 0x4061, 0x713: 0xa000, 0x714: 0x4069, 0x715: 0xa000, 0x716: 0x4071, 0x717: 0xa000, + 0x718: 0x4079, 0x719: 0xa000, 0x71a: 0x4081, 0x71b: 0xa000, 0x71c: 0x4089, 0x71d: 0xa000, + 0x71e: 0x4091, 0x71f: 0xa000, 0x720: 0x4099, 0x721: 0xa000, 0x722: 0x40a1, + 0x724: 0xa000, 0x725: 0x40a9, 0x726: 0xa000, 0x727: 0x40b1, 0x728: 0xa000, 0x729: 0x40b9, + 0x72f: 0xa000, + 0x730: 0x40c1, 0x731: 0x40c9, 0x732: 0xa000, 0x733: 0x40d1, 0x734: 0x40d9, 0x735: 0xa000, + 0x736: 0x40e1, 0x737: 0x40e9, 0x738: 0xa000, 0x739: 0x40f1, 0x73a: 0x40f9, 0x73b: 0xa000, + 0x73c: 0x4101, 0x73d: 0x4109, + // Block 0x1d, offset 0x740 + 0x754: 0x4041, + 0x759: 0x9904, 0x75a: 0x9904, 0x75b: 0x8100, 0x75c: 0x8100, 0x75d: 0xa000, + 0x75e: 0x4111, + 0x766: 0xa000, + 0x76b: 0xa000, 0x76c: 0x4121, 0x76d: 0xa000, 0x76e: 0x4129, 0x76f: 0xa000, + 0x770: 0x4131, 0x771: 0xa000, 0x772: 0x4139, 0x773: 0xa000, 0x774: 0x4141, 0x775: 0xa000, + 0x776: 0x4149, 0x777: 0xa000, 0x778: 0x4151, 0x779: 0xa000, 0x77a: 0x4159, 0x77b: 0xa000, + 0x77c: 0x4161, 0x77d: 0xa000, 0x77e: 0x4169, 0x77f: 0xa000, + // Block 0x1e, offset 0x780 + 0x780: 0x4171, 0x781: 0xa000, 0x782: 0x4179, 0x784: 0xa000, 0x785: 0x4181, + 0x786: 0xa000, 0x787: 0x4189, 0x788: 0xa000, 0x789: 0x4191, + 0x78f: 0xa000, 0x790: 0x4199, 0x791: 0x41a1, + 0x792: 0xa000, 0x793: 0x41a9, 0x794: 0x41b1, 0x795: 0xa000, 0x796: 0x41b9, 0x797: 0x41c1, + 0x798: 0xa000, 0x799: 0x41c9, 0x79a: 0x41d1, 0x79b: 0xa000, 0x79c: 0x41d9, 0x79d: 0x41e1, + 0x7af: 0xa000, + 0x7b0: 0xa000, 0x7b1: 0xa000, 0x7b2: 0xa000, 0x7b4: 0x4119, + 0x7b7: 0x41e9, 0x7b8: 0x41f1, 0x7b9: 0x41f9, 0x7ba: 0x4201, + 0x7bd: 0xa000, 0x7be: 0x4209, + // Block 0x1f, offset 0x7c0 + 0x7c0: 0x1472, 0x7c1: 0x0df6, 0x7c2: 0x14ce, 0x7c3: 0x149a, 0x7c4: 0x0f52, 0x7c5: 0x07e6, + 0x7c6: 0x09da, 0x7c7: 0x1726, 0x7c8: 0x1726, 0x7c9: 0x0b06, 0x7ca: 0x155a, 0x7cb: 0x0a3e, + 0x7cc: 0x0b02, 0x7cd: 0x0cea, 0x7ce: 0x10ca, 0x7cf: 0x125a, 0x7d0: 0x1392, 0x7d1: 0x13ce, + 0x7d2: 0x1402, 0x7d3: 0x1516, 0x7d4: 0x0e6e, 0x7d5: 0x0efa, 0x7d6: 0x0fa6, 0x7d7: 0x103e, + 0x7d8: 0x135a, 0x7d9: 0x1542, 0x7da: 0x166e, 0x7db: 0x080a, 0x7dc: 0x09ae, 0x7dd: 0x0e82, + 0x7de: 0x0fca, 0x7df: 0x138e, 0x7e0: 0x16be, 0x7e1: 0x0bae, 0x7e2: 0x0f72, 0x7e3: 0x137e, + 0x7e4: 0x1412, 0x7e5: 0x0d1e, 0x7e6: 0x12b6, 0x7e7: 0x13da, 0x7e8: 0x0c1a, 0x7e9: 0x0e0a, + 0x7ea: 0x0f12, 0x7eb: 0x1016, 0x7ec: 0x1522, 0x7ed: 0x084a, 0x7ee: 0x08e2, 0x7ef: 0x094e, + 0x7f0: 0x0d86, 0x7f1: 0x0e7a, 0x7f2: 0x0fc6, 0x7f3: 0x10ea, 0x7f4: 0x1272, 0x7f5: 0x1386, + 0x7f6: 0x139e, 0x7f7: 0x14c2, 0x7f8: 0x15ea, 0x7f9: 0x169e, 0x7fa: 0x16ba, 0x7fb: 0x1126, + 0x7fc: 0x1166, 0x7fd: 0x121e, 0x7fe: 0x133e, 0x7ff: 0x1576, + // Block 0x20, offset 0x800 + 0x800: 0x16c6, 0x801: 0x1446, 0x802: 0x0ac2, 0x803: 0x0c36, 0x804: 0x11d6, 0x805: 0x1296, + 0x806: 0x0ffa, 0x807: 0x112e, 0x808: 0x1492, 0x809: 0x15e2, 0x80a: 0x0abe, 0x80b: 0x0b8a, + 0x80c: 0x0e72, 0x80d: 0x0f26, 0x80e: 0x0f5a, 0x80f: 0x120e, 0x810: 0x1236, 0x811: 0x15a2, + 0x812: 0x094a, 0x813: 0x12a2, 0x814: 0x08ee, 0x815: 0x08ea, 0x816: 0x1192, 0x817: 0x1222, + 0x818: 0x1356, 0x819: 0x15aa, 0x81a: 0x1462, 0x81b: 0x0d22, 0x81c: 0x0e6e, 0x81d: 0x1452, + 0x81e: 0x07f2, 0x81f: 0x0b5e, 0x820: 0x0c8e, 0x821: 0x102a, 0x822: 0x10aa, 0x823: 0x096e, + 0x824: 0x1136, 0x825: 0x085a, 0x826: 0x0c72, 0x827: 0x07d2, 0x828: 0x0ee6, 0x829: 0x0d9e, + 0x82a: 0x120a, 0x82b: 0x09c2, 0x82c: 0x0aae, 0x82d: 0x10f6, 0x82e: 0x135e, 0x82f: 0x1436, + 0x830: 0x0eb2, 0x831: 0x14f2, 0x832: 0x0ede, 0x833: 0x0d32, 0x834: 0x1316, 0x835: 0x0d52, + 0x836: 0x10a6, 0x837: 0x0826, 0x838: 0x08a2, 0x839: 0x08e6, 0x83a: 0x0e4e, 0x83b: 0x11f6, + 0x83c: 0x12ee, 0x83d: 0x1442, 0x83e: 0x1556, 0x83f: 0x0956, + // Block 0x21, offset 0x840 + 0x840: 0x0a0a, 0x841: 0x0b12, 0x842: 0x0c2a, 0x843: 0x0dba, 0x844: 0x0f76, 0x845: 0x113a, + 0x846: 0x1592, 0x847: 0x1676, 0x848: 0x16ca, 0x849: 0x16e2, 0x84a: 0x0932, 0x84b: 0x0dee, + 0x84c: 0x0e9e, 0x84d: 0x14e6, 0x84e: 0x0bf6, 0x84f: 0x0cd2, 0x850: 0x0cee, 0x851: 0x0d7e, + 0x852: 0x0f66, 0x853: 0x0fb2, 0x854: 0x1062, 0x855: 0x1186, 0x856: 0x122a, 0x857: 0x128e, + 0x858: 0x14d6, 0x859: 0x1366, 0x85a: 0x14fe, 0x85b: 0x157a, 0x85c: 0x090a, 0x85d: 0x0936, + 0x85e: 0x0a1e, 0x85f: 0x0fa2, 0x860: 0x13ee, 0x861: 0x1436, 0x862: 0x0c16, 0x863: 0x0c86, + 0x864: 0x0d4a, 0x865: 0x0eaa, 0x866: 0x11d2, 0x867: 0x101e, 0x868: 0x0836, 0x869: 0x0a7a, + 0x86a: 0x0b5e, 0x86b: 0x0bc2, 0x86c: 0x0c92, 0x86d: 0x103a, 0x86e: 0x1056, 0x86f: 0x1266, + 0x870: 0x1286, 0x871: 0x155e, 0x872: 0x15de, 0x873: 0x15ee, 0x874: 0x162a, 0x875: 0x084e, + 0x876: 0x117a, 0x877: 0x154a, 0x878: 0x15c6, 0x879: 0x0caa, 0x87a: 0x0812, 0x87b: 0x0872, + 0x87c: 0x0b62, 0x87d: 0x0b82, 0x87e: 0x0daa, 0x87f: 0x0e6e, + // Block 0x22, offset 0x880 + 0x880: 0x0fbe, 0x881: 0x10c6, 0x882: 0x1372, 0x883: 0x1512, 0x884: 0x171e, 0x885: 0x0dde, + 0x886: 0x159e, 0x887: 0x092e, 0x888: 0x0e2a, 0x889: 0x0e36, 0x88a: 0x0f0a, 0x88b: 0x0f42, + 0x88c: 0x1046, 0x88d: 0x10a2, 0x88e: 0x1122, 0x88f: 0x1206, 0x890: 0x1636, 0x891: 0x08aa, + 0x892: 0x0cfe, 0x893: 0x15ae, 0x894: 0x0862, 0x895: 0x0ba6, 0x896: 0x0f2a, 0x897: 0x14da, + 0x898: 0x0c62, 0x899: 0x0cb2, 0x89a: 0x0e3e, 0x89b: 0x102a, 0x89c: 0x15b6, 0x89d: 0x0912, + 0x89e: 0x09fa, 0x89f: 0x0b92, 0x8a0: 0x0dce, 0x8a1: 0x0e1a, 0x8a2: 0x0e5a, 0x8a3: 0x0eee, + 0x8a4: 0x1042, 0x8a5: 0x10b6, 0x8a6: 0x1252, 0x8a7: 0x13f2, 0x8a8: 0x13fe, 0x8a9: 0x1552, + 0x8aa: 0x15d2, 0x8ab: 0x097e, 0x8ac: 0x0f46, 0x8ad: 0x09fe, 0x8ae: 0x0fc2, 0x8af: 0x1066, + 0x8b0: 0x1382, 0x8b1: 0x15ba, 0x8b2: 0x16a6, 0x8b3: 0x16ce, 0x8b4: 0x0e32, 0x8b5: 0x0f22, + 0x8b6: 0x12be, 0x8b7: 0x11b2, 0x8b8: 0x11be, 0x8b9: 0x11e2, 0x8ba: 0x1012, 0x8bb: 0x0f9a, + 0x8bc: 0x145e, 0x8bd: 0x082e, 0x8be: 0x1326, 0x8bf: 0x0916, + // Block 0x23, offset 0x8c0 + 0x8c0: 0x0906, 0x8c1: 0x0c06, 0x8c2: 0x0d26, 0x8c3: 0x11ee, 0x8c4: 0x0b4e, 0x8c5: 0x0efe, + 0x8c6: 0x0dea, 0x8c7: 0x14e2, 0x8c8: 0x13e2, 0x8c9: 0x15a6, 0x8ca: 0x141e, 0x8cb: 0x0c22, + 0x8cc: 0x0882, 0x8cd: 0x0a56, 0x8d0: 0x0aaa, + 0x8d2: 0x0dda, 0x8d5: 0x08f2, 0x8d6: 0x101a, 0x8d7: 0x10de, + 0x8d8: 0x1142, 0x8d9: 0x115e, 0x8da: 0x1162, 0x8db: 0x1176, 0x8dc: 0x15f6, 0x8dd: 0x11e6, + 0x8de: 0x126a, 0x8e0: 0x138a, 0x8e2: 0x144e, + 0x8e5: 0x1502, 0x8e6: 0x152e, + 0x8ea: 0x164a, 0x8eb: 0x164e, 0x8ec: 0x1652, 0x8ed: 0x16b6, 0x8ee: 0x1526, 0x8ef: 0x15c2, + 0x8f0: 0x0852, 0x8f1: 0x0876, 0x8f2: 0x088a, 0x8f3: 0x0946, 0x8f4: 0x0952, 0x8f5: 0x0992, + 0x8f6: 0x0a46, 0x8f7: 0x0a62, 0x8f8: 0x0a6a, 0x8f9: 0x0aa6, 0x8fa: 0x0ab2, 0x8fb: 0x0b8e, + 0x8fc: 0x0b96, 0x8fd: 0x0c9e, 0x8fe: 0x0cc6, 0x8ff: 0x0cce, + // Block 0x24, offset 0x900 + 0x900: 0x0ce6, 0x901: 0x0d92, 0x902: 0x0dc2, 0x903: 0x0de2, 0x904: 0x0e52, 0x905: 0x0f16, + 0x906: 0x0f32, 0x907: 0x0f62, 0x908: 0x0fb6, 0x909: 0x0fd6, 0x90a: 0x104a, 0x90b: 0x112a, + 0x90c: 0x1146, 0x90d: 0x114e, 0x90e: 0x114a, 0x90f: 0x1152, 0x910: 0x1156, 0x911: 0x115a, + 0x912: 0x116e, 0x913: 0x1172, 0x914: 0x1196, 0x915: 0x11aa, 0x916: 0x11c6, 0x917: 0x122a, + 0x918: 0x1232, 0x919: 0x123a, 0x91a: 0x124e, 0x91b: 0x1276, 0x91c: 0x12c6, 0x91d: 0x12fa, + 0x91e: 0x12fa, 0x91f: 0x1362, 0x920: 0x140a, 0x921: 0x1422, 0x922: 0x1456, 0x923: 0x145a, + 0x924: 0x149e, 0x925: 0x14a2, 0x926: 0x14fa, 0x927: 0x1502, 0x928: 0x15d6, 0x929: 0x161a, + 0x92a: 0x1632, 0x92b: 0x0c96, 0x92c: 0x184b, 0x92d: 0x12de, + 0x930: 0x07da, 0x931: 0x08de, 0x932: 0x089e, 0x933: 0x0846, 0x934: 0x0886, 0x935: 0x08b2, + 0x936: 0x0942, 0x937: 0x095e, 0x938: 0x0a46, 0x939: 0x0a32, 0x93a: 0x0a42, 0x93b: 0x0a5e, + 0x93c: 0x0aaa, 0x93d: 0x0aba, 0x93e: 0x0afe, 0x93f: 0x0b0a, + // Block 0x25, offset 0x940 + 0x940: 0x0b26, 0x941: 0x0b36, 0x942: 0x0c1e, 0x943: 0x0c26, 0x944: 0x0c56, 0x945: 0x0c76, + 0x946: 0x0ca6, 0x947: 0x0cbe, 0x948: 0x0cae, 0x949: 0x0cce, 0x94a: 0x0cc2, 0x94b: 0x0ce6, + 0x94c: 0x0d02, 0x94d: 0x0d5a, 0x94e: 0x0d66, 0x94f: 0x0d6e, 0x950: 0x0d96, 0x951: 0x0dda, + 0x952: 0x0e0a, 0x953: 0x0e0e, 0x954: 0x0e22, 0x955: 0x0ea2, 0x956: 0x0eb2, 0x957: 0x0f0a, + 0x958: 0x0f56, 0x959: 0x0f4e, 0x95a: 0x0f62, 0x95b: 0x0f7e, 0x95c: 0x0fb6, 0x95d: 0x110e, + 0x95e: 0x0fda, 0x95f: 0x100e, 0x960: 0x101a, 0x961: 0x105a, 0x962: 0x1076, 0x963: 0x109a, + 0x964: 0x10be, 0x965: 0x10c2, 0x966: 0x10de, 0x967: 0x10e2, 0x968: 0x10f2, 0x969: 0x1106, + 0x96a: 0x1102, 0x96b: 0x1132, 0x96c: 0x11ae, 0x96d: 0x11c6, 0x96e: 0x11de, 0x96f: 0x1216, + 0x970: 0x122a, 0x971: 0x1246, 0x972: 0x1276, 0x973: 0x132a, 0x974: 0x1352, 0x975: 0x13c6, + 0x976: 0x140e, 0x977: 0x141a, 0x978: 0x1422, 0x979: 0x143a, 0x97a: 0x144e, 0x97b: 0x143e, + 0x97c: 0x1456, 0x97d: 0x1452, 0x97e: 0x144a, 0x97f: 0x145a, + // Block 0x26, offset 0x980 + 0x980: 0x1466, 0x981: 0x14a2, 0x982: 0x14de, 0x983: 0x150e, 0x984: 0x1546, 0x985: 0x1566, + 0x986: 0x15b2, 0x987: 0x15d6, 0x988: 0x15f6, 0x989: 0x160a, 0x98a: 0x161a, 0x98b: 0x1626, + 0x98c: 0x1632, 0x98d: 0x1686, 0x98e: 0x1726, 0x98f: 0x17e2, 0x990: 0x17dd, 0x991: 0x180f, + 0x992: 0x0702, 0x993: 0x072a, 0x994: 0x072e, 0x995: 0x1891, 0x996: 0x18be, 0x997: 0x1936, + 0x998: 0x1712, 0x999: 0x1722, + // Block 0x27, offset 0x9c0 + 0x9c0: 0x07f6, 0x9c1: 0x07ee, 0x9c2: 0x07fe, 0x9c3: 0x1774, 0x9c4: 0x0842, 0x9c5: 0x0852, + 0x9c6: 0x0856, 0x9c7: 0x085e, 0x9c8: 0x0866, 0x9c9: 0x086a, 0x9ca: 0x0876, 0x9cb: 0x086e, + 0x9cc: 0x06ae, 0x9cd: 0x1788, 0x9ce: 0x088a, 0x9cf: 0x088e, 0x9d0: 0x0892, 0x9d1: 0x08ae, + 0x9d2: 0x1779, 0x9d3: 0x06b2, 0x9d4: 0x089a, 0x9d5: 0x08ba, 0x9d6: 0x1783, 0x9d7: 0x08ca, + 0x9d8: 0x08d2, 0x9d9: 0x0832, 0x9da: 0x08da, 0x9db: 0x08de, 0x9dc: 0x195e, 0x9dd: 0x08fa, + 0x9de: 0x0902, 0x9df: 0x06ba, 0x9e0: 0x091a, 0x9e1: 0x091e, 0x9e2: 0x0926, 0x9e3: 0x092a, + 0x9e4: 0x06be, 0x9e5: 0x0942, 0x9e6: 0x0946, 0x9e7: 0x0952, 0x9e8: 0x095e, 0x9e9: 0x0962, + 0x9ea: 0x0966, 0x9eb: 0x096e, 0x9ec: 0x098e, 0x9ed: 0x0992, 0x9ee: 0x099a, 0x9ef: 0x09aa, + 0x9f0: 0x09b2, 0x9f1: 0x09b6, 0x9f2: 0x09b6, 0x9f3: 0x09b6, 0x9f4: 0x1797, 0x9f5: 0x0f8e, + 0x9f6: 0x09ca, 0x9f7: 0x09d2, 0x9f8: 0x179c, 0x9f9: 0x09de, 0x9fa: 0x09e6, 0x9fb: 0x09ee, + 0x9fc: 0x0a16, 0x9fd: 0x0a02, 0x9fe: 0x0a0e, 0x9ff: 0x0a12, + // Block 0x28, offset 0xa00 + 0xa00: 0x0a1a, 0xa01: 0x0a22, 0xa02: 0x0a26, 0xa03: 0x0a2e, 0xa04: 0x0a36, 0xa05: 0x0a3a, + 0xa06: 0x0a3a, 0xa07: 0x0a42, 0xa08: 0x0a4a, 0xa09: 0x0a4e, 0xa0a: 0x0a5a, 0xa0b: 0x0a7e, + 0xa0c: 0x0a62, 0xa0d: 0x0a82, 0xa0e: 0x0a66, 0xa0f: 0x0a6e, 0xa10: 0x0906, 0xa11: 0x0aca, + 0xa12: 0x0a92, 0xa13: 0x0a96, 0xa14: 0x0a9a, 0xa15: 0x0a8e, 0xa16: 0x0aa2, 0xa17: 0x0a9e, + 0xa18: 0x0ab6, 0xa19: 0x17a1, 0xa1a: 0x0ad2, 0xa1b: 0x0ad6, 0xa1c: 0x0ade, 0xa1d: 0x0aea, + 0xa1e: 0x0af2, 0xa1f: 0x0b0e, 0xa20: 0x17a6, 0xa21: 0x17ab, 0xa22: 0x0b1a, 0xa23: 0x0b1e, + 0xa24: 0x0b22, 0xa25: 0x0b16, 0xa26: 0x0b2a, 0xa27: 0x06c2, 0xa28: 0x06c6, 0xa29: 0x0b32, + 0xa2a: 0x0b3a, 0xa2b: 0x0b3a, 0xa2c: 0x17b0, 0xa2d: 0x0b56, 0xa2e: 0x0b5a, 0xa2f: 0x0b5e, + 0xa30: 0x0b66, 0xa31: 0x17b5, 0xa32: 0x0b6e, 0xa33: 0x0b72, 0xa34: 0x0c4a, 0xa35: 0x0b7a, + 0xa36: 0x06ca, 0xa37: 0x0b86, 0xa38: 0x0b96, 0xa39: 0x0ba2, 0xa3a: 0x0b9e, 0xa3b: 0x17bf, + 0xa3c: 0x0baa, 0xa3d: 0x17c4, 0xa3e: 0x0bb6, 0xa3f: 0x0bb2, + // Block 0x29, offset 0xa40 + 0xa40: 0x0bba, 0xa41: 0x0bca, 0xa42: 0x0bce, 0xa43: 0x06ce, 0xa44: 0x0bde, 0xa45: 0x0be6, + 0xa46: 0x0bea, 0xa47: 0x0bee, 0xa48: 0x06d2, 0xa49: 0x17c9, 0xa4a: 0x06d6, 0xa4b: 0x0c0a, + 0xa4c: 0x0c0e, 0xa4d: 0x0c12, 0xa4e: 0x0c1a, 0xa4f: 0x1990, 0xa50: 0x0c32, 0xa51: 0x17d3, + 0xa52: 0x17d3, 0xa53: 0x12d2, 0xa54: 0x0c42, 0xa55: 0x0c42, 0xa56: 0x06da, 0xa57: 0x17f6, + 0xa58: 0x18c8, 0xa59: 0x0c52, 0xa5a: 0x0c5a, 0xa5b: 0x06de, 0xa5c: 0x0c6e, 0xa5d: 0x0c7e, + 0xa5e: 0x0c82, 0xa5f: 0x0c8a, 0xa60: 0x0c9a, 0xa61: 0x06e6, 0xa62: 0x06e2, 0xa63: 0x0c9e, + 0xa64: 0x17d8, 0xa65: 0x0ca2, 0xa66: 0x0cb6, 0xa67: 0x0cba, 0xa68: 0x0cbe, 0xa69: 0x0cba, + 0xa6a: 0x0cca, 0xa6b: 0x0cce, 0xa6c: 0x0cde, 0xa6d: 0x0cd6, 0xa6e: 0x0cda, 0xa6f: 0x0ce2, + 0xa70: 0x0ce6, 0xa71: 0x0cea, 0xa72: 0x0cf6, 0xa73: 0x0cfa, 0xa74: 0x0d12, 0xa75: 0x0d1a, + 0xa76: 0x0d2a, 0xa77: 0x0d3e, 0xa78: 0x17e7, 0xa79: 0x0d3a, 0xa7a: 0x0d2e, 0xa7b: 0x0d46, + 0xa7c: 0x0d4e, 0xa7d: 0x0d62, 0xa7e: 0x17ec, 0xa7f: 0x0d6a, + // Block 0x2a, offset 0xa80 + 0xa80: 0x0d5e, 0xa81: 0x0d56, 0xa82: 0x06ea, 0xa83: 0x0d72, 0xa84: 0x0d7a, 0xa85: 0x0d82, + 0xa86: 0x0d76, 0xa87: 0x06ee, 0xa88: 0x0d92, 0xa89: 0x0d9a, 0xa8a: 0x17f1, 0xa8b: 0x0dc6, + 0xa8c: 0x0dfa, 0xa8d: 0x0dd6, 0xa8e: 0x06fa, 0xa8f: 0x0de2, 0xa90: 0x06f6, 0xa91: 0x06f2, + 0xa92: 0x08be, 0xa93: 0x08c2, 0xa94: 0x0dfe, 0xa95: 0x0de6, 0xa96: 0x12a6, 0xa97: 0x075e, + 0xa98: 0x0e0a, 0xa99: 0x0e0e, 0xa9a: 0x0e12, 0xa9b: 0x0e26, 0xa9c: 0x0e1e, 0xa9d: 0x180a, + 0xa9e: 0x06fe, 0xa9f: 0x0e3a, 0xaa0: 0x0e2e, 0xaa1: 0x0e4a, 0xaa2: 0x0e52, 0xaa3: 0x1814, + 0xaa4: 0x0e56, 0xaa5: 0x0e42, 0xaa6: 0x0e5e, 0xaa7: 0x0702, 0xaa8: 0x0e62, 0xaa9: 0x0e66, + 0xaaa: 0x0e6a, 0xaab: 0x0e76, 0xaac: 0x1819, 0xaad: 0x0e7e, 0xaae: 0x0706, 0xaaf: 0x0e8a, + 0xab0: 0x181e, 0xab1: 0x0e8e, 0xab2: 0x070a, 0xab3: 0x0e9a, 0xab4: 0x0ea6, 0xab5: 0x0eb2, + 0xab6: 0x0eb6, 0xab7: 0x1823, 0xab8: 0x17ba, 0xab9: 0x1828, 0xaba: 0x0ed6, 0xabb: 0x182d, + 0xabc: 0x0ee2, 0xabd: 0x0eea, 0xabe: 0x0eda, 0xabf: 0x0ef6, + // Block 0x2b, offset 0xac0 + 0xac0: 0x0f06, 0xac1: 0x0f16, 0xac2: 0x0f0a, 0xac3: 0x0f0e, 0xac4: 0x0f1a, 0xac5: 0x0f1e, + 0xac6: 0x1832, 0xac7: 0x0f02, 0xac8: 0x0f36, 0xac9: 0x0f3a, 0xaca: 0x070e, 0xacb: 0x0f4e, + 0xacc: 0x0f4a, 0xacd: 0x1837, 0xace: 0x0f2e, 0xacf: 0x0f6a, 0xad0: 0x183c, 0xad1: 0x1841, + 0xad2: 0x0f6e, 0xad3: 0x0f82, 0xad4: 0x0f7e, 0xad5: 0x0f7a, 0xad6: 0x0712, 0xad7: 0x0f86, + 0xad8: 0x0f96, 0xad9: 0x0f92, 0xada: 0x0f9e, 0xadb: 0x177e, 0xadc: 0x0fae, 0xadd: 0x1846, + 0xade: 0x0fba, 0xadf: 0x1850, 0xae0: 0x0fce, 0xae1: 0x0fda, 0xae2: 0x0fee, 0xae3: 0x1855, + 0xae4: 0x1002, 0xae5: 0x1006, 0xae6: 0x185a, 0xae7: 0x185f, 0xae8: 0x1022, 0xae9: 0x1032, + 0xaea: 0x0716, 0xaeb: 0x1036, 0xaec: 0x071a, 0xaed: 0x071a, 0xaee: 0x104e, 0xaef: 0x1052, + 0xaf0: 0x105a, 0xaf1: 0x105e, 0xaf2: 0x106a, 0xaf3: 0x071e, 0xaf4: 0x1082, 0xaf5: 0x1864, + 0xaf6: 0x109e, 0xaf7: 0x1869, 0xaf8: 0x10aa, 0xaf9: 0x17ce, 0xafa: 0x10ba, 0xafb: 0x186e, + 0xafc: 0x1873, 0xafd: 0x1878, 0xafe: 0x0722, 0xaff: 0x0726, + // Block 0x2c, offset 0xb00 + 0xb00: 0x10f2, 0xb01: 0x1882, 0xb02: 0x187d, 0xb03: 0x1887, 0xb04: 0x188c, 0xb05: 0x10fa, + 0xb06: 0x10fe, 0xb07: 0x10fe, 0xb08: 0x1106, 0xb09: 0x072e, 0xb0a: 0x110a, 0xb0b: 0x0732, + 0xb0c: 0x0736, 0xb0d: 0x1896, 0xb0e: 0x111e, 0xb0f: 0x1126, 0xb10: 0x1132, 0xb11: 0x073a, + 0xb12: 0x189b, 0xb13: 0x1156, 0xb14: 0x18a0, 0xb15: 0x18a5, 0xb16: 0x1176, 0xb17: 0x118e, + 0xb18: 0x073e, 0xb19: 0x1196, 0xb1a: 0x119a, 0xb1b: 0x119e, 0xb1c: 0x18aa, 0xb1d: 0x18af, + 0xb1e: 0x18af, 0xb1f: 0x11b6, 0xb20: 0x0742, 0xb21: 0x18b4, 0xb22: 0x11ca, 0xb23: 0x11ce, + 0xb24: 0x0746, 0xb25: 0x18b9, 0xb26: 0x11ea, 0xb27: 0x074a, 0xb28: 0x11fa, 0xb29: 0x11f2, + 0xb2a: 0x1202, 0xb2b: 0x18c3, 0xb2c: 0x121a, 0xb2d: 0x074e, 0xb2e: 0x1226, 0xb2f: 0x122e, + 0xb30: 0x123e, 0xb31: 0x0752, 0xb32: 0x18cd, 0xb33: 0x18d2, 0xb34: 0x0756, 0xb35: 0x18d7, + 0xb36: 0x1256, 0xb37: 0x18dc, 0xb38: 0x1262, 0xb39: 0x126e, 0xb3a: 0x1276, 0xb3b: 0x18e1, + 0xb3c: 0x18e6, 0xb3d: 0x128a, 0xb3e: 0x18eb, 0xb3f: 0x1292, + // Block 0x2d, offset 0xb40 + 0xb40: 0x17fb, 0xb41: 0x075a, 0xb42: 0x12aa, 0xb43: 0x12ae, 0xb44: 0x0762, 0xb45: 0x12b2, + 0xb46: 0x0b2e, 0xb47: 0x18f0, 0xb48: 0x18f5, 0xb49: 0x1800, 0xb4a: 0x1805, 0xb4b: 0x12d2, + 0xb4c: 0x12d6, 0xb4d: 0x14ee, 0xb4e: 0x0766, 0xb4f: 0x1302, 0xb50: 0x12fe, 0xb51: 0x1306, + 0xb52: 0x093a, 0xb53: 0x130a, 0xb54: 0x130e, 0xb55: 0x1312, 0xb56: 0x131a, 0xb57: 0x18fa, + 0xb58: 0x1316, 0xb59: 0x131e, 0xb5a: 0x1332, 0xb5b: 0x1336, 0xb5c: 0x1322, 0xb5d: 0x133a, + 0xb5e: 0x134e, 0xb5f: 0x1362, 0xb60: 0x132e, 0xb61: 0x1342, 0xb62: 0x1346, 0xb63: 0x134a, + 0xb64: 0x18ff, 0xb65: 0x1909, 0xb66: 0x1904, 0xb67: 0x076a, 0xb68: 0x136a, 0xb69: 0x136e, + 0xb6a: 0x1376, 0xb6b: 0x191d, 0xb6c: 0x137a, 0xb6d: 0x190e, 0xb6e: 0x076e, 0xb6f: 0x0772, + 0xb70: 0x1913, 0xb71: 0x1918, 0xb72: 0x0776, 0xb73: 0x139a, 0xb74: 0x139e, 0xb75: 0x13a2, + 0xb76: 0x13a6, 0xb77: 0x13b2, 0xb78: 0x13ae, 0xb79: 0x13ba, 0xb7a: 0x13b6, 0xb7b: 0x13c6, + 0xb7c: 0x13be, 0xb7d: 0x13c2, 0xb7e: 0x13ca, 0xb7f: 0x077a, + // Block 0x2e, offset 0xb80 + 0xb80: 0x13d2, 0xb81: 0x13d6, 0xb82: 0x077e, 0xb83: 0x13e6, 0xb84: 0x13ea, 0xb85: 0x1922, + 0xb86: 0x13f6, 0xb87: 0x13fa, 0xb88: 0x0782, 0xb89: 0x1406, 0xb8a: 0x06b6, 0xb8b: 0x1927, + 0xb8c: 0x192c, 0xb8d: 0x0786, 0xb8e: 0x078a, 0xb8f: 0x1432, 0xb90: 0x144a, 0xb91: 0x1466, + 0xb92: 0x1476, 0xb93: 0x1931, 0xb94: 0x148a, 0xb95: 0x148e, 0xb96: 0x14a6, 0xb97: 0x14b2, + 0xb98: 0x193b, 0xb99: 0x178d, 0xb9a: 0x14be, 0xb9b: 0x14ba, 0xb9c: 0x14c6, 0xb9d: 0x1792, + 0xb9e: 0x14d2, 0xb9f: 0x14de, 0xba0: 0x1940, 0xba1: 0x1945, 0xba2: 0x151e, 0xba3: 0x152a, + 0xba4: 0x1532, 0xba5: 0x194a, 0xba6: 0x1536, 0xba7: 0x1562, 0xba8: 0x156e, 0xba9: 0x1572, + 0xbaa: 0x156a, 0xbab: 0x157e, 0xbac: 0x1582, 0xbad: 0x194f, 0xbae: 0x158e, 0xbaf: 0x078e, + 0xbb0: 0x1596, 0xbb1: 0x1954, 0xbb2: 0x0792, 0xbb3: 0x15ce, 0xbb4: 0x0bbe, 0xbb5: 0x15e6, + 0xbb6: 0x1959, 0xbb7: 0x1963, 0xbb8: 0x0796, 0xbb9: 0x079a, 0xbba: 0x160e, 0xbbb: 0x1968, + 0xbbc: 0x079e, 0xbbd: 0x196d, 0xbbe: 0x1626, 0xbbf: 0x1626, + // Block 0x2f, offset 0xbc0 + 0xbc0: 0x162e, 0xbc1: 0x1972, 0xbc2: 0x1646, 0xbc3: 0x07a2, 0xbc4: 0x1656, 0xbc5: 0x1662, + 0xbc6: 0x166a, 0xbc7: 0x1672, 0xbc8: 0x07a6, 0xbc9: 0x1977, 0xbca: 0x1686, 0xbcb: 0x16a2, + 0xbcc: 0x16ae, 0xbcd: 0x07aa, 0xbce: 0x07ae, 0xbcf: 0x16b2, 0xbd0: 0x197c, 0xbd1: 0x07b2, + 0xbd2: 0x1981, 0xbd3: 0x1986, 0xbd4: 0x198b, 0xbd5: 0x16d6, 0xbd6: 0x07b6, 0xbd7: 0x16ea, + 0xbd8: 0x16f2, 0xbd9: 0x16f6, 0xbda: 0x16fe, 0xbdb: 0x1706, 0xbdc: 0x170e, 0xbdd: 0x1995, +} + +// nfcIndex: 22 blocks, 1408 entries, 1408 bytes +// Block 0 is the zero block. +var nfcIndex = [1408]uint8{ + // Block 0x0, offset 0x0 + // Block 0x1, offset 0x40 + // Block 0x2, offset 0x80 + // Block 0x3, offset 0xc0 + 0xc2: 0x2e, 0xc3: 0x01, 0xc4: 0x02, 0xc5: 0x03, 0xc6: 0x2f, 0xc7: 0x04, + 0xc8: 0x05, 0xca: 0x30, 0xcb: 0x31, 0xcc: 0x06, 0xcd: 0x07, 0xce: 0x08, 0xcf: 0x32, + 0xd0: 0x09, 0xd1: 0x33, 0xd2: 0x34, 0xd3: 0x0a, 0xd6: 0x0b, 0xd7: 0x35, + 0xd8: 0x36, 0xd9: 0x0c, 0xdb: 0x37, 0xdc: 0x38, 0xdd: 0x39, 0xdf: 0x3a, + 0xe0: 0x02, 0xe1: 0x03, 0xe2: 0x04, 0xe3: 0x05, + 0xea: 0x06, 0xeb: 0x07, 0xec: 0x08, 0xed: 0x09, 0xef: 0x0a, + 0xf0: 0x13, + // Block 0x4, offset 0x100 + 0x120: 0x3b, 0x121: 0x3c, 0x122: 0x3d, 0x123: 0x0d, 0x124: 0x3e, 0x125: 0x3f, 0x126: 0x40, 0x127: 0x41, + 0x128: 0x42, 0x129: 0x43, 0x12a: 0x44, 0x12b: 0x45, 0x12c: 0x40, 0x12d: 0x46, 0x12e: 0x47, 0x12f: 0x48, + 0x130: 0x44, 0x131: 0x49, 0x132: 0x4a, 0x133: 0x4b, 0x134: 0x4c, 0x135: 0x4d, 0x137: 0x4e, + 0x138: 0x4f, 0x139: 0x50, 0x13a: 0x51, 0x13b: 0x52, 0x13c: 0x53, 0x13d: 0x54, 0x13e: 0x55, 0x13f: 0x56, + // Block 0x5, offset 0x140 + 0x140: 0x57, 0x142: 0x58, 0x144: 0x59, 0x145: 0x5a, 0x146: 0x5b, 0x147: 0x5c, + 0x14d: 0x5d, + 0x15c: 0x5e, 0x15f: 0x5f, + 0x162: 0x60, 0x164: 0x61, + 0x168: 0x62, 0x169: 0x63, 0x16a: 0x64, 0x16b: 0x65, 0x16c: 0x0e, 0x16d: 0x66, 0x16e: 0x67, 0x16f: 0x68, + 0x170: 0x69, 0x173: 0x6a, 0x177: 0x0f, + 0x178: 0x10, 0x179: 0x11, 0x17a: 0x12, 0x17b: 0x13, 0x17c: 0x14, 0x17d: 0x15, 0x17e: 0x16, 0x17f: 0x17, + // Block 0x6, offset 0x180 + 0x180: 0x6b, 0x183: 0x6c, 0x184: 0x6d, 0x186: 0x6e, 0x187: 0x6f, + 0x188: 0x70, 0x189: 0x18, 0x18a: 0x19, 0x18b: 0x71, 0x18c: 0x72, + 0x1ab: 0x73, + 0x1b3: 0x74, 0x1b5: 0x75, 0x1b7: 0x76, + // Block 0x7, offset 0x1c0 + 0x1c0: 0x77, 0x1c1: 0x1a, 0x1c2: 0x1b, 0x1c3: 0x1c, 0x1c4: 0x78, 0x1c5: 0x79, + 0x1c9: 0x7a, 0x1cc: 0x7b, 0x1cd: 0x7c, + // Block 0x8, offset 0x200 + 0x219: 0x7d, 0x21a: 0x7e, 0x21b: 0x7f, + 0x220: 0x80, 0x223: 0x81, 0x224: 0x82, 0x225: 0x83, 0x226: 0x84, 0x227: 0x85, + 0x22a: 0x86, 0x22b: 0x87, 0x22f: 0x88, + 0x230: 0x89, 0x231: 0x8a, 0x232: 0x8b, 0x233: 0x8c, 0x234: 0x8d, 0x235: 0x8e, 0x236: 0x8f, 0x237: 0x89, + 0x238: 0x8a, 0x239: 0x8b, 0x23a: 0x8c, 0x23b: 0x8d, 0x23c: 0x8e, 0x23d: 0x8f, 0x23e: 0x89, 0x23f: 0x8a, + // Block 0x9, offset 0x240 + 0x240: 0x8b, 0x241: 0x8c, 0x242: 0x8d, 0x243: 0x8e, 0x244: 0x8f, 0x245: 0x89, 0x246: 0x8a, 0x247: 0x8b, + 0x248: 0x8c, 0x249: 0x8d, 0x24a: 0x8e, 0x24b: 0x8f, 0x24c: 0x89, 0x24d: 0x8a, 0x24e: 0x8b, 0x24f: 0x8c, + 0x250: 0x8d, 0x251: 0x8e, 0x252: 0x8f, 0x253: 0x89, 0x254: 0x8a, 0x255: 0x8b, 0x256: 0x8c, 0x257: 0x8d, + 0x258: 0x8e, 0x259: 0x8f, 0x25a: 0x89, 0x25b: 0x8a, 0x25c: 0x8b, 0x25d: 0x8c, 0x25e: 0x8d, 0x25f: 0x8e, + 0x260: 0x8f, 0x261: 0x89, 0x262: 0x8a, 0x263: 0x8b, 0x264: 0x8c, 0x265: 0x8d, 0x266: 0x8e, 0x267: 0x8f, + 0x268: 0x89, 0x269: 0x8a, 0x26a: 0x8b, 0x26b: 0x8c, 0x26c: 0x8d, 0x26d: 0x8e, 0x26e: 0x8f, 0x26f: 0x89, + 0x270: 0x8a, 0x271: 0x8b, 0x272: 0x8c, 0x273: 0x8d, 0x274: 0x8e, 0x275: 0x8f, 0x276: 0x89, 0x277: 0x8a, + 0x278: 0x8b, 0x279: 0x8c, 0x27a: 0x8d, 0x27b: 0x8e, 0x27c: 0x8f, 0x27d: 0x89, 0x27e: 0x8a, 0x27f: 0x8b, + // Block 0xa, offset 0x280 + 0x280: 0x8c, 0x281: 0x8d, 0x282: 0x8e, 0x283: 0x8f, 0x284: 0x89, 0x285: 0x8a, 0x286: 0x8b, 0x287: 0x8c, + 0x288: 0x8d, 0x289: 0x8e, 0x28a: 0x8f, 0x28b: 0x89, 0x28c: 0x8a, 0x28d: 0x8b, 0x28e: 0x8c, 0x28f: 0x8d, + 0x290: 0x8e, 0x291: 0x8f, 0x292: 0x89, 0x293: 0x8a, 0x294: 0x8b, 0x295: 0x8c, 0x296: 0x8d, 0x297: 0x8e, + 0x298: 0x8f, 0x299: 0x89, 0x29a: 0x8a, 0x29b: 0x8b, 0x29c: 0x8c, 0x29d: 0x8d, 0x29e: 0x8e, 0x29f: 0x8f, + 0x2a0: 0x89, 0x2a1: 0x8a, 0x2a2: 0x8b, 0x2a3: 0x8c, 0x2a4: 0x8d, 0x2a5: 0x8e, 0x2a6: 0x8f, 0x2a7: 0x89, + 0x2a8: 0x8a, 0x2a9: 0x8b, 0x2aa: 0x8c, 0x2ab: 0x8d, 0x2ac: 0x8e, 0x2ad: 0x8f, 0x2ae: 0x89, 0x2af: 0x8a, + 0x2b0: 0x8b, 0x2b1: 0x8c, 0x2b2: 0x8d, 0x2b3: 0x8e, 0x2b4: 0x8f, 0x2b5: 0x89, 0x2b6: 0x8a, 0x2b7: 0x8b, + 0x2b8: 0x8c, 0x2b9: 0x8d, 0x2ba: 0x8e, 0x2bb: 0x8f, 0x2bc: 0x89, 0x2bd: 0x8a, 0x2be: 0x8b, 0x2bf: 0x8c, + // Block 0xb, offset 0x2c0 + 0x2c0: 0x8d, 0x2c1: 0x8e, 0x2c2: 0x8f, 0x2c3: 0x89, 0x2c4: 0x8a, 0x2c5: 0x8b, 0x2c6: 0x8c, 0x2c7: 0x8d, + 0x2c8: 0x8e, 0x2c9: 0x8f, 0x2ca: 0x89, 0x2cb: 0x8a, 0x2cc: 0x8b, 0x2cd: 0x8c, 0x2ce: 0x8d, 0x2cf: 0x8e, + 0x2d0: 0x8f, 0x2d1: 0x89, 0x2d2: 0x8a, 0x2d3: 0x8b, 0x2d4: 0x8c, 0x2d5: 0x8d, 0x2d6: 0x8e, 0x2d7: 0x8f, + 0x2d8: 0x89, 0x2d9: 0x8a, 0x2da: 0x8b, 0x2db: 0x8c, 0x2dc: 0x8d, 0x2dd: 0x8e, 0x2de: 0x90, + // Block 0xc, offset 0x300 + 0x324: 0x1d, 0x325: 0x1e, 0x326: 0x1f, 0x327: 0x20, + 0x328: 0x21, 0x329: 0x22, 0x32a: 0x23, 0x32b: 0x24, 0x32c: 0x91, 0x32d: 0x92, 0x32e: 0x93, + 0x331: 0x94, 0x332: 0x95, 0x333: 0x96, 0x334: 0x97, + 0x338: 0x98, 0x339: 0x99, 0x33a: 0x9a, 0x33b: 0x9b, 0x33e: 0x9c, 0x33f: 0x9d, + // Block 0xd, offset 0x340 + 0x347: 0x9e, + 0x34b: 0x9f, 0x34d: 0xa0, + 0x368: 0xa1, 0x36b: 0xa2, + 0x374: 0xa3, + 0x37a: 0xa4, 0x37b: 0xa5, 0x37d: 0xa6, 0x37e: 0xa7, + // Block 0xe, offset 0x380 + 0x381: 0xa8, 0x382: 0xa9, 0x384: 0xaa, 0x385: 0x84, 0x387: 0xab, + 0x388: 0xac, 0x38b: 0xad, 0x38c: 0xae, 0x38d: 0xaf, + 0x391: 0xb0, 0x392: 0xb1, 0x393: 0xb2, 0x396: 0xb3, 0x397: 0xb4, + 0x398: 0x75, 0x39a: 0xb5, 0x39c: 0xb6, + 0x3a0: 0xb7, 0x3a4: 0xb8, 0x3a5: 0xb9, 0x3a7: 0xba, + 0x3a8: 0xbb, 0x3a9: 0xbc, 0x3aa: 0xbd, + 0x3b0: 0x75, 0x3b5: 0xbe, 0x3b6: 0xbf, + 0x3bd: 0xc0, + // Block 0xf, offset 0x3c0 + 0x3eb: 0xc1, 0x3ec: 0xc2, + 0x3ff: 0xc3, + // Block 0x10, offset 0x400 + 0x432: 0xc4, + // Block 0x11, offset 0x440 + 0x445: 0xc5, 0x446: 0xc6, 0x447: 0xc7, + 0x449: 0xc8, + // Block 0x12, offset 0x480 + 0x480: 0xc9, 0x482: 0xca, 0x484: 0xc2, + 0x48a: 0xcb, 0x48b: 0xcc, + 0x493: 0xcd, + 0x4a3: 0xce, 0x4a5: 0xcf, + // Block 0x13, offset 0x4c0 + 0x4c8: 0xd0, + // Block 0x14, offset 0x500 + 0x520: 0x25, 0x521: 0x26, 0x522: 0x27, 0x523: 0x28, 0x524: 0x29, 0x525: 0x2a, 0x526: 0x2b, 0x527: 0x2c, + 0x528: 0x2d, + // Block 0x15, offset 0x540 + 0x550: 0x0b, 0x551: 0x0c, 0x556: 0x0d, + 0x55b: 0x0e, 0x55d: 0x0f, 0x55e: 0x10, 0x55f: 0x11, + 0x56f: 0x12, +} + +// nfcSparseOffset: 163 entries, 326 bytes +var nfcSparseOffset = []uint16{0x0, 0x5, 0x9, 0xb, 0xd, 0x18, 0x28, 0x2a, 0x2f, 0x3a, 0x49, 0x56, 0x5e, 0x63, 0x68, 0x6a, 0x6e, 0x76, 0x7d, 0x80, 0x88, 0x8c, 0x90, 0x92, 0x94, 0x9d, 0xa1, 0xa8, 0xad, 0xb0, 0xba, 0xbd, 0xc4, 0xcc, 0xcf, 0xd1, 0xd4, 0xd6, 0xdb, 0xec, 0xf8, 0xfa, 0x100, 0x102, 0x104, 0x106, 0x108, 0x10a, 0x10c, 0x10f, 0x112, 0x114, 0x117, 0x11a, 0x11e, 0x124, 0x12b, 0x134, 0x136, 0x139, 0x13b, 0x146, 0x14a, 0x158, 0x15b, 0x161, 0x167, 0x172, 0x176, 0x178, 0x17a, 0x17c, 0x17e, 0x180, 0x186, 0x18a, 0x18c, 0x18e, 0x196, 0x19a, 0x19d, 0x19f, 0x1a1, 0x1a4, 0x1a7, 0x1a9, 0x1ab, 0x1ad, 0x1af, 0x1b5, 0x1b8, 0x1ba, 0x1c1, 0x1c7, 0x1cd, 0x1d5, 0x1db, 0x1e1, 0x1e7, 0x1eb, 0x1f9, 0x202, 0x205, 0x208, 0x20a, 0x20d, 0x20f, 0x213, 0x218, 0x21a, 0x21c, 0x221, 0x227, 0x229, 0x22b, 0x22d, 0x233, 0x236, 0x238, 0x23a, 0x23c, 0x242, 0x246, 0x24a, 0x252, 0x259, 0x25c, 0x25f, 0x261, 0x264, 0x26c, 0x270, 0x277, 0x27a, 0x280, 0x282, 0x285, 0x287, 0x28a, 0x28f, 0x291, 0x293, 0x295, 0x297, 0x299, 0x29c, 0x29e, 0x2a0, 0x2a2, 0x2a4, 0x2a6, 0x2a8, 0x2b5, 0x2bf, 0x2c1, 0x2c3, 0x2c9, 0x2cb, 0x2cd, 0x2cf, 0x2d3, 0x2d5, 0x2d8} + +// nfcSparseValues: 730 entries, 2920 bytes +var nfcSparseValues = [730]valueRange{ + // Block 0x0, offset 0x0 + {value: 0x0000, lo: 0x04}, + {value: 0xa100, lo: 0xa8, hi: 0xa8}, + {value: 0x8100, lo: 0xaf, hi: 0xaf}, + {value: 0x8100, lo: 0xb4, hi: 0xb4}, + {value: 0x8100, lo: 0xb8, hi: 0xb8}, + // Block 0x1, offset 0x5 + {value: 0x0091, lo: 0x03}, + {value: 0x4823, lo: 0xa0, hi: 0xa1}, + {value: 0x4855, lo: 0xaf, hi: 0xb0}, + {value: 0xa000, lo: 0xb7, hi: 0xb7}, + // Block 0x2, offset 0x9 + {value: 0x0000, lo: 0x01}, + {value: 0xa000, lo: 0x92, hi: 0x92}, + // Block 0x3, offset 0xb + {value: 0x0000, lo: 0x01}, + {value: 0x8100, lo: 0x98, hi: 0x9d}, + // Block 0x4, offset 0xd + {value: 0x0006, lo: 0x0a}, + {value: 0xa000, lo: 0x81, hi: 0x81}, + {value: 0xa000, lo: 0x85, hi: 0x85}, + {value: 0xa000, lo: 0x89, hi: 0x89}, + {value: 0x4981, lo: 0x8a, hi: 0x8a}, + {value: 0x499f, lo: 0x8b, hi: 0x8b}, + {value: 0x3808, lo: 0x8c, hi: 0x8c}, + {value: 0x3820, lo: 0x8d, hi: 0x8d}, + {value: 0x49b7, lo: 0x8e, hi: 0x8e}, + {value: 0xa000, lo: 0x92, hi: 0x92}, + {value: 0x383e, lo: 0x93, hi: 0x94}, + // Block 0x5, offset 0x18 + {value: 0x0000, lo: 0x0f}, + {value: 0xa000, lo: 0x83, hi: 0x83}, + {value: 0xa000, lo: 0x87, hi: 0x87}, + {value: 0xa000, lo: 0x8b, hi: 0x8b}, + {value: 0xa000, lo: 0x8d, hi: 0x8d}, + {value: 0x38e6, lo: 0x90, hi: 0x90}, + {value: 0x38f2, lo: 0x91, hi: 0x91}, + {value: 0x38e0, lo: 0x93, hi: 0x93}, + {value: 0xa000, lo: 0x96, hi: 0x96}, + {value: 0x3958, lo: 0x97, hi: 0x97}, + {value: 0x3922, lo: 0x9c, hi: 0x9c}, + {value: 0x390a, lo: 0x9d, hi: 0x9d}, + {value: 0x3934, lo: 0x9e, hi: 0x9e}, + {value: 0xa000, lo: 0xb4, hi: 0xb5}, + {value: 0x395e, lo: 0xb6, hi: 0xb6}, + {value: 0x3964, lo: 0xb7, hi: 0xb7}, + // Block 0x6, offset 0x28 + {value: 0x0000, lo: 0x01}, + {value: 0x8133, lo: 0x83, hi: 0x87}, + // Block 0x7, offset 0x2a + {value: 0x0001, lo: 0x04}, + {value: 0x8114, lo: 0x81, hi: 0x82}, + {value: 0x8133, lo: 0x84, hi: 0x84}, + {value: 0x812e, lo: 0x85, hi: 0x85}, + {value: 0x810e, lo: 0x87, hi: 0x87}, + // Block 0x8, offset 0x2f + {value: 0x0000, lo: 0x0a}, + {value: 0x8133, lo: 0x90, hi: 0x97}, + {value: 0x811a, lo: 0x98, hi: 0x98}, + {value: 0x811b, lo: 0x99, hi: 0x99}, + {value: 0x811c, lo: 0x9a, hi: 0x9a}, + {value: 0x3982, lo: 0xa2, hi: 0xa2}, + {value: 0x3988, lo: 0xa3, hi: 0xa3}, + {value: 0x3994, lo: 0xa4, hi: 0xa4}, + {value: 0x398e, lo: 0xa5, hi: 0xa5}, + {value: 0x399a, lo: 0xa6, hi: 0xa6}, + {value: 0xa000, lo: 0xa7, hi: 0xa7}, + // Block 0x9, offset 0x3a + {value: 0x0000, lo: 0x0e}, + {value: 0x39ac, lo: 0x80, hi: 0x80}, + {value: 0xa000, lo: 0x81, hi: 0x81}, + {value: 0x39a0, lo: 0x82, hi: 0x82}, + {value: 0xa000, lo: 0x92, hi: 0x92}, + {value: 0x39a6, lo: 0x93, hi: 0x93}, + {value: 0xa000, lo: 0x95, hi: 0x95}, + {value: 0x8133, lo: 0x96, hi: 0x9c}, + {value: 0x8133, lo: 0x9f, hi: 0xa2}, + {value: 0x812e, lo: 0xa3, hi: 0xa3}, + {value: 0x8133, lo: 0xa4, hi: 0xa4}, + {value: 0x8133, lo: 0xa7, hi: 0xa8}, + {value: 0x812e, lo: 0xaa, hi: 0xaa}, + {value: 0x8133, lo: 0xab, hi: 0xac}, + {value: 0x812e, lo: 0xad, hi: 0xad}, + // Block 0xa, offset 0x49 + {value: 0x0000, lo: 0x0c}, + {value: 0x8120, lo: 0x91, hi: 0x91}, + {value: 0x8133, lo: 0xb0, hi: 0xb0}, + {value: 0x812e, lo: 0xb1, hi: 0xb1}, + {value: 0x8133, lo: 0xb2, hi: 0xb3}, + {value: 0x812e, lo: 0xb4, hi: 0xb4}, + {value: 0x8133, lo: 0xb5, hi: 0xb6}, + {value: 0x812e, lo: 0xb7, hi: 0xb9}, + {value: 0x8133, lo: 0xba, hi: 0xba}, + {value: 0x812e, lo: 0xbb, hi: 0xbc}, + {value: 0x8133, lo: 0xbd, hi: 0xbd}, + {value: 0x812e, lo: 0xbe, hi: 0xbe}, + {value: 0x8133, lo: 0xbf, hi: 0xbf}, + // Block 0xb, offset 0x56 + {value: 0x0005, lo: 0x07}, + {value: 0x8133, lo: 0x80, hi: 0x80}, + {value: 0x8133, lo: 0x81, hi: 0x81}, + {value: 0x812e, lo: 0x82, hi: 0x83}, + {value: 0x812e, lo: 0x84, hi: 0x85}, + {value: 0x812e, lo: 0x86, hi: 0x87}, + {value: 0x812e, lo: 0x88, hi: 0x89}, + {value: 0x8133, lo: 0x8a, hi: 0x8a}, + // Block 0xc, offset 0x5e + {value: 0x0000, lo: 0x04}, + {value: 0x8133, lo: 0xab, hi: 0xb1}, + {value: 0x812e, lo: 0xb2, hi: 0xb2}, + {value: 0x8133, lo: 0xb3, hi: 0xb3}, + {value: 0x812e, lo: 0xbd, hi: 0xbd}, + // Block 0xd, offset 0x63 + {value: 0x0000, lo: 0x04}, + {value: 0x8133, lo: 0x96, hi: 0x99}, + {value: 0x8133, lo: 0x9b, hi: 0xa3}, + {value: 0x8133, lo: 0xa5, hi: 0xa7}, + {value: 0x8133, lo: 0xa9, hi: 0xad}, + // Block 0xe, offset 0x68 + {value: 0x0000, lo: 0x01}, + {value: 0x812e, lo: 0x99, hi: 0x9b}, + // Block 0xf, offset 0x6a + {value: 0x0000, lo: 0x03}, + {value: 0x8133, lo: 0x98, hi: 0x98}, + {value: 0x812e, lo: 0x99, hi: 0x9b}, + {value: 0x8133, lo: 0x9c, hi: 0x9f}, + // Block 0x10, offset 0x6e + {value: 0x0000, lo: 0x07}, + {value: 0xa000, lo: 0xa8, hi: 0xa8}, + {value: 0x4019, lo: 0xa9, hi: 0xa9}, + {value: 0xa000, lo: 0xb0, hi: 0xb0}, + {value: 0x4021, lo: 0xb1, hi: 0xb1}, + {value: 0xa000, lo: 0xb3, hi: 0xb3}, + {value: 0x4029, lo: 0xb4, hi: 0xb4}, + {value: 0x9903, lo: 0xbc, hi: 0xbc}, + // Block 0x11, offset 0x76 + {value: 0x0008, lo: 0x06}, + {value: 0x8105, lo: 0x8d, hi: 0x8d}, + {value: 0x8133, lo: 0x91, hi: 0x91}, + {value: 0x812e, lo: 0x92, hi: 0x92}, + {value: 0x8133, lo: 0x93, hi: 0x93}, + {value: 0x8133, lo: 0x94, hi: 0x94}, + {value: 0x465d, lo: 0x98, hi: 0x9f}, + // Block 0x12, offset 0x7d + {value: 0x0000, lo: 0x02}, + {value: 0x8103, lo: 0xbc, hi: 0xbc}, + {value: 0x9900, lo: 0xbe, hi: 0xbe}, + // Block 0x13, offset 0x80 + {value: 0x0008, lo: 0x07}, + {value: 0xa000, lo: 0x87, hi: 0x87}, + {value: 0x2dd5, lo: 0x8b, hi: 0x8c}, + {value: 0x8105, lo: 0x8d, hi: 0x8d}, + {value: 0x9900, lo: 0x97, hi: 0x97}, + {value: 0x469d, lo: 0x9c, hi: 0x9d}, + {value: 0x46ad, lo: 0x9f, hi: 0x9f}, + {value: 0x8133, lo: 0xbe, hi: 0xbe}, + // Block 0x14, offset 0x88 + {value: 0x0000, lo: 0x03}, + {value: 0x46d5, lo: 0xb3, hi: 0xb3}, + {value: 0x46dd, lo: 0xb6, hi: 0xb6}, + {value: 0x8103, lo: 0xbc, hi: 0xbc}, + // Block 0x15, offset 0x8c + {value: 0x0008, lo: 0x03}, + {value: 0x8105, lo: 0x8d, hi: 0x8d}, + {value: 0x46b5, lo: 0x99, hi: 0x9b}, + {value: 0x46cd, lo: 0x9e, hi: 0x9e}, + // Block 0x16, offset 0x90 + {value: 0x0000, lo: 0x01}, + {value: 0x8103, lo: 0xbc, hi: 0xbc}, + // Block 0x17, offset 0x92 + {value: 0x0000, lo: 0x01}, + {value: 0x8105, lo: 0x8d, hi: 0x8d}, + // Block 0x18, offset 0x94 + {value: 0x0000, lo: 0x08}, + {value: 0xa000, lo: 0x87, hi: 0x87}, + {value: 0x2ded, lo: 0x88, hi: 0x88}, + {value: 0x2de5, lo: 0x8b, hi: 0x8b}, + {value: 0x2df5, lo: 0x8c, hi: 0x8c}, + {value: 0x8105, lo: 0x8d, hi: 0x8d}, + {value: 0x9900, lo: 0x96, hi: 0x97}, + {value: 0x46e5, lo: 0x9c, hi: 0x9c}, + {value: 0x46ed, lo: 0x9d, hi: 0x9d}, + // Block 0x19, offset 0x9d + {value: 0x0000, lo: 0x03}, + {value: 0xa000, lo: 0x92, hi: 0x92}, + {value: 0x2dfd, lo: 0x94, hi: 0x94}, + {value: 0x9900, lo: 0xbe, hi: 0xbe}, + // Block 0x1a, offset 0xa1 + {value: 0x0000, lo: 0x06}, + {value: 0xa000, lo: 0x86, hi: 0x87}, + {value: 0x2e05, lo: 0x8a, hi: 0x8a}, + {value: 0x2e15, lo: 0x8b, hi: 0x8b}, + {value: 0x2e0d, lo: 0x8c, hi: 0x8c}, + {value: 0x8105, lo: 0x8d, hi: 0x8d}, + {value: 0x9900, lo: 0x97, hi: 0x97}, + // Block 0x1b, offset 0xa8 + {value: 0x1801, lo: 0x04}, + {value: 0xa000, lo: 0x86, hi: 0x86}, + {value: 0x4031, lo: 0x88, hi: 0x88}, + {value: 0x8105, lo: 0x8d, hi: 0x8d}, + {value: 0x8121, lo: 0x95, hi: 0x96}, + // Block 0x1c, offset 0xad + {value: 0x0000, lo: 0x02}, + {value: 0x8103, lo: 0xbc, hi: 0xbc}, + {value: 0xa000, lo: 0xbf, hi: 0xbf}, + // Block 0x1d, offset 0xb0 + {value: 0x0000, lo: 0x09}, + {value: 0x2e1d, lo: 0x80, hi: 0x80}, + {value: 0x9900, lo: 0x82, hi: 0x82}, + {value: 0xa000, lo: 0x86, hi: 0x86}, + {value: 0x2e25, lo: 0x87, hi: 0x87}, + {value: 0x2e2d, lo: 0x88, hi: 0x88}, + {value: 0x3091, lo: 0x8a, hi: 0x8a}, + {value: 0x2f19, lo: 0x8b, hi: 0x8b}, + {value: 0x8105, lo: 0x8d, hi: 0x8d}, + {value: 0x9900, lo: 0x95, hi: 0x96}, + // Block 0x1e, offset 0xba + {value: 0x0000, lo: 0x02}, + {value: 0x8105, lo: 0xbb, hi: 0xbc}, + {value: 0x9900, lo: 0xbe, hi: 0xbe}, + // Block 0x1f, offset 0xbd + {value: 0x0000, lo: 0x06}, + {value: 0xa000, lo: 0x86, hi: 0x87}, + {value: 0x2e35, lo: 0x8a, hi: 0x8a}, + {value: 0x2e45, lo: 0x8b, hi: 0x8b}, + {value: 0x2e3d, lo: 0x8c, hi: 0x8c}, + {value: 0x8105, lo: 0x8d, hi: 0x8d}, + {value: 0x9900, lo: 0x97, hi: 0x97}, + // Block 0x20, offset 0xc4 + {value: 0x6ab3, lo: 0x07}, + {value: 0x9905, lo: 0x8a, hi: 0x8a}, + {value: 0x9900, lo: 0x8f, hi: 0x8f}, + {value: 0xa000, lo: 0x99, hi: 0x99}, + {value: 0x4039, lo: 0x9a, hi: 0x9a}, + {value: 0x3099, lo: 0x9c, hi: 0x9c}, + {value: 0x2f24, lo: 0x9d, hi: 0x9d}, + {value: 0x2e4d, lo: 0x9e, hi: 0x9f}, + // Block 0x21, offset 0xcc + {value: 0x0000, lo: 0x02}, + {value: 0x8123, lo: 0xb8, hi: 0xb9}, + {value: 0x8105, lo: 0xba, hi: 0xba}, + // Block 0x22, offset 0xcf + {value: 0x0000, lo: 0x01}, + {value: 0x8124, lo: 0x88, hi: 0x8b}, + // Block 0x23, offset 0xd1 + {value: 0x0000, lo: 0x02}, + {value: 0x8125, lo: 0xb8, hi: 0xb9}, + {value: 0x8105, lo: 0xba, hi: 0xba}, + // Block 0x24, offset 0xd4 + {value: 0x0000, lo: 0x01}, + {value: 0x8126, lo: 0x88, hi: 0x8b}, + // Block 0x25, offset 0xd6 + {value: 0x0000, lo: 0x04}, + {value: 0x812e, lo: 0x98, hi: 0x99}, + {value: 0x812e, lo: 0xb5, hi: 0xb5}, + {value: 0x812e, lo: 0xb7, hi: 0xb7}, + {value: 0x812c, lo: 0xb9, hi: 0xb9}, + // Block 0x26, offset 0xdb + {value: 0x0000, lo: 0x10}, + {value: 0x2774, lo: 0x83, hi: 0x83}, + {value: 0x277b, lo: 0x8d, hi: 0x8d}, + {value: 0x2782, lo: 0x92, hi: 0x92}, + {value: 0x2789, lo: 0x97, hi: 0x97}, + {value: 0x2790, lo: 0x9c, hi: 0x9c}, + {value: 0x276d, lo: 0xa9, hi: 0xa9}, + {value: 0x8127, lo: 0xb1, hi: 0xb1}, + {value: 0x8128, lo: 0xb2, hi: 0xb2}, + {value: 0x4bc5, lo: 0xb3, hi: 0xb3}, + {value: 0x8129, lo: 0xb4, hi: 0xb4}, + {value: 0x4bce, lo: 0xb5, hi: 0xb5}, + {value: 0x46f5, lo: 0xb6, hi: 0xb6}, + {value: 0x8200, lo: 0xb7, hi: 0xb7}, + {value: 0x46fd, lo: 0xb8, hi: 0xb8}, + {value: 0x8200, lo: 0xb9, hi: 0xb9}, + {value: 0x8128, lo: 0xba, hi: 0xbd}, + // Block 0x27, offset 0xec + {value: 0x0000, lo: 0x0b}, + {value: 0x8128, lo: 0x80, hi: 0x80}, + {value: 0x4bd7, lo: 0x81, hi: 0x81}, + {value: 0x8133, lo: 0x82, hi: 0x83}, + {value: 0x8105, lo: 0x84, hi: 0x84}, + {value: 0x8133, lo: 0x86, hi: 0x87}, + {value: 0x279e, lo: 0x93, hi: 0x93}, + {value: 0x27a5, lo: 0x9d, hi: 0x9d}, + {value: 0x27ac, lo: 0xa2, hi: 0xa2}, + {value: 0x27b3, lo: 0xa7, hi: 0xa7}, + {value: 0x27ba, lo: 0xac, hi: 0xac}, + {value: 0x2797, lo: 0xb9, hi: 0xb9}, + // Block 0x28, offset 0xf8 + {value: 0x0000, lo: 0x01}, + {value: 0x812e, lo: 0x86, hi: 0x86}, + // Block 0x29, offset 0xfa + {value: 0x0000, lo: 0x05}, + {value: 0xa000, lo: 0xa5, hi: 0xa5}, + {value: 0x2e55, lo: 0xa6, hi: 0xa6}, + {value: 0x9900, lo: 0xae, hi: 0xae}, + {value: 0x8103, lo: 0xb7, hi: 0xb7}, + {value: 0x8105, lo: 0xb9, hi: 0xba}, + // Block 0x2a, offset 0x100 + {value: 0x0000, lo: 0x01}, + {value: 0x812e, lo: 0x8d, hi: 0x8d}, + // Block 0x2b, offset 0x102 + {value: 0x0000, lo: 0x01}, + {value: 0xa000, lo: 0x80, hi: 0x92}, + // Block 0x2c, offset 0x104 + {value: 0x0000, lo: 0x01}, + {value: 0xb900, lo: 0xa1, hi: 0xb5}, + // Block 0x2d, offset 0x106 + {value: 0x0000, lo: 0x01}, + {value: 0x9900, lo: 0xa8, hi: 0xbf}, + // Block 0x2e, offset 0x108 + {value: 0x0000, lo: 0x01}, + {value: 0x9900, lo: 0x80, hi: 0x82}, + // Block 0x2f, offset 0x10a + {value: 0x0000, lo: 0x01}, + {value: 0x8133, lo: 0x9d, hi: 0x9f}, + // Block 0x30, offset 0x10c + {value: 0x0000, lo: 0x02}, + {value: 0x8105, lo: 0x94, hi: 0x95}, + {value: 0x8105, lo: 0xb4, hi: 0xb4}, + // Block 0x31, offset 0x10f + {value: 0x0000, lo: 0x02}, + {value: 0x8105, lo: 0x92, hi: 0x92}, + {value: 0x8133, lo: 0x9d, hi: 0x9d}, + // Block 0x32, offset 0x112 + {value: 0x0000, lo: 0x01}, + {value: 0x8132, lo: 0xa9, hi: 0xa9}, + // Block 0x33, offset 0x114 + {value: 0x0004, lo: 0x02}, + {value: 0x812f, lo: 0xb9, hi: 0xba}, + {value: 0x812e, lo: 0xbb, hi: 0xbb}, + // Block 0x34, offset 0x117 + {value: 0x0000, lo: 0x02}, + {value: 0x8133, lo: 0x97, hi: 0x97}, + {value: 0x812e, lo: 0x98, hi: 0x98}, + // Block 0x35, offset 0x11a + {value: 0x0000, lo: 0x03}, + {value: 0x8105, lo: 0xa0, hi: 0xa0}, + {value: 0x8133, lo: 0xb5, hi: 0xbc}, + {value: 0x812e, lo: 0xbf, hi: 0xbf}, + // Block 0x36, offset 0x11e + {value: 0x0000, lo: 0x05}, + {value: 0x8133, lo: 0xb0, hi: 0xb4}, + {value: 0x812e, lo: 0xb5, hi: 0xba}, + {value: 0x8133, lo: 0xbb, hi: 0xbc}, + {value: 0x812e, lo: 0xbd, hi: 0xbd}, + {value: 0x812e, lo: 0xbf, hi: 0xbf}, + // Block 0x37, offset 0x124 + {value: 0x0000, lo: 0x06}, + {value: 0x812e, lo: 0x80, hi: 0x80}, + {value: 0x8133, lo: 0x81, hi: 0x82}, + {value: 0x812e, lo: 0x83, hi: 0x84}, + {value: 0x8133, lo: 0x85, hi: 0x89}, + {value: 0x812e, lo: 0x8a, hi: 0x8a}, + {value: 0x8133, lo: 0x8b, hi: 0x8e}, + // Block 0x38, offset 0x12b + {value: 0x0000, lo: 0x08}, + {value: 0x2e9d, lo: 0x80, hi: 0x80}, + {value: 0x2ea5, lo: 0x81, hi: 0x81}, + {value: 0xa000, lo: 0x82, hi: 0x82}, + {value: 0x2ead, lo: 0x83, hi: 0x83}, + {value: 0x8105, lo: 0x84, hi: 0x84}, + {value: 0x8133, lo: 0xab, hi: 0xab}, + {value: 0x812e, lo: 0xac, hi: 0xac}, + {value: 0x8133, lo: 0xad, hi: 0xb3}, + // Block 0x39, offset 0x134 + {value: 0x0000, lo: 0x01}, + {value: 0x8105, lo: 0xaa, hi: 0xab}, + // Block 0x3a, offset 0x136 + {value: 0x0000, lo: 0x02}, + {value: 0x8103, lo: 0xa6, hi: 0xa6}, + {value: 0x8105, lo: 0xb2, hi: 0xb3}, + // Block 0x3b, offset 0x139 + {value: 0x0000, lo: 0x01}, + {value: 0x8103, lo: 0xb7, hi: 0xb7}, + // Block 0x3c, offset 0x13b + {value: 0x0000, lo: 0x0a}, + {value: 0x8133, lo: 0x90, hi: 0x92}, + {value: 0x8101, lo: 0x94, hi: 0x94}, + {value: 0x812e, lo: 0x95, hi: 0x99}, + {value: 0x8133, lo: 0x9a, hi: 0x9b}, + {value: 0x812e, lo: 0x9c, hi: 0x9f}, + {value: 0x8133, lo: 0xa0, hi: 0xa0}, + {value: 0x8101, lo: 0xa2, hi: 0xa8}, + {value: 0x812e, lo: 0xad, hi: 0xad}, + {value: 0x8133, lo: 0xb4, hi: 0xb4}, + {value: 0x8133, lo: 0xb8, hi: 0xb9}, + // Block 0x3d, offset 0x146 + {value: 0x0004, lo: 0x03}, + {value: 0x052a, lo: 0x80, hi: 0x81}, + {value: 0x8100, lo: 0x97, hi: 0x97}, + {value: 0x8100, lo: 0xbe, hi: 0xbe}, + // Block 0x3e, offset 0x14a + {value: 0x0000, lo: 0x0d}, + {value: 0x8133, lo: 0x90, hi: 0x91}, + {value: 0x8101, lo: 0x92, hi: 0x93}, + {value: 0x8133, lo: 0x94, hi: 0x97}, + {value: 0x8101, lo: 0x98, hi: 0x9a}, + {value: 0x8133, lo: 0x9b, hi: 0x9c}, + {value: 0x8133, lo: 0xa1, hi: 0xa1}, + {value: 0x8101, lo: 0xa5, hi: 0xa6}, + {value: 0x8133, lo: 0xa7, hi: 0xa7}, + {value: 0x812e, lo: 0xa8, hi: 0xa8}, + {value: 0x8133, lo: 0xa9, hi: 0xa9}, + {value: 0x8101, lo: 0xaa, hi: 0xab}, + {value: 0x812e, lo: 0xac, hi: 0xaf}, + {value: 0x8133, lo: 0xb0, hi: 0xb0}, + // Block 0x3f, offset 0x158 + {value: 0x43bc, lo: 0x02}, + {value: 0x023c, lo: 0xa6, hi: 0xa6}, + {value: 0x0057, lo: 0xaa, hi: 0xab}, + // Block 0x40, offset 0x15b + {value: 0x0007, lo: 0x05}, + {value: 0xa000, lo: 0x90, hi: 0x90}, + {value: 0xa000, lo: 0x92, hi: 0x92}, + {value: 0xa000, lo: 0x94, hi: 0x94}, + {value: 0x3cfa, lo: 0x9a, hi: 0x9b}, + {value: 0x3d08, lo: 0xae, hi: 0xae}, + // Block 0x41, offset 0x161 + {value: 0x000e, lo: 0x05}, + {value: 0x3d0f, lo: 0x8d, hi: 0x8e}, + {value: 0x3d16, lo: 0x8f, hi: 0x8f}, + {value: 0xa000, lo: 0x90, hi: 0x90}, + {value: 0xa000, lo: 0x92, hi: 0x92}, + {value: 0xa000, lo: 0x94, hi: 0x94}, + // Block 0x42, offset 0x167 + {value: 0x62c7, lo: 0x0a}, + {value: 0xa000, lo: 0x83, hi: 0x83}, + {value: 0x3d24, lo: 0x84, hi: 0x84}, + {value: 0xa000, lo: 0x88, hi: 0x88}, + {value: 0x3d2b, lo: 0x89, hi: 0x89}, + {value: 0xa000, lo: 0x8b, hi: 0x8b}, + {value: 0x3d32, lo: 0x8c, hi: 0x8c}, + {value: 0xa000, lo: 0xa3, hi: 0xa3}, + {value: 0x3d39, lo: 0xa4, hi: 0xa5}, + {value: 0x3d40, lo: 0xa6, hi: 0xa6}, + {value: 0xa000, lo: 0xbc, hi: 0xbc}, + // Block 0x43, offset 0x172 + {value: 0x0007, lo: 0x03}, + {value: 0x3da9, lo: 0xa0, hi: 0xa1}, + {value: 0x3dd3, lo: 0xa2, hi: 0xa3}, + {value: 0x3dfd, lo: 0xaa, hi: 0xad}, + // Block 0x44, offset 0x176 + {value: 0x0004, lo: 0x01}, + {value: 0x0586, lo: 0xa9, hi: 0xaa}, + // Block 0x45, offset 0x178 + {value: 0x0000, lo: 0x01}, + {value: 0x461e, lo: 0x9c, hi: 0x9c}, + // Block 0x46, offset 0x17a + {value: 0x0000, lo: 0x01}, + {value: 0x8133, lo: 0xaf, hi: 0xb1}, + // Block 0x47, offset 0x17c + {value: 0x0000, lo: 0x01}, + {value: 0x8105, lo: 0xbf, hi: 0xbf}, + // Block 0x48, offset 0x17e + {value: 0x0000, lo: 0x01}, + {value: 0x8133, lo: 0xa0, hi: 0xbf}, + // Block 0x49, offset 0x180 + {value: 0x0000, lo: 0x05}, + {value: 0x812d, lo: 0xaa, hi: 0xaa}, + {value: 0x8132, lo: 0xab, hi: 0xab}, + {value: 0x8134, lo: 0xac, hi: 0xac}, + {value: 0x812f, lo: 0xad, hi: 0xad}, + {value: 0x8130, lo: 0xae, hi: 0xaf}, + // Block 0x4a, offset 0x186 + {value: 0x0000, lo: 0x03}, + {value: 0x4be0, lo: 0xb3, hi: 0xb3}, + {value: 0x4be0, lo: 0xb5, hi: 0xb6}, + {value: 0x4be0, lo: 0xba, hi: 0xbf}, + // Block 0x4b, offset 0x18a + {value: 0x0000, lo: 0x01}, + {value: 0x4be0, lo: 0x8f, hi: 0xa3}, + // Block 0x4c, offset 0x18c + {value: 0x0000, lo: 0x01}, + {value: 0x8100, lo: 0xae, hi: 0xbe}, + // Block 0x4d, offset 0x18e + {value: 0x0000, lo: 0x07}, + {value: 0x8100, lo: 0x84, hi: 0x84}, + {value: 0x8100, lo: 0x87, hi: 0x87}, + {value: 0x8100, lo: 0x90, hi: 0x90}, + {value: 0x8100, lo: 0x9e, hi: 0x9e}, + {value: 0x8100, lo: 0xa1, hi: 0xa1}, + {value: 0x8100, lo: 0xb2, hi: 0xb2}, + {value: 0x8100, lo: 0xbb, hi: 0xbb}, + // Block 0x4e, offset 0x196 + {value: 0x0000, lo: 0x03}, + {value: 0x8100, lo: 0x80, hi: 0x80}, + {value: 0x8100, lo: 0x8b, hi: 0x8b}, + {value: 0x8100, lo: 0x8e, hi: 0x8e}, + // Block 0x4f, offset 0x19a + {value: 0x0000, lo: 0x02}, + {value: 0x8133, lo: 0xaf, hi: 0xaf}, + {value: 0x8133, lo: 0xb4, hi: 0xbd}, + // Block 0x50, offset 0x19d + {value: 0x0000, lo: 0x01}, + {value: 0x8133, lo: 0x9e, hi: 0x9f}, + // Block 0x51, offset 0x19f + {value: 0x0000, lo: 0x01}, + {value: 0x8133, lo: 0xb0, hi: 0xb1}, + // Block 0x52, offset 0x1a1 + {value: 0x0000, lo: 0x02}, + {value: 0x8105, lo: 0x86, hi: 0x86}, + {value: 0x8105, lo: 0xac, hi: 0xac}, + // Block 0x53, offset 0x1a4 + {value: 0x0000, lo: 0x02}, + {value: 0x8105, lo: 0x84, hi: 0x84}, + {value: 0x8133, lo: 0xa0, hi: 0xb1}, + // Block 0x54, offset 0x1a7 + {value: 0x0000, lo: 0x01}, + {value: 0x812e, lo: 0xab, hi: 0xad}, + // Block 0x55, offset 0x1a9 + {value: 0x0000, lo: 0x01}, + {value: 0x8105, lo: 0x93, hi: 0x93}, + // Block 0x56, offset 0x1ab + {value: 0x0000, lo: 0x01}, + {value: 0x8103, lo: 0xb3, hi: 0xb3}, + // Block 0x57, offset 0x1ad + {value: 0x0000, lo: 0x01}, + {value: 0x8105, lo: 0x80, hi: 0x80}, + // Block 0x58, offset 0x1af + {value: 0x0000, lo: 0x05}, + {value: 0x8133, lo: 0xb0, hi: 0xb0}, + {value: 0x8133, lo: 0xb2, hi: 0xb3}, + {value: 0x812e, lo: 0xb4, hi: 0xb4}, + {value: 0x8133, lo: 0xb7, hi: 0xb8}, + {value: 0x8133, lo: 0xbe, hi: 0xbf}, + // Block 0x59, offset 0x1b5 + {value: 0x0000, lo: 0x02}, + {value: 0x8133, lo: 0x81, hi: 0x81}, + {value: 0x8105, lo: 0xb6, hi: 0xb6}, + // Block 0x5a, offset 0x1b8 + {value: 0x0000, lo: 0x01}, + {value: 0x8105, lo: 0xad, hi: 0xad}, + // Block 0x5b, offset 0x1ba + {value: 0x0000, lo: 0x06}, + {value: 0xe500, lo: 0x80, hi: 0x80}, + {value: 0xc600, lo: 0x81, hi: 0x9b}, + {value: 0xe500, lo: 0x9c, hi: 0x9c}, + {value: 0xc600, lo: 0x9d, hi: 0xb7}, + {value: 0xe500, lo: 0xb8, hi: 0xb8}, + {value: 0xc600, lo: 0xb9, hi: 0xbf}, + // Block 0x5c, offset 0x1c1 + {value: 0x0000, lo: 0x05}, + {value: 0xc600, lo: 0x80, hi: 0x93}, + {value: 0xe500, lo: 0x94, hi: 0x94}, + {value: 0xc600, lo: 0x95, hi: 0xaf}, + {value: 0xe500, lo: 0xb0, hi: 0xb0}, + {value: 0xc600, lo: 0xb1, hi: 0xbf}, + // Block 0x5d, offset 0x1c7 + {value: 0x0000, lo: 0x05}, + {value: 0xc600, lo: 0x80, hi: 0x8b}, + {value: 0xe500, lo: 0x8c, hi: 0x8c}, + {value: 0xc600, lo: 0x8d, hi: 0xa7}, + {value: 0xe500, lo: 0xa8, hi: 0xa8}, + {value: 0xc600, lo: 0xa9, hi: 0xbf}, + // Block 0x5e, offset 0x1cd + {value: 0x0000, lo: 0x07}, + {value: 0xc600, lo: 0x80, hi: 0x83}, + {value: 0xe500, lo: 0x84, hi: 0x84}, + {value: 0xc600, lo: 0x85, hi: 0x9f}, + {value: 0xe500, lo: 0xa0, hi: 0xa0}, + {value: 0xc600, lo: 0xa1, hi: 0xbb}, + {value: 0xe500, lo: 0xbc, hi: 0xbc}, + {value: 0xc600, lo: 0xbd, hi: 0xbf}, + // Block 0x5f, offset 0x1d5 + {value: 0x0000, lo: 0x05}, + {value: 0xc600, lo: 0x80, hi: 0x97}, + {value: 0xe500, lo: 0x98, hi: 0x98}, + {value: 0xc600, lo: 0x99, hi: 0xb3}, + {value: 0xe500, lo: 0xb4, hi: 0xb4}, + {value: 0xc600, lo: 0xb5, hi: 0xbf}, + // Block 0x60, offset 0x1db + {value: 0x0000, lo: 0x05}, + {value: 0xc600, lo: 0x80, hi: 0x8f}, + {value: 0xe500, lo: 0x90, hi: 0x90}, + {value: 0xc600, lo: 0x91, hi: 0xab}, + {value: 0xe500, lo: 0xac, hi: 0xac}, + {value: 0xc600, lo: 0xad, hi: 0xbf}, + // Block 0x61, offset 0x1e1 + {value: 0x0000, lo: 0x05}, + {value: 0xc600, lo: 0x80, hi: 0x87}, + {value: 0xe500, lo: 0x88, hi: 0x88}, + {value: 0xc600, lo: 0x89, hi: 0xa3}, + {value: 0xe500, lo: 0xa4, hi: 0xa4}, + {value: 0xc600, lo: 0xa5, hi: 0xbf}, + // Block 0x62, offset 0x1e7 + {value: 0x0000, lo: 0x03}, + {value: 0xc600, lo: 0x80, hi: 0x87}, + {value: 0xe500, lo: 0x88, hi: 0x88}, + {value: 0xc600, lo: 0x89, hi: 0xa3}, + // Block 0x63, offset 0x1eb + {value: 0x0006, lo: 0x0d}, + {value: 0x44d1, lo: 0x9d, hi: 0x9d}, + {value: 0x8116, lo: 0x9e, hi: 0x9e}, + {value: 0x4543, lo: 0x9f, hi: 0x9f}, + {value: 0x4531, lo: 0xaa, hi: 0xab}, + {value: 0x4635, lo: 0xac, hi: 0xac}, + {value: 0x463d, lo: 0xad, hi: 0xad}, + {value: 0x4489, lo: 0xae, hi: 0xb1}, + {value: 0x44a7, lo: 0xb2, hi: 0xb4}, + {value: 0x44bf, lo: 0xb5, hi: 0xb6}, + {value: 0x44cb, lo: 0xb8, hi: 0xb8}, + {value: 0x44d7, lo: 0xb9, hi: 0xbb}, + {value: 0x44ef, lo: 0xbc, hi: 0xbc}, + {value: 0x44f5, lo: 0xbe, hi: 0xbe}, + // Block 0x64, offset 0x1f9 + {value: 0x0006, lo: 0x08}, + {value: 0x44fb, lo: 0x80, hi: 0x81}, + {value: 0x4507, lo: 0x83, hi: 0x84}, + {value: 0x4519, lo: 0x86, hi: 0x89}, + {value: 0x453d, lo: 0x8a, hi: 0x8a}, + {value: 0x44b9, lo: 0x8b, hi: 0x8b}, + {value: 0x44a1, lo: 0x8c, hi: 0x8c}, + {value: 0x44e9, lo: 0x8d, hi: 0x8d}, + {value: 0x4513, lo: 0x8e, hi: 0x8e}, + // Block 0x65, offset 0x202 + {value: 0x0000, lo: 0x02}, + {value: 0x8100, lo: 0xa4, hi: 0xa5}, + {value: 0x8100, lo: 0xb0, hi: 0xb1}, + // Block 0x66, offset 0x205 + {value: 0x0000, lo: 0x02}, + {value: 0x8100, lo: 0x9b, hi: 0x9d}, + {value: 0x8200, lo: 0x9e, hi: 0xa3}, + // Block 0x67, offset 0x208 + {value: 0x0000, lo: 0x01}, + {value: 0x8100, lo: 0x90, hi: 0x90}, + // Block 0x68, offset 0x20a + {value: 0x0000, lo: 0x02}, + {value: 0x8100, lo: 0x99, hi: 0x99}, + {value: 0x8200, lo: 0xb2, hi: 0xb4}, + // Block 0x69, offset 0x20d + {value: 0x0000, lo: 0x01}, + {value: 0x8100, lo: 0xbc, hi: 0xbd}, + // Block 0x6a, offset 0x20f + {value: 0x0000, lo: 0x03}, + {value: 0x8133, lo: 0xa0, hi: 0xa6}, + {value: 0x812e, lo: 0xa7, hi: 0xad}, + {value: 0x8133, lo: 0xae, hi: 0xaf}, + // Block 0x6b, offset 0x213 + {value: 0x0000, lo: 0x04}, + {value: 0x8100, lo: 0x89, hi: 0x8c}, + {value: 0x8100, lo: 0xb0, hi: 0xb2}, + {value: 0x8100, lo: 0xb4, hi: 0xb4}, + {value: 0x8100, lo: 0xb6, hi: 0xbf}, + // Block 0x6c, offset 0x218 + {value: 0x0000, lo: 0x01}, + {value: 0x8100, lo: 0x81, hi: 0x8c}, + // Block 0x6d, offset 0x21a + {value: 0x0000, lo: 0x01}, + {value: 0x8100, lo: 0xb5, hi: 0xba}, + // Block 0x6e, offset 0x21c + {value: 0x0000, lo: 0x04}, + {value: 0x4be0, lo: 0x9e, hi: 0x9f}, + {value: 0x4be0, lo: 0xa3, hi: 0xa3}, + {value: 0x4be0, lo: 0xa5, hi: 0xa6}, + {value: 0x4be0, lo: 0xaa, hi: 0xaf}, + // Block 0x6f, offset 0x221 + {value: 0x0000, lo: 0x05}, + {value: 0x4be0, lo: 0x82, hi: 0x87}, + {value: 0x4be0, lo: 0x8a, hi: 0x8f}, + {value: 0x4be0, lo: 0x92, hi: 0x97}, + {value: 0x4be0, lo: 0x9a, hi: 0x9c}, + {value: 0x8100, lo: 0xa3, hi: 0xa3}, + // Block 0x70, offset 0x227 + {value: 0x0000, lo: 0x01}, + {value: 0x812e, lo: 0xbd, hi: 0xbd}, + // Block 0x71, offset 0x229 + {value: 0x0000, lo: 0x01}, + {value: 0x812e, lo: 0xa0, hi: 0xa0}, + // Block 0x72, offset 0x22b + {value: 0x0000, lo: 0x01}, + {value: 0x8133, lo: 0xb6, hi: 0xba}, + // Block 0x73, offset 0x22d + {value: 0x002d, lo: 0x05}, + {value: 0x812e, lo: 0x8d, hi: 0x8d}, + {value: 0x8133, lo: 0x8f, hi: 0x8f}, + {value: 0x8133, lo: 0xb8, hi: 0xb8}, + {value: 0x8101, lo: 0xb9, hi: 0xba}, + {value: 0x8105, lo: 0xbf, hi: 0xbf}, + // Block 0x74, offset 0x233 + {value: 0x0000, lo: 0x02}, + {value: 0x8133, lo: 0xa5, hi: 0xa5}, + {value: 0x812e, lo: 0xa6, hi: 0xa6}, + // Block 0x75, offset 0x236 + {value: 0x0000, lo: 0x01}, + {value: 0x8133, lo: 0xa4, hi: 0xa7}, + // Block 0x76, offset 0x238 + {value: 0x0000, lo: 0x01}, + {value: 0x8133, lo: 0xab, hi: 0xac}, + // Block 0x77, offset 0x23a + {value: 0x0000, lo: 0x01}, + {value: 0x812e, lo: 0xbd, hi: 0xbf}, + // Block 0x78, offset 0x23c + {value: 0x0000, lo: 0x05}, + {value: 0x812e, lo: 0x86, hi: 0x87}, + {value: 0x8133, lo: 0x88, hi: 0x8a}, + {value: 0x812e, lo: 0x8b, hi: 0x8b}, + {value: 0x8133, lo: 0x8c, hi: 0x8c}, + {value: 0x812e, lo: 0x8d, hi: 0x90}, + // Block 0x79, offset 0x242 + {value: 0x0005, lo: 0x03}, + {value: 0x8133, lo: 0x82, hi: 0x82}, + {value: 0x812e, lo: 0x83, hi: 0x84}, + {value: 0x812e, lo: 0x85, hi: 0x85}, + // Block 0x7a, offset 0x246 + {value: 0x0000, lo: 0x03}, + {value: 0x8105, lo: 0x86, hi: 0x86}, + {value: 0x8105, lo: 0xb0, hi: 0xb0}, + {value: 0x8105, lo: 0xbf, hi: 0xbf}, + // Block 0x7b, offset 0x24a + {value: 0x17fe, lo: 0x07}, + {value: 0xa000, lo: 0x99, hi: 0x99}, + {value: 0x4379, lo: 0x9a, hi: 0x9a}, + {value: 0xa000, lo: 0x9b, hi: 0x9b}, + {value: 0x4383, lo: 0x9c, hi: 0x9c}, + {value: 0xa000, lo: 0xa5, hi: 0xa5}, + {value: 0x438d, lo: 0xab, hi: 0xab}, + {value: 0x8105, lo: 0xb9, hi: 0xba}, + // Block 0x7c, offset 0x252 + {value: 0x0000, lo: 0x06}, + {value: 0x8133, lo: 0x80, hi: 0x82}, + {value: 0x9900, lo: 0xa7, hi: 0xa7}, + {value: 0x2eb5, lo: 0xae, hi: 0xae}, + {value: 0x2ebf, lo: 0xaf, hi: 0xaf}, + {value: 0xa000, lo: 0xb1, hi: 0xb2}, + {value: 0x8105, lo: 0xb3, hi: 0xb4}, + // Block 0x7d, offset 0x259 + {value: 0x0000, lo: 0x02}, + {value: 0x8105, lo: 0x80, hi: 0x80}, + {value: 0x8103, lo: 0x8a, hi: 0x8a}, + // Block 0x7e, offset 0x25c + {value: 0x0000, lo: 0x02}, + {value: 0x8105, lo: 0xb5, hi: 0xb5}, + {value: 0x8103, lo: 0xb6, hi: 0xb6}, + // Block 0x7f, offset 0x25f + {value: 0x0002, lo: 0x01}, + {value: 0x8103, lo: 0xa9, hi: 0xaa}, + // Block 0x80, offset 0x261 + {value: 0x0000, lo: 0x02}, + {value: 0x8103, lo: 0xbb, hi: 0xbc}, + {value: 0x9900, lo: 0xbe, hi: 0xbe}, + // Block 0x81, offset 0x264 + {value: 0x0000, lo: 0x07}, + {value: 0xa000, lo: 0x87, hi: 0x87}, + {value: 0x2ec9, lo: 0x8b, hi: 0x8b}, + {value: 0x2ed3, lo: 0x8c, hi: 0x8c}, + {value: 0x8105, lo: 0x8d, hi: 0x8d}, + {value: 0x9900, lo: 0x97, hi: 0x97}, + {value: 0x8133, lo: 0xa6, hi: 0xac}, + {value: 0x8133, lo: 0xb0, hi: 0xb4}, + // Block 0x82, offset 0x26c + {value: 0x0000, lo: 0x03}, + {value: 0x8105, lo: 0x82, hi: 0x82}, + {value: 0x8103, lo: 0x86, hi: 0x86}, + {value: 0x8133, lo: 0x9e, hi: 0x9e}, + // Block 0x83, offset 0x270 + {value: 0x6a23, lo: 0x06}, + {value: 0x9900, lo: 0xb0, hi: 0xb0}, + {value: 0xa000, lo: 0xb9, hi: 0xb9}, + {value: 0x9900, lo: 0xba, hi: 0xba}, + {value: 0x2ee7, lo: 0xbb, hi: 0xbb}, + {value: 0x2edd, lo: 0xbc, hi: 0xbd}, + {value: 0x2ef1, lo: 0xbe, hi: 0xbe}, + // Block 0x84, offset 0x277 + {value: 0x0000, lo: 0x02}, + {value: 0x8105, lo: 0x82, hi: 0x82}, + {value: 0x8103, lo: 0x83, hi: 0x83}, + // Block 0x85, offset 0x27a + {value: 0x0000, lo: 0x05}, + {value: 0x9900, lo: 0xaf, hi: 0xaf}, + {value: 0xa000, lo: 0xb8, hi: 0xb9}, + {value: 0x2efb, lo: 0xba, hi: 0xba}, + {value: 0x2f05, lo: 0xbb, hi: 0xbb}, + {value: 0x8105, lo: 0xbf, hi: 0xbf}, + // Block 0x86, offset 0x280 + {value: 0x0000, lo: 0x01}, + {value: 0x8103, lo: 0x80, hi: 0x80}, + // Block 0x87, offset 0x282 + {value: 0x0000, lo: 0x02}, + {value: 0x8105, lo: 0xb6, hi: 0xb6}, + {value: 0x8103, lo: 0xb7, hi: 0xb7}, + // Block 0x88, offset 0x285 + {value: 0x0000, lo: 0x01}, + {value: 0x8105, lo: 0xab, hi: 0xab}, + // Block 0x89, offset 0x287 + {value: 0x0000, lo: 0x02}, + {value: 0x8105, lo: 0xb9, hi: 0xb9}, + {value: 0x8103, lo: 0xba, hi: 0xba}, + // Block 0x8a, offset 0x28a + {value: 0x0000, lo: 0x04}, + {value: 0x9900, lo: 0xb0, hi: 0xb0}, + {value: 0xa000, lo: 0xb5, hi: 0xb5}, + {value: 0x2f0f, lo: 0xb8, hi: 0xb8}, + {value: 0x8105, lo: 0xbd, hi: 0xbe}, + // Block 0x8b, offset 0x28f + {value: 0x0000, lo: 0x01}, + {value: 0x8103, lo: 0x83, hi: 0x83}, + // Block 0x8c, offset 0x291 + {value: 0x0000, lo: 0x01}, + {value: 0x8105, lo: 0xa0, hi: 0xa0}, + // Block 0x8d, offset 0x293 + {value: 0x0000, lo: 0x01}, + {value: 0x8105, lo: 0xb4, hi: 0xb4}, + // Block 0x8e, offset 0x295 + {value: 0x0000, lo: 0x01}, + {value: 0x8105, lo: 0x87, hi: 0x87}, + // Block 0x8f, offset 0x297 + {value: 0x0000, lo: 0x01}, + {value: 0x8105, lo: 0x99, hi: 0x99}, + // Block 0x90, offset 0x299 + {value: 0x0000, lo: 0x02}, + {value: 0x8103, lo: 0x82, hi: 0x82}, + {value: 0x8105, lo: 0x84, hi: 0x85}, + // Block 0x91, offset 0x29c + {value: 0x0000, lo: 0x01}, + {value: 0x8105, lo: 0x97, hi: 0x97}, + // Block 0x92, offset 0x29e + {value: 0x0000, lo: 0x01}, + {value: 0x8105, lo: 0x81, hi: 0x82}, + // Block 0x93, offset 0x2a0 + {value: 0x0000, lo: 0x01}, + {value: 0x8101, lo: 0xb0, hi: 0xb4}, + // Block 0x94, offset 0x2a2 + {value: 0x0000, lo: 0x01}, + {value: 0x8133, lo: 0xb0, hi: 0xb6}, + // Block 0x95, offset 0x2a4 + {value: 0x0000, lo: 0x01}, + {value: 0x8102, lo: 0xb0, hi: 0xb1}, + // Block 0x96, offset 0x2a6 + {value: 0x0000, lo: 0x01}, + {value: 0x8101, lo: 0x9e, hi: 0x9e}, + // Block 0x97, offset 0x2a8 + {value: 0x0000, lo: 0x0c}, + {value: 0x470d, lo: 0x9e, hi: 0x9e}, + {value: 0x4717, lo: 0x9f, hi: 0x9f}, + {value: 0x474b, lo: 0xa0, hi: 0xa0}, + {value: 0x4759, lo: 0xa1, hi: 0xa1}, + {value: 0x4767, lo: 0xa2, hi: 0xa2}, + {value: 0x4775, lo: 0xa3, hi: 0xa3}, + {value: 0x4783, lo: 0xa4, hi: 0xa4}, + {value: 0x812c, lo: 0xa5, hi: 0xa6}, + {value: 0x8101, lo: 0xa7, hi: 0xa9}, + {value: 0x8131, lo: 0xad, hi: 0xad}, + {value: 0x812c, lo: 0xae, hi: 0xb2}, + {value: 0x812e, lo: 0xbb, hi: 0xbf}, + // Block 0x98, offset 0x2b5 + {value: 0x0000, lo: 0x09}, + {value: 0x812e, lo: 0x80, hi: 0x82}, + {value: 0x8133, lo: 0x85, hi: 0x89}, + {value: 0x812e, lo: 0x8a, hi: 0x8b}, + {value: 0x8133, lo: 0xaa, hi: 0xad}, + {value: 0x4721, lo: 0xbb, hi: 0xbb}, + {value: 0x472b, lo: 0xbc, hi: 0xbc}, + {value: 0x4791, lo: 0xbd, hi: 0xbd}, + {value: 0x47ad, lo: 0xbe, hi: 0xbe}, + {value: 0x479f, lo: 0xbf, hi: 0xbf}, + // Block 0x99, offset 0x2bf + {value: 0x0000, lo: 0x01}, + {value: 0x47bb, lo: 0x80, hi: 0x80}, + // Block 0x9a, offset 0x2c1 + {value: 0x0000, lo: 0x01}, + {value: 0x8133, lo: 0x82, hi: 0x84}, + // Block 0x9b, offset 0x2c3 + {value: 0x0000, lo: 0x05}, + {value: 0x8133, lo: 0x80, hi: 0x86}, + {value: 0x8133, lo: 0x88, hi: 0x98}, + {value: 0x8133, lo: 0x9b, hi: 0xa1}, + {value: 0x8133, lo: 0xa3, hi: 0xa4}, + {value: 0x8133, lo: 0xa6, hi: 0xaa}, + // Block 0x9c, offset 0x2c9 + {value: 0x0000, lo: 0x01}, + {value: 0x8133, lo: 0x8f, hi: 0x8f}, + // Block 0x9d, offset 0x2cb + {value: 0x0000, lo: 0x01}, + {value: 0x8133, lo: 0xae, hi: 0xae}, + // Block 0x9e, offset 0x2cd + {value: 0x0000, lo: 0x01}, + {value: 0x8133, lo: 0xac, hi: 0xaf}, + // Block 0x9f, offset 0x2cf + {value: 0x0000, lo: 0x03}, + {value: 0x8134, lo: 0xac, hi: 0xad}, + {value: 0x812e, lo: 0xae, hi: 0xae}, + {value: 0x8133, lo: 0xaf, hi: 0xaf}, + // Block 0xa0, offset 0x2d3 + {value: 0x0000, lo: 0x01}, + {value: 0x812e, lo: 0x90, hi: 0x96}, + // Block 0xa1, offset 0x2d5 + {value: 0x0000, lo: 0x02}, + {value: 0x8133, lo: 0x84, hi: 0x89}, + {value: 0x8103, lo: 0x8a, hi: 0x8a}, + // Block 0xa2, offset 0x2d8 + {value: 0x0000, lo: 0x01}, + {value: 0x8100, lo: 0x93, hi: 0x93}, +} + +// lookup returns the trie value for the first UTF-8 encoding in s and +// the width in bytes of this encoding. The size will be 0 if s does not +// hold enough bytes to complete the encoding. len(s) must be greater than 0. +func (t *nfkcTrie) lookup(s []byte) (v uint16, sz int) { + c0 := s[0] + switch { + case c0 < 0x80: // is ASCII + return nfkcValues[c0], 1 + case c0 < 0xC2: + return 0, 1 // Illegal UTF-8: not a starter, not ASCII. + case c0 < 0xE0: // 2-byte UTF-8 + if len(s) < 2 { + return 0, 0 + } + i := nfkcIndex[c0] + c1 := s[1] + if c1 < 0x80 || 0xC0 <= c1 { + return 0, 1 // Illegal UTF-8: not a continuation byte. + } + return t.lookupValue(uint32(i), c1), 2 + case c0 < 0xF0: // 3-byte UTF-8 + if len(s) < 3 { + return 0, 0 + } + i := nfkcIndex[c0] + c1 := s[1] + if c1 < 0x80 || 0xC0 <= c1 { + return 0, 1 // Illegal UTF-8: not a continuation byte. + } + o := uint32(i)<<6 + uint32(c1) + i = nfkcIndex[o] + c2 := s[2] + if c2 < 0x80 || 0xC0 <= c2 { + return 0, 2 // Illegal UTF-8: not a continuation byte. + } + return t.lookupValue(uint32(i), c2), 3 + case c0 < 0xF8: // 4-byte UTF-8 + if len(s) < 4 { + return 0, 0 + } + i := nfkcIndex[c0] + c1 := s[1] + if c1 < 0x80 || 0xC0 <= c1 { + return 0, 1 // Illegal UTF-8: not a continuation byte. + } + o := uint32(i)<<6 + uint32(c1) + i = nfkcIndex[o] + c2 := s[2] + if c2 < 0x80 || 0xC0 <= c2 { + return 0, 2 // Illegal UTF-8: not a continuation byte. + } + o = uint32(i)<<6 + uint32(c2) + i = nfkcIndex[o] + c3 := s[3] + if c3 < 0x80 || 0xC0 <= c3 { + return 0, 3 // Illegal UTF-8: not a continuation byte. + } + return t.lookupValue(uint32(i), c3), 4 + } + // Illegal rune + return 0, 1 +} + +// lookupUnsafe returns the trie value for the first UTF-8 encoding in s. +// s must start with a full and valid UTF-8 encoded rune. +func (t *nfkcTrie) lookupUnsafe(s []byte) uint16 { + c0 := s[0] + if c0 < 0x80 { // is ASCII + return nfkcValues[c0] + } + i := nfkcIndex[c0] + if c0 < 0xE0 { // 2-byte UTF-8 + return t.lookupValue(uint32(i), s[1]) + } + i = nfkcIndex[uint32(i)<<6+uint32(s[1])] + if c0 < 0xF0 { // 3-byte UTF-8 + return t.lookupValue(uint32(i), s[2]) + } + i = nfkcIndex[uint32(i)<<6+uint32(s[2])] + if c0 < 0xF8 { // 4-byte UTF-8 + return t.lookupValue(uint32(i), s[3]) + } + return 0 +} + +// lookupString returns the trie value for the first UTF-8 encoding in s and +// the width in bytes of this encoding. The size will be 0 if s does not +// hold enough bytes to complete the encoding. len(s) must be greater than 0. +func (t *nfkcTrie) lookupString(s string) (v uint16, sz int) { + c0 := s[0] + switch { + case c0 < 0x80: // is ASCII + return nfkcValues[c0], 1 + case c0 < 0xC2: + return 0, 1 // Illegal UTF-8: not a starter, not ASCII. + case c0 < 0xE0: // 2-byte UTF-8 + if len(s) < 2 { + return 0, 0 + } + i := nfkcIndex[c0] + c1 := s[1] + if c1 < 0x80 || 0xC0 <= c1 { + return 0, 1 // Illegal UTF-8: not a continuation byte. + } + return t.lookupValue(uint32(i), c1), 2 + case c0 < 0xF0: // 3-byte UTF-8 + if len(s) < 3 { + return 0, 0 + } + i := nfkcIndex[c0] + c1 := s[1] + if c1 < 0x80 || 0xC0 <= c1 { + return 0, 1 // Illegal UTF-8: not a continuation byte. + } + o := uint32(i)<<6 + uint32(c1) + i = nfkcIndex[o] + c2 := s[2] + if c2 < 0x80 || 0xC0 <= c2 { + return 0, 2 // Illegal UTF-8: not a continuation byte. + } + return t.lookupValue(uint32(i), c2), 3 + case c0 < 0xF8: // 4-byte UTF-8 + if len(s) < 4 { + return 0, 0 + } + i := nfkcIndex[c0] + c1 := s[1] + if c1 < 0x80 || 0xC0 <= c1 { + return 0, 1 // Illegal UTF-8: not a continuation byte. + } + o := uint32(i)<<6 + uint32(c1) + i = nfkcIndex[o] + c2 := s[2] + if c2 < 0x80 || 0xC0 <= c2 { + return 0, 2 // Illegal UTF-8: not a continuation byte. + } + o = uint32(i)<<6 + uint32(c2) + i = nfkcIndex[o] + c3 := s[3] + if c3 < 0x80 || 0xC0 <= c3 { + return 0, 3 // Illegal UTF-8: not a continuation byte. + } + return t.lookupValue(uint32(i), c3), 4 + } + // Illegal rune + return 0, 1 +} + +// lookupStringUnsafe returns the trie value for the first UTF-8 encoding in s. +// s must start with a full and valid UTF-8 encoded rune. +func (t *nfkcTrie) lookupStringUnsafe(s string) uint16 { + c0 := s[0] + if c0 < 0x80 { // is ASCII + return nfkcValues[c0] + } + i := nfkcIndex[c0] + if c0 < 0xE0 { // 2-byte UTF-8 + return t.lookupValue(uint32(i), s[1]) + } + i = nfkcIndex[uint32(i)<<6+uint32(s[1])] + if c0 < 0xF0 { // 3-byte UTF-8 + return t.lookupValue(uint32(i), s[2]) + } + i = nfkcIndex[uint32(i)<<6+uint32(s[2])] + if c0 < 0xF8 { // 4-byte UTF-8 + return t.lookupValue(uint32(i), s[3]) + } + return 0 +} + +// nfkcTrie. Total size: 19260 bytes (18.81 KiB). Checksum: 1a0bbc4c8c24da49. +type nfkcTrie struct{} + +func newNfkcTrie(i int) *nfkcTrie { + return &nfkcTrie{} +} + +// lookupValue determines the type of block n and looks up the value for b. +func (t *nfkcTrie) lookupValue(n uint32, b byte) uint16 { + switch { + case n < 95: + return uint16(nfkcValues[n<<6+uint32(b)]) + default: + n -= 95 + return uint16(nfkcSparse.lookup(n, b)) + } +} + +// nfkcValues: 97 blocks, 6208 entries, 12416 bytes +// The third block is the zero block. +var nfkcValues = [6208]uint16{ + // Block 0x0, offset 0x0 + 0x3c: 0xa000, 0x3d: 0xa000, 0x3e: 0xa000, + // Block 0x1, offset 0x40 + 0x41: 0xa000, 0x42: 0xa000, 0x43: 0xa000, 0x44: 0xa000, 0x45: 0xa000, + 0x46: 0xa000, 0x47: 0xa000, 0x48: 0xa000, 0x49: 0xa000, 0x4a: 0xa000, 0x4b: 0xa000, + 0x4c: 0xa000, 0x4d: 0xa000, 0x4e: 0xa000, 0x4f: 0xa000, 0x50: 0xa000, + 0x52: 0xa000, 0x53: 0xa000, 0x54: 0xa000, 0x55: 0xa000, 0x56: 0xa000, 0x57: 0xa000, + 0x58: 0xa000, 0x59: 0xa000, 0x5a: 0xa000, + 0x61: 0xa000, 0x62: 0xa000, 0x63: 0xa000, + 0x64: 0xa000, 0x65: 0xa000, 0x66: 0xa000, 0x67: 0xa000, 0x68: 0xa000, 0x69: 0xa000, + 0x6a: 0xa000, 0x6b: 0xa000, 0x6c: 0xa000, 0x6d: 0xa000, 0x6e: 0xa000, 0x6f: 0xa000, + 0x70: 0xa000, 0x72: 0xa000, 0x73: 0xa000, 0x74: 0xa000, 0x75: 0xa000, + 0x76: 0xa000, 0x77: 0xa000, 0x78: 0xa000, 0x79: 0xa000, 0x7a: 0xa000, + // Block 0x2, offset 0x80 + // Block 0x3, offset 0xc0 + 0xc0: 0x30b0, 0xc1: 0x30b5, 0xc2: 0x47c9, 0xc3: 0x30ba, 0xc4: 0x47d8, 0xc5: 0x47dd, + 0xc6: 0xa000, 0xc7: 0x47e7, 0xc8: 0x3123, 0xc9: 0x3128, 0xca: 0x47ec, 0xcb: 0x313c, + 0xcc: 0x31af, 0xcd: 0x31b4, 0xce: 0x31b9, 0xcf: 0x4800, 0xd1: 0x3245, + 0xd2: 0x3268, 0xd3: 0x326d, 0xd4: 0x480a, 0xd5: 0x480f, 0xd6: 0x481e, + 0xd8: 0xa000, 0xd9: 0x32f4, 0xda: 0x32f9, 0xdb: 0x32fe, 0xdc: 0x4850, 0xdd: 0x3376, + 0xe0: 0x33bc, 0xe1: 0x33c1, 0xe2: 0x485a, 0xe3: 0x33c6, + 0xe4: 0x4869, 0xe5: 0x486e, 0xe6: 0xa000, 0xe7: 0x4878, 0xe8: 0x342f, 0xe9: 0x3434, + 0xea: 0x487d, 0xeb: 0x3448, 0xec: 0x34c0, 0xed: 0x34c5, 0xee: 0x34ca, 0xef: 0x4891, + 0xf1: 0x3556, 0xf2: 0x3579, 0xf3: 0x357e, 0xf4: 0x489b, 0xf5: 0x48a0, + 0xf6: 0x48af, 0xf8: 0xa000, 0xf9: 0x360a, 0xfa: 0x360f, 0xfb: 0x3614, + 0xfc: 0x48e1, 0xfd: 0x3691, 0xff: 0x36aa, + // Block 0x4, offset 0x100 + 0x100: 0x30bf, 0x101: 0x33cb, 0x102: 0x47ce, 0x103: 0x485f, 0x104: 0x30dd, 0x105: 0x33e9, + 0x106: 0x30f1, 0x107: 0x33fd, 0x108: 0x30f6, 0x109: 0x3402, 0x10a: 0x30fb, 0x10b: 0x3407, + 0x10c: 0x3100, 0x10d: 0x340c, 0x10e: 0x310a, 0x10f: 0x3416, + 0x112: 0x47f1, 0x113: 0x4882, 0x114: 0x3132, 0x115: 0x343e, 0x116: 0x3137, 0x117: 0x3443, + 0x118: 0x3155, 0x119: 0x3461, 0x11a: 0x3146, 0x11b: 0x3452, 0x11c: 0x316e, 0x11d: 0x347a, + 0x11e: 0x3178, 0x11f: 0x3484, 0x120: 0x317d, 0x121: 0x3489, 0x122: 0x3187, 0x123: 0x3493, + 0x124: 0x318c, 0x125: 0x3498, 0x128: 0x31be, 0x129: 0x34cf, + 0x12a: 0x31c3, 0x12b: 0x34d4, 0x12c: 0x31c8, 0x12d: 0x34d9, 0x12e: 0x31eb, 0x12f: 0x34f7, + 0x130: 0x31cd, 0x132: 0x1a8a, 0x133: 0x1b17, 0x134: 0x31f5, 0x135: 0x3501, + 0x136: 0x3209, 0x137: 0x351a, 0x139: 0x3213, 0x13a: 0x3524, 0x13b: 0x321d, + 0x13c: 0x352e, 0x13d: 0x3218, 0x13e: 0x3529, 0x13f: 0x1cdc, + // Block 0x5, offset 0x140 + 0x140: 0x1d64, 0x143: 0x3240, 0x144: 0x3551, 0x145: 0x3259, + 0x146: 0x356a, 0x147: 0x324f, 0x148: 0x3560, 0x149: 0x1d8c, + 0x14c: 0x4814, 0x14d: 0x48a5, 0x14e: 0x3272, 0x14f: 0x3583, 0x150: 0x327c, 0x151: 0x358d, + 0x154: 0x329a, 0x155: 0x35ab, 0x156: 0x32b3, 0x157: 0x35c4, + 0x158: 0x32a4, 0x159: 0x35b5, 0x15a: 0x4837, 0x15b: 0x48c8, 0x15c: 0x32bd, 0x15d: 0x35ce, + 0x15e: 0x32cc, 0x15f: 0x35dd, 0x160: 0x483c, 0x161: 0x48cd, 0x162: 0x32e5, 0x163: 0x35fb, + 0x164: 0x32d6, 0x165: 0x35ec, 0x168: 0x4846, 0x169: 0x48d7, + 0x16a: 0x484b, 0x16b: 0x48dc, 0x16c: 0x3303, 0x16d: 0x3619, 0x16e: 0x330d, 0x16f: 0x3623, + 0x170: 0x3312, 0x171: 0x3628, 0x172: 0x3330, 0x173: 0x3646, 0x174: 0x3353, 0x175: 0x3669, + 0x176: 0x337b, 0x177: 0x3696, 0x178: 0x338f, 0x179: 0x339e, 0x17a: 0x36be, 0x17b: 0x33a8, + 0x17c: 0x36c8, 0x17d: 0x33ad, 0x17e: 0x36cd, 0x17f: 0x00a7, + // Block 0x6, offset 0x180 + 0x184: 0x2f2f, 0x185: 0x2f35, + 0x186: 0x2f3b, 0x187: 0x1a9f, 0x188: 0x1aa2, 0x189: 0x1b38, 0x18a: 0x1ab7, 0x18b: 0x1aba, + 0x18c: 0x1b6e, 0x18d: 0x30c9, 0x18e: 0x33d5, 0x18f: 0x31d7, 0x190: 0x34e3, 0x191: 0x3281, + 0x192: 0x3592, 0x193: 0x3317, 0x194: 0x362d, 0x195: 0x3b10, 0x196: 0x3c9f, 0x197: 0x3b09, + 0x198: 0x3c98, 0x199: 0x3b17, 0x19a: 0x3ca6, 0x19b: 0x3b02, 0x19c: 0x3c91, + 0x19e: 0x39f1, 0x19f: 0x3b80, 0x1a0: 0x39ea, 0x1a1: 0x3b79, 0x1a2: 0x36f4, 0x1a3: 0x3706, + 0x1a6: 0x3182, 0x1a7: 0x348e, 0x1a8: 0x31ff, 0x1a9: 0x3510, + 0x1aa: 0x482d, 0x1ab: 0x48be, 0x1ac: 0x3ad1, 0x1ad: 0x3c60, 0x1ae: 0x3718, 0x1af: 0x371e, + 0x1b0: 0x3506, 0x1b1: 0x1a6f, 0x1b2: 0x1a72, 0x1b3: 0x1aff, 0x1b4: 0x3169, 0x1b5: 0x3475, + 0x1b8: 0x323b, 0x1b9: 0x354c, 0x1ba: 0x39f8, 0x1bb: 0x3b87, + 0x1bc: 0x36ee, 0x1bd: 0x3700, 0x1be: 0x36fa, 0x1bf: 0x370c, + // Block 0x7, offset 0x1c0 + 0x1c0: 0x30ce, 0x1c1: 0x33da, 0x1c2: 0x30d3, 0x1c3: 0x33df, 0x1c4: 0x314b, 0x1c5: 0x3457, + 0x1c6: 0x3150, 0x1c7: 0x345c, 0x1c8: 0x31dc, 0x1c9: 0x34e8, 0x1ca: 0x31e1, 0x1cb: 0x34ed, + 0x1cc: 0x3286, 0x1cd: 0x3597, 0x1ce: 0x328b, 0x1cf: 0x359c, 0x1d0: 0x32a9, 0x1d1: 0x35ba, + 0x1d2: 0x32ae, 0x1d3: 0x35bf, 0x1d4: 0x331c, 0x1d5: 0x3632, 0x1d6: 0x3321, 0x1d7: 0x3637, + 0x1d8: 0x32c7, 0x1d9: 0x35d8, 0x1da: 0x32e0, 0x1db: 0x35f6, + 0x1de: 0x319b, 0x1df: 0x34a7, + 0x1e6: 0x47d3, 0x1e7: 0x4864, 0x1e8: 0x47fb, 0x1e9: 0x488c, + 0x1ea: 0x3aa0, 0x1eb: 0x3c2f, 0x1ec: 0x3a7d, 0x1ed: 0x3c0c, 0x1ee: 0x4819, 0x1ef: 0x48aa, + 0x1f0: 0x3a99, 0x1f1: 0x3c28, 0x1f2: 0x3385, 0x1f3: 0x36a0, + // Block 0x8, offset 0x200 + 0x200: 0x9933, 0x201: 0x9933, 0x202: 0x9933, 0x203: 0x9933, 0x204: 0x9933, 0x205: 0x8133, + 0x206: 0x9933, 0x207: 0x9933, 0x208: 0x9933, 0x209: 0x9933, 0x20a: 0x9933, 0x20b: 0x9933, + 0x20c: 0x9933, 0x20d: 0x8133, 0x20e: 0x8133, 0x20f: 0x9933, 0x210: 0x8133, 0x211: 0x9933, + 0x212: 0x8133, 0x213: 0x9933, 0x214: 0x9933, 0x215: 0x8134, 0x216: 0x812e, 0x217: 0x812e, + 0x218: 0x812e, 0x219: 0x812e, 0x21a: 0x8134, 0x21b: 0x992c, 0x21c: 0x812e, 0x21d: 0x812e, + 0x21e: 0x812e, 0x21f: 0x812e, 0x220: 0x812e, 0x221: 0x812a, 0x222: 0x812a, 0x223: 0x992e, + 0x224: 0x992e, 0x225: 0x992e, 0x226: 0x992e, 0x227: 0x992a, 0x228: 0x992a, 0x229: 0x812e, + 0x22a: 0x812e, 0x22b: 0x812e, 0x22c: 0x812e, 0x22d: 0x992e, 0x22e: 0x992e, 0x22f: 0x812e, + 0x230: 0x992e, 0x231: 0x992e, 0x232: 0x812e, 0x233: 0x812e, 0x234: 0x8101, 0x235: 0x8101, + 0x236: 0x8101, 0x237: 0x8101, 0x238: 0x9901, 0x239: 0x812e, 0x23a: 0x812e, 0x23b: 0x812e, + 0x23c: 0x812e, 0x23d: 0x8133, 0x23e: 0x8133, 0x23f: 0x8133, + // Block 0x9, offset 0x240 + 0x240: 0x4aef, 0x241: 0x4af4, 0x242: 0x9933, 0x243: 0x4af9, 0x244: 0x4bb2, 0x245: 0x9937, + 0x246: 0x8133, 0x247: 0x812e, 0x248: 0x812e, 0x249: 0x812e, 0x24a: 0x8133, 0x24b: 0x8133, + 0x24c: 0x8133, 0x24d: 0x812e, 0x24e: 0x812e, 0x250: 0x8133, 0x251: 0x8133, + 0x252: 0x8133, 0x253: 0x812e, 0x254: 0x812e, 0x255: 0x812e, 0x256: 0x812e, 0x257: 0x8133, + 0x258: 0x8134, 0x259: 0x812e, 0x25a: 0x812e, 0x25b: 0x8133, 0x25c: 0x8135, 0x25d: 0x8136, + 0x25e: 0x8136, 0x25f: 0x8135, 0x260: 0x8136, 0x261: 0x8136, 0x262: 0x8135, 0x263: 0x8133, + 0x264: 0x8133, 0x265: 0x8133, 0x266: 0x8133, 0x267: 0x8133, 0x268: 0x8133, 0x269: 0x8133, + 0x26a: 0x8133, 0x26b: 0x8133, 0x26c: 0x8133, 0x26d: 0x8133, 0x26e: 0x8133, 0x26f: 0x8133, + 0x274: 0x01ee, + 0x27a: 0x43e6, + 0x27e: 0x0037, + // Block 0xa, offset 0x280 + 0x284: 0x439b, 0x285: 0x45bc, + 0x286: 0x372a, 0x287: 0x00ce, 0x288: 0x3748, 0x289: 0x3754, 0x28a: 0x3766, + 0x28c: 0x3784, 0x28e: 0x3796, 0x28f: 0x37b4, 0x290: 0x3f49, 0x291: 0xa000, + 0x295: 0xa000, 0x297: 0xa000, + 0x299: 0xa000, + 0x29f: 0xa000, 0x2a1: 0xa000, + 0x2a5: 0xa000, 0x2a9: 0xa000, + 0x2aa: 0x3778, 0x2ab: 0x37a8, 0x2ac: 0x493f, 0x2ad: 0x37d8, 0x2ae: 0x4969, 0x2af: 0x37ea, + 0x2b0: 0x3fb1, 0x2b1: 0xa000, 0x2b5: 0xa000, + 0x2b7: 0xa000, 0x2b9: 0xa000, + 0x2bf: 0xa000, + // Block 0xb, offset 0x2c0 + 0x2c1: 0xa000, 0x2c5: 0xa000, + 0x2c9: 0xa000, 0x2ca: 0x4981, 0x2cb: 0x499f, + 0x2cc: 0x3808, 0x2cd: 0x3820, 0x2ce: 0x49b7, 0x2d0: 0x0242, 0x2d1: 0x0254, + 0x2d2: 0x0230, 0x2d3: 0x444d, 0x2d4: 0x4453, 0x2d5: 0x027e, 0x2d6: 0x026c, + 0x2f0: 0x025a, 0x2f1: 0x026f, 0x2f2: 0x0272, 0x2f4: 0x020c, 0x2f5: 0x024b, + 0x2f9: 0x022a, + // Block 0xc, offset 0x300 + 0x300: 0x3862, 0x301: 0x386e, 0x303: 0x385c, + 0x306: 0xa000, 0x307: 0x384a, + 0x30c: 0x389e, 0x30d: 0x3886, 0x30e: 0x38b0, 0x310: 0xa000, + 0x313: 0xa000, 0x315: 0xa000, 0x316: 0xa000, 0x317: 0xa000, + 0x318: 0xa000, 0x319: 0x3892, 0x31a: 0xa000, + 0x31e: 0xa000, 0x323: 0xa000, + 0x327: 0xa000, + 0x32b: 0xa000, 0x32d: 0xa000, + 0x330: 0xa000, 0x333: 0xa000, 0x335: 0xa000, + 0x336: 0xa000, 0x337: 0xa000, 0x338: 0xa000, 0x339: 0x3916, 0x33a: 0xa000, + 0x33e: 0xa000, + // Block 0xd, offset 0x340 + 0x341: 0x3874, 0x342: 0x38f8, + 0x350: 0x3850, 0x351: 0x38d4, + 0x352: 0x3856, 0x353: 0x38da, 0x356: 0x3868, 0x357: 0x38ec, + 0x358: 0xa000, 0x359: 0xa000, 0x35a: 0x396a, 0x35b: 0x3970, 0x35c: 0x387a, 0x35d: 0x38fe, + 0x35e: 0x3880, 0x35f: 0x3904, 0x362: 0x388c, 0x363: 0x3910, + 0x364: 0x3898, 0x365: 0x391c, 0x366: 0x38a4, 0x367: 0x3928, 0x368: 0xa000, 0x369: 0xa000, + 0x36a: 0x3976, 0x36b: 0x397c, 0x36c: 0x38ce, 0x36d: 0x3952, 0x36e: 0x38aa, 0x36f: 0x392e, + 0x370: 0x38b6, 0x371: 0x393a, 0x372: 0x38bc, 0x373: 0x3940, 0x374: 0x38c2, 0x375: 0x3946, + 0x378: 0x38c8, 0x379: 0x394c, + // Block 0xe, offset 0x380 + 0x387: 0x1e91, + 0x391: 0x812e, + 0x392: 0x8133, 0x393: 0x8133, 0x394: 0x8133, 0x395: 0x8133, 0x396: 0x812e, 0x397: 0x8133, + 0x398: 0x8133, 0x399: 0x8133, 0x39a: 0x812f, 0x39b: 0x812e, 0x39c: 0x8133, 0x39d: 0x8133, + 0x39e: 0x8133, 0x39f: 0x8133, 0x3a0: 0x8133, 0x3a1: 0x8133, 0x3a2: 0x812e, 0x3a3: 0x812e, + 0x3a4: 0x812e, 0x3a5: 0x812e, 0x3a6: 0x812e, 0x3a7: 0x812e, 0x3a8: 0x8133, 0x3a9: 0x8133, + 0x3aa: 0x812e, 0x3ab: 0x8133, 0x3ac: 0x8133, 0x3ad: 0x812f, 0x3ae: 0x8132, 0x3af: 0x8133, + 0x3b0: 0x8106, 0x3b1: 0x8107, 0x3b2: 0x8108, 0x3b3: 0x8109, 0x3b4: 0x810a, 0x3b5: 0x810b, + 0x3b6: 0x810c, 0x3b7: 0x810d, 0x3b8: 0x810e, 0x3b9: 0x810f, 0x3ba: 0x810f, 0x3bb: 0x8110, + 0x3bc: 0x8111, 0x3bd: 0x8112, 0x3bf: 0x8113, + // Block 0xf, offset 0x3c0 + 0x3c8: 0xa000, 0x3ca: 0xa000, 0x3cb: 0x8117, + 0x3cc: 0x8118, 0x3cd: 0x8119, 0x3ce: 0x811a, 0x3cf: 0x811b, 0x3d0: 0x811c, 0x3d1: 0x811d, + 0x3d2: 0x811e, 0x3d3: 0x9933, 0x3d4: 0x9933, 0x3d5: 0x992e, 0x3d6: 0x812e, 0x3d7: 0x8133, + 0x3d8: 0x8133, 0x3d9: 0x8133, 0x3da: 0x8133, 0x3db: 0x8133, 0x3dc: 0x812e, 0x3dd: 0x8133, + 0x3de: 0x8133, 0x3df: 0x812e, + 0x3f0: 0x811f, 0x3f5: 0x1eb4, + 0x3f6: 0x2143, 0x3f7: 0x217f, 0x3f8: 0x217a, + // Block 0x10, offset 0x400 + 0x40a: 0x8133, 0x40b: 0x8133, + 0x40c: 0x8133, 0x40d: 0x8133, 0x40e: 0x8133, 0x40f: 0x812e, 0x410: 0x812e, 0x411: 0x812e, + 0x412: 0x812e, 0x413: 0x812e, 0x414: 0x8133, 0x415: 0x8133, 0x416: 0x8133, 0x417: 0x8133, + 0x418: 0x8133, 0x419: 0x8133, 0x41a: 0x8133, 0x41b: 0x8133, 0x41c: 0x8133, 0x41d: 0x8133, + 0x41e: 0x8133, 0x41f: 0x8133, 0x420: 0x8133, 0x421: 0x8133, 0x423: 0x812e, + 0x424: 0x8133, 0x425: 0x8133, 0x426: 0x812e, 0x427: 0x8133, 0x428: 0x8133, 0x429: 0x812e, + 0x42a: 0x8133, 0x42b: 0x8133, 0x42c: 0x8133, 0x42d: 0x812e, 0x42e: 0x812e, 0x42f: 0x812e, + 0x430: 0x8117, 0x431: 0x8118, 0x432: 0x8119, 0x433: 0x8133, 0x434: 0x8133, 0x435: 0x8133, + 0x436: 0x812e, 0x437: 0x8133, 0x438: 0x8133, 0x439: 0x812e, 0x43a: 0x812e, 0x43b: 0x8133, + 0x43c: 0x8133, 0x43d: 0x8133, 0x43e: 0x8133, 0x43f: 0x8133, + // Block 0x11, offset 0x440 + 0x445: 0xa000, + 0x446: 0x2e5d, 0x447: 0xa000, 0x448: 0x2e65, 0x449: 0xa000, 0x44a: 0x2e6d, 0x44b: 0xa000, + 0x44c: 0x2e75, 0x44d: 0xa000, 0x44e: 0x2e7d, 0x451: 0xa000, + 0x452: 0x2e85, + 0x474: 0x8103, 0x475: 0x9900, + 0x47a: 0xa000, 0x47b: 0x2e8d, + 0x47c: 0xa000, 0x47d: 0x2e95, 0x47e: 0xa000, 0x47f: 0xa000, + // Block 0x12, offset 0x480 + 0x480: 0x0069, 0x481: 0x006b, 0x482: 0x006f, 0x483: 0x0083, 0x484: 0x0104, 0x485: 0x0107, + 0x486: 0x0506, 0x487: 0x0085, 0x488: 0x0089, 0x489: 0x008b, 0x48a: 0x011f, 0x48b: 0x0122, + 0x48c: 0x0125, 0x48d: 0x008f, 0x48f: 0x0097, 0x490: 0x009b, 0x491: 0x00e6, + 0x492: 0x009f, 0x493: 0x0110, 0x494: 0x050a, 0x495: 0x050e, 0x496: 0x00a1, 0x497: 0x00a9, + 0x498: 0x00ab, 0x499: 0x0516, 0x49a: 0x015b, 0x49b: 0x00ad, 0x49c: 0x051a, 0x49d: 0x0242, + 0x49e: 0x0245, 0x49f: 0x0248, 0x4a0: 0x027e, 0x4a1: 0x0281, 0x4a2: 0x0093, 0x4a3: 0x00a5, + 0x4a4: 0x00ab, 0x4a5: 0x00ad, 0x4a6: 0x0242, 0x4a7: 0x0245, 0x4a8: 0x026f, 0x4a9: 0x027e, + 0x4aa: 0x0281, + 0x4b8: 0x02b4, + // Block 0x13, offset 0x4c0 + 0x4db: 0x010a, 0x4dc: 0x0087, 0x4dd: 0x0113, + 0x4de: 0x00d7, 0x4df: 0x0125, 0x4e0: 0x008d, 0x4e1: 0x012b, 0x4e2: 0x0131, 0x4e3: 0x013d, + 0x4e4: 0x0146, 0x4e5: 0x0149, 0x4e6: 0x014c, 0x4e7: 0x051e, 0x4e8: 0x01c7, 0x4e9: 0x0155, + 0x4ea: 0x0522, 0x4eb: 0x01ca, 0x4ec: 0x0161, 0x4ed: 0x015e, 0x4ee: 0x0164, 0x4ef: 0x0167, + 0x4f0: 0x016a, 0x4f1: 0x016d, 0x4f2: 0x0176, 0x4f3: 0x018e, 0x4f4: 0x0191, 0x4f5: 0x00f2, + 0x4f6: 0x019a, 0x4f7: 0x019d, 0x4f8: 0x0512, 0x4f9: 0x01a0, 0x4fa: 0x01a3, 0x4fb: 0x00b5, + 0x4fc: 0x01af, 0x4fd: 0x01b2, 0x4fe: 0x01b5, 0x4ff: 0x0254, + // Block 0x14, offset 0x500 + 0x500: 0x8133, 0x501: 0x8133, 0x502: 0x812e, 0x503: 0x8133, 0x504: 0x8133, 0x505: 0x8133, + 0x506: 0x8133, 0x507: 0x8133, 0x508: 0x8133, 0x509: 0x8133, 0x50a: 0x812e, 0x50b: 0x8133, + 0x50c: 0x8133, 0x50d: 0x8136, 0x50e: 0x812b, 0x50f: 0x812e, 0x510: 0x812a, 0x511: 0x8133, + 0x512: 0x8133, 0x513: 0x8133, 0x514: 0x8133, 0x515: 0x8133, 0x516: 0x8133, 0x517: 0x8133, + 0x518: 0x8133, 0x519: 0x8133, 0x51a: 0x8133, 0x51b: 0x8133, 0x51c: 0x8133, 0x51d: 0x8133, + 0x51e: 0x8133, 0x51f: 0x8133, 0x520: 0x8133, 0x521: 0x8133, 0x522: 0x8133, 0x523: 0x8133, + 0x524: 0x8133, 0x525: 0x8133, 0x526: 0x8133, 0x527: 0x8133, 0x528: 0x8133, 0x529: 0x8133, + 0x52a: 0x8133, 0x52b: 0x8133, 0x52c: 0x8133, 0x52d: 0x8133, 0x52e: 0x8133, 0x52f: 0x8133, + 0x530: 0x8133, 0x531: 0x8133, 0x532: 0x8133, 0x533: 0x8133, 0x534: 0x8133, 0x535: 0x8133, + 0x536: 0x8134, 0x537: 0x8132, 0x538: 0x8132, 0x539: 0x812e, 0x53a: 0x812d, 0x53b: 0x8133, + 0x53c: 0x8135, 0x53d: 0x812e, 0x53e: 0x8133, 0x53f: 0x812e, + // Block 0x15, offset 0x540 + 0x540: 0x30d8, 0x541: 0x33e4, 0x542: 0x30e2, 0x543: 0x33ee, 0x544: 0x30e7, 0x545: 0x33f3, + 0x546: 0x30ec, 0x547: 0x33f8, 0x548: 0x3a0d, 0x549: 0x3b9c, 0x54a: 0x3105, 0x54b: 0x3411, + 0x54c: 0x310f, 0x54d: 0x341b, 0x54e: 0x311e, 0x54f: 0x342a, 0x550: 0x3114, 0x551: 0x3420, + 0x552: 0x3119, 0x553: 0x3425, 0x554: 0x3a30, 0x555: 0x3bbf, 0x556: 0x3a37, 0x557: 0x3bc6, + 0x558: 0x315a, 0x559: 0x3466, 0x55a: 0x315f, 0x55b: 0x346b, 0x55c: 0x3a45, 0x55d: 0x3bd4, + 0x55e: 0x3164, 0x55f: 0x3470, 0x560: 0x3173, 0x561: 0x347f, 0x562: 0x3191, 0x563: 0x349d, + 0x564: 0x31a0, 0x565: 0x34ac, 0x566: 0x3196, 0x567: 0x34a2, 0x568: 0x31a5, 0x569: 0x34b1, + 0x56a: 0x31aa, 0x56b: 0x34b6, 0x56c: 0x31f0, 0x56d: 0x34fc, 0x56e: 0x3a4c, 0x56f: 0x3bdb, + 0x570: 0x31fa, 0x571: 0x350b, 0x572: 0x3204, 0x573: 0x3515, 0x574: 0x320e, 0x575: 0x351f, + 0x576: 0x4805, 0x577: 0x4896, 0x578: 0x3a53, 0x579: 0x3be2, 0x57a: 0x3227, 0x57b: 0x3538, + 0x57c: 0x3222, 0x57d: 0x3533, 0x57e: 0x322c, 0x57f: 0x353d, + // Block 0x16, offset 0x580 + 0x580: 0x3231, 0x581: 0x3542, 0x582: 0x3236, 0x583: 0x3547, 0x584: 0x324a, 0x585: 0x355b, + 0x586: 0x3254, 0x587: 0x3565, 0x588: 0x3263, 0x589: 0x3574, 0x58a: 0x325e, 0x58b: 0x356f, + 0x58c: 0x3a76, 0x58d: 0x3c05, 0x58e: 0x3a84, 0x58f: 0x3c13, 0x590: 0x3a8b, 0x591: 0x3c1a, + 0x592: 0x3a92, 0x593: 0x3c21, 0x594: 0x3290, 0x595: 0x35a1, 0x596: 0x3295, 0x597: 0x35a6, + 0x598: 0x329f, 0x599: 0x35b0, 0x59a: 0x4832, 0x59b: 0x48c3, 0x59c: 0x3ad8, 0x59d: 0x3c67, + 0x59e: 0x32b8, 0x59f: 0x35c9, 0x5a0: 0x32c2, 0x5a1: 0x35d3, 0x5a2: 0x4841, 0x5a3: 0x48d2, + 0x5a4: 0x3adf, 0x5a5: 0x3c6e, 0x5a6: 0x3ae6, 0x5a7: 0x3c75, 0x5a8: 0x3aed, 0x5a9: 0x3c7c, + 0x5aa: 0x32d1, 0x5ab: 0x35e2, 0x5ac: 0x32db, 0x5ad: 0x35f1, 0x5ae: 0x32ef, 0x5af: 0x3605, + 0x5b0: 0x32ea, 0x5b1: 0x3600, 0x5b2: 0x332b, 0x5b3: 0x3641, 0x5b4: 0x333a, 0x5b5: 0x3650, + 0x5b6: 0x3335, 0x5b7: 0x364b, 0x5b8: 0x3af4, 0x5b9: 0x3c83, 0x5ba: 0x3afb, 0x5bb: 0x3c8a, + 0x5bc: 0x333f, 0x5bd: 0x3655, 0x5be: 0x3344, 0x5bf: 0x365a, + // Block 0x17, offset 0x5c0 + 0x5c0: 0x3349, 0x5c1: 0x365f, 0x5c2: 0x334e, 0x5c3: 0x3664, 0x5c4: 0x335d, 0x5c5: 0x3673, + 0x5c6: 0x3358, 0x5c7: 0x366e, 0x5c8: 0x3362, 0x5c9: 0x367d, 0x5ca: 0x3367, 0x5cb: 0x3682, + 0x5cc: 0x336c, 0x5cd: 0x3687, 0x5ce: 0x338a, 0x5cf: 0x36a5, 0x5d0: 0x33a3, 0x5d1: 0x36c3, + 0x5d2: 0x33b2, 0x5d3: 0x36d2, 0x5d4: 0x33b7, 0x5d5: 0x36d7, 0x5d6: 0x34bb, 0x5d7: 0x35e7, + 0x5d8: 0x3678, 0x5d9: 0x36b4, 0x5da: 0x1d10, 0x5db: 0x4418, + 0x5e0: 0x47e2, 0x5e1: 0x4873, 0x5e2: 0x30c4, 0x5e3: 0x33d0, + 0x5e4: 0x39b9, 0x5e5: 0x3b48, 0x5e6: 0x39b2, 0x5e7: 0x3b41, 0x5e8: 0x39c7, 0x5e9: 0x3b56, + 0x5ea: 0x39c0, 0x5eb: 0x3b4f, 0x5ec: 0x39ff, 0x5ed: 0x3b8e, 0x5ee: 0x39d5, 0x5ef: 0x3b64, + 0x5f0: 0x39ce, 0x5f1: 0x3b5d, 0x5f2: 0x39e3, 0x5f3: 0x3b72, 0x5f4: 0x39dc, 0x5f5: 0x3b6b, + 0x5f6: 0x3a06, 0x5f7: 0x3b95, 0x5f8: 0x47f6, 0x5f9: 0x4887, 0x5fa: 0x3141, 0x5fb: 0x344d, + 0x5fc: 0x312d, 0x5fd: 0x3439, 0x5fe: 0x3a1b, 0x5ff: 0x3baa, + // Block 0x18, offset 0x600 + 0x600: 0x3a14, 0x601: 0x3ba3, 0x602: 0x3a29, 0x603: 0x3bb8, 0x604: 0x3a22, 0x605: 0x3bb1, + 0x606: 0x3a3e, 0x607: 0x3bcd, 0x608: 0x31d2, 0x609: 0x34de, 0x60a: 0x31e6, 0x60b: 0x34f2, + 0x60c: 0x4828, 0x60d: 0x48b9, 0x60e: 0x3277, 0x60f: 0x3588, 0x610: 0x3a61, 0x611: 0x3bf0, + 0x612: 0x3a5a, 0x613: 0x3be9, 0x614: 0x3a6f, 0x615: 0x3bfe, 0x616: 0x3a68, 0x617: 0x3bf7, + 0x618: 0x3aca, 0x619: 0x3c59, 0x61a: 0x3aae, 0x61b: 0x3c3d, 0x61c: 0x3aa7, 0x61d: 0x3c36, + 0x61e: 0x3abc, 0x61f: 0x3c4b, 0x620: 0x3ab5, 0x621: 0x3c44, 0x622: 0x3ac3, 0x623: 0x3c52, + 0x624: 0x3326, 0x625: 0x363c, 0x626: 0x3308, 0x627: 0x361e, 0x628: 0x3b25, 0x629: 0x3cb4, + 0x62a: 0x3b1e, 0x62b: 0x3cad, 0x62c: 0x3b33, 0x62d: 0x3cc2, 0x62e: 0x3b2c, 0x62f: 0x3cbb, + 0x630: 0x3b3a, 0x631: 0x3cc9, 0x632: 0x3371, 0x633: 0x368c, 0x634: 0x3399, 0x635: 0x36b9, + 0x636: 0x3394, 0x637: 0x36af, 0x638: 0x3380, 0x639: 0x369b, + // Block 0x19, offset 0x640 + 0x640: 0x4945, 0x641: 0x494b, 0x642: 0x4a5f, 0x643: 0x4a77, 0x644: 0x4a67, 0x645: 0x4a7f, + 0x646: 0x4a6f, 0x647: 0x4a87, 0x648: 0x48eb, 0x649: 0x48f1, 0x64a: 0x49cf, 0x64b: 0x49e7, + 0x64c: 0x49d7, 0x64d: 0x49ef, 0x64e: 0x49df, 0x64f: 0x49f7, 0x650: 0x4957, 0x651: 0x495d, + 0x652: 0x3ef9, 0x653: 0x3f09, 0x654: 0x3f01, 0x655: 0x3f11, + 0x658: 0x48f7, 0x659: 0x48fd, 0x65a: 0x3e29, 0x65b: 0x3e39, 0x65c: 0x3e31, 0x65d: 0x3e41, + 0x660: 0x496f, 0x661: 0x4975, 0x662: 0x4a8f, 0x663: 0x4aa7, + 0x664: 0x4a97, 0x665: 0x4aaf, 0x666: 0x4a9f, 0x667: 0x4ab7, 0x668: 0x4903, 0x669: 0x4909, + 0x66a: 0x49ff, 0x66b: 0x4a17, 0x66c: 0x4a07, 0x66d: 0x4a1f, 0x66e: 0x4a0f, 0x66f: 0x4a27, + 0x670: 0x4987, 0x671: 0x498d, 0x672: 0x3f59, 0x673: 0x3f71, 0x674: 0x3f61, 0x675: 0x3f79, + 0x676: 0x3f69, 0x677: 0x3f81, 0x678: 0x490f, 0x679: 0x4915, 0x67a: 0x3e59, 0x67b: 0x3e71, + 0x67c: 0x3e61, 0x67d: 0x3e79, 0x67e: 0x3e69, 0x67f: 0x3e81, + // Block 0x1a, offset 0x680 + 0x680: 0x4993, 0x681: 0x4999, 0x682: 0x3f89, 0x683: 0x3f99, 0x684: 0x3f91, 0x685: 0x3fa1, + 0x688: 0x491b, 0x689: 0x4921, 0x68a: 0x3e89, 0x68b: 0x3e99, + 0x68c: 0x3e91, 0x68d: 0x3ea1, 0x690: 0x49a5, 0x691: 0x49ab, + 0x692: 0x3fc1, 0x693: 0x3fd9, 0x694: 0x3fc9, 0x695: 0x3fe1, 0x696: 0x3fd1, 0x697: 0x3fe9, + 0x699: 0x4927, 0x69b: 0x3ea9, 0x69d: 0x3eb1, + 0x69f: 0x3eb9, 0x6a0: 0x49bd, 0x6a1: 0x49c3, 0x6a2: 0x4abf, 0x6a3: 0x4ad7, + 0x6a4: 0x4ac7, 0x6a5: 0x4adf, 0x6a6: 0x4acf, 0x6a7: 0x4ae7, 0x6a8: 0x492d, 0x6a9: 0x4933, + 0x6aa: 0x4a2f, 0x6ab: 0x4a47, 0x6ac: 0x4a37, 0x6ad: 0x4a4f, 0x6ae: 0x4a3f, 0x6af: 0x4a57, + 0x6b0: 0x4939, 0x6b1: 0x445f, 0x6b2: 0x37d2, 0x6b3: 0x4465, 0x6b4: 0x4963, 0x6b5: 0x446b, + 0x6b6: 0x37e4, 0x6b7: 0x4471, 0x6b8: 0x3802, 0x6b9: 0x4477, 0x6ba: 0x381a, 0x6bb: 0x447d, + 0x6bc: 0x49b1, 0x6bd: 0x4483, + // Block 0x1b, offset 0x6c0 + 0x6c0: 0x3ee1, 0x6c1: 0x3ee9, 0x6c2: 0x42c5, 0x6c3: 0x42e3, 0x6c4: 0x42cf, 0x6c5: 0x42ed, + 0x6c6: 0x42d9, 0x6c7: 0x42f7, 0x6c8: 0x3e19, 0x6c9: 0x3e21, 0x6ca: 0x4211, 0x6cb: 0x422f, + 0x6cc: 0x421b, 0x6cd: 0x4239, 0x6ce: 0x4225, 0x6cf: 0x4243, 0x6d0: 0x3f29, 0x6d1: 0x3f31, + 0x6d2: 0x4301, 0x6d3: 0x431f, 0x6d4: 0x430b, 0x6d5: 0x4329, 0x6d6: 0x4315, 0x6d7: 0x4333, + 0x6d8: 0x3e49, 0x6d9: 0x3e51, 0x6da: 0x424d, 0x6db: 0x426b, 0x6dc: 0x4257, 0x6dd: 0x4275, + 0x6de: 0x4261, 0x6df: 0x427f, 0x6e0: 0x4001, 0x6e1: 0x4009, 0x6e2: 0x433d, 0x6e3: 0x435b, + 0x6e4: 0x4347, 0x6e5: 0x4365, 0x6e6: 0x4351, 0x6e7: 0x436f, 0x6e8: 0x3ec1, 0x6e9: 0x3ec9, + 0x6ea: 0x4289, 0x6eb: 0x42a7, 0x6ec: 0x4293, 0x6ed: 0x42b1, 0x6ee: 0x429d, 0x6ef: 0x42bb, + 0x6f0: 0x37c6, 0x6f1: 0x37c0, 0x6f2: 0x3ed1, 0x6f3: 0x37cc, 0x6f4: 0x3ed9, + 0x6f6: 0x4951, 0x6f7: 0x3ef1, 0x6f8: 0x3736, 0x6f9: 0x3730, 0x6fa: 0x3724, 0x6fb: 0x442f, + 0x6fc: 0x373c, 0x6fd: 0x43c8, 0x6fe: 0x0257, 0x6ff: 0x43c8, + // Block 0x1c, offset 0x700 + 0x700: 0x43e1, 0x701: 0x45c3, 0x702: 0x3f19, 0x703: 0x37de, 0x704: 0x3f21, + 0x706: 0x497b, 0x707: 0x3f39, 0x708: 0x3742, 0x709: 0x4435, 0x70a: 0x374e, 0x70b: 0x443b, + 0x70c: 0x375a, 0x70d: 0x45ca, 0x70e: 0x45d1, 0x70f: 0x45d8, 0x710: 0x37f6, 0x711: 0x37f0, + 0x712: 0x3f41, 0x713: 0x4625, 0x716: 0x37fc, 0x717: 0x3f51, + 0x718: 0x3772, 0x719: 0x376c, 0x71a: 0x3760, 0x71b: 0x4441, 0x71d: 0x45df, + 0x71e: 0x45e6, 0x71f: 0x45ed, 0x720: 0x382c, 0x721: 0x3826, 0x722: 0x3fa9, 0x723: 0x462d, + 0x724: 0x380e, 0x725: 0x3814, 0x726: 0x3832, 0x727: 0x3fb9, 0x728: 0x37a2, 0x729: 0x379c, + 0x72a: 0x3790, 0x72b: 0x444d, 0x72c: 0x378a, 0x72d: 0x45b5, 0x72e: 0x45bc, 0x72f: 0x0081, + 0x732: 0x3ff1, 0x733: 0x3838, 0x734: 0x3ff9, + 0x736: 0x49c9, 0x737: 0x4011, 0x738: 0x377e, 0x739: 0x4447, 0x73a: 0x37ae, 0x73b: 0x4459, + 0x73c: 0x37ba, 0x73d: 0x439b, 0x73e: 0x43cd, + // Block 0x1d, offset 0x740 + 0x740: 0x1d08, 0x741: 0x1d0c, 0x742: 0x0047, 0x743: 0x1d84, 0x745: 0x1d18, + 0x746: 0x1d1c, 0x747: 0x00ef, 0x749: 0x1d88, 0x74a: 0x008f, 0x74b: 0x0051, + 0x74c: 0x0051, 0x74d: 0x0051, 0x74e: 0x0091, 0x74f: 0x00e0, 0x750: 0x0053, 0x751: 0x0053, + 0x752: 0x0059, 0x753: 0x0099, 0x755: 0x005d, 0x756: 0x1abd, + 0x759: 0x0061, 0x75a: 0x0063, 0x75b: 0x0065, 0x75c: 0x0065, 0x75d: 0x0065, + 0x760: 0x1acf, 0x761: 0x1cf8, 0x762: 0x1ad8, + 0x764: 0x0075, 0x766: 0x023c, 0x768: 0x0075, + 0x76a: 0x0057, 0x76b: 0x4413, 0x76c: 0x0045, 0x76d: 0x0047, 0x76f: 0x008b, + 0x770: 0x004b, 0x771: 0x004d, 0x773: 0x005b, 0x774: 0x009f, 0x775: 0x0308, + 0x776: 0x030b, 0x777: 0x030e, 0x778: 0x0311, 0x779: 0x0093, 0x77b: 0x1cc8, + 0x77c: 0x026c, 0x77d: 0x0245, 0x77e: 0x01fd, 0x77f: 0x0224, + // Block 0x1e, offset 0x780 + 0x780: 0x055a, 0x785: 0x0049, + 0x786: 0x0089, 0x787: 0x008b, 0x788: 0x0093, 0x789: 0x0095, + 0x790: 0x235e, 0x791: 0x236a, + 0x792: 0x241e, 0x793: 0x2346, 0x794: 0x23ca, 0x795: 0x2352, 0x796: 0x23d0, 0x797: 0x23e8, + 0x798: 0x23f4, 0x799: 0x2358, 0x79a: 0x23fa, 0x79b: 0x2364, 0x79c: 0x23ee, 0x79d: 0x2400, + 0x79e: 0x2406, 0x79f: 0x1dec, 0x7a0: 0x0053, 0x7a1: 0x1a87, 0x7a2: 0x1cd4, 0x7a3: 0x1a90, + 0x7a4: 0x006d, 0x7a5: 0x1adb, 0x7a6: 0x1d00, 0x7a7: 0x1e78, 0x7a8: 0x1a93, 0x7a9: 0x0071, + 0x7aa: 0x1ae7, 0x7ab: 0x1d04, 0x7ac: 0x0059, 0x7ad: 0x0047, 0x7ae: 0x0049, 0x7af: 0x005b, + 0x7b0: 0x0093, 0x7b1: 0x1b14, 0x7b2: 0x1d48, 0x7b3: 0x1b1d, 0x7b4: 0x00ad, 0x7b5: 0x1b92, + 0x7b6: 0x1d7c, 0x7b7: 0x1e8c, 0x7b8: 0x1b20, 0x7b9: 0x00b1, 0x7ba: 0x1b95, 0x7bb: 0x1d80, + 0x7bc: 0x0099, 0x7bd: 0x0087, 0x7be: 0x0089, 0x7bf: 0x009b, + // Block 0x1f, offset 0x7c0 + 0x7c1: 0x3d47, 0x7c3: 0xa000, 0x7c4: 0x3d4e, 0x7c5: 0xa000, + 0x7c7: 0x3d55, 0x7c8: 0xa000, 0x7c9: 0x3d5c, + 0x7cd: 0xa000, + 0x7e0: 0x30a6, 0x7e1: 0xa000, 0x7e2: 0x3d6a, + 0x7e4: 0xa000, 0x7e5: 0xa000, + 0x7ed: 0x3d63, 0x7ee: 0x30a1, 0x7ef: 0x30ab, + 0x7f0: 0x3d71, 0x7f1: 0x3d78, 0x7f2: 0xa000, 0x7f3: 0xa000, 0x7f4: 0x3d7f, 0x7f5: 0x3d86, + 0x7f6: 0xa000, 0x7f7: 0xa000, 0x7f8: 0x3d8d, 0x7f9: 0x3d94, 0x7fa: 0xa000, 0x7fb: 0xa000, + 0x7fc: 0xa000, 0x7fd: 0xa000, + // Block 0x20, offset 0x800 + 0x800: 0x3d9b, 0x801: 0x3da2, 0x802: 0xa000, 0x803: 0xa000, 0x804: 0x3db7, 0x805: 0x3dbe, + 0x806: 0xa000, 0x807: 0xa000, 0x808: 0x3dc5, 0x809: 0x3dcc, + 0x811: 0xa000, + 0x812: 0xa000, + 0x822: 0xa000, + 0x828: 0xa000, 0x829: 0xa000, + 0x82b: 0xa000, 0x82c: 0x3de1, 0x82d: 0x3de8, 0x82e: 0x3def, 0x82f: 0x3df6, + 0x832: 0xa000, 0x833: 0xa000, 0x834: 0xa000, 0x835: 0xa000, + // Block 0x21, offset 0x840 + 0x860: 0x0023, 0x861: 0x0025, 0x862: 0x0027, 0x863: 0x0029, + 0x864: 0x002b, 0x865: 0x002d, 0x866: 0x002f, 0x867: 0x0031, 0x868: 0x0033, 0x869: 0x19af, + 0x86a: 0x19b2, 0x86b: 0x19b5, 0x86c: 0x19b8, 0x86d: 0x19bb, 0x86e: 0x19be, 0x86f: 0x19c1, + 0x870: 0x19c4, 0x871: 0x19c7, 0x872: 0x19ca, 0x873: 0x19d3, 0x874: 0x1b98, 0x875: 0x1b9c, + 0x876: 0x1ba0, 0x877: 0x1ba4, 0x878: 0x1ba8, 0x879: 0x1bac, 0x87a: 0x1bb0, 0x87b: 0x1bb4, + 0x87c: 0x1bb8, 0x87d: 0x1db0, 0x87e: 0x1db5, 0x87f: 0x1dba, + // Block 0x22, offset 0x880 + 0x880: 0x1dbf, 0x881: 0x1dc4, 0x882: 0x1dc9, 0x883: 0x1dce, 0x884: 0x1dd3, 0x885: 0x1dd8, + 0x886: 0x1ddd, 0x887: 0x1de2, 0x888: 0x19ac, 0x889: 0x19d0, 0x88a: 0x19f4, 0x88b: 0x1a18, + 0x88c: 0x1a3c, 0x88d: 0x1a45, 0x88e: 0x1a4b, 0x88f: 0x1a51, 0x890: 0x1a57, 0x891: 0x1c90, + 0x892: 0x1c94, 0x893: 0x1c98, 0x894: 0x1c9c, 0x895: 0x1ca0, 0x896: 0x1ca4, 0x897: 0x1ca8, + 0x898: 0x1cac, 0x899: 0x1cb0, 0x89a: 0x1cb4, 0x89b: 0x1cb8, 0x89c: 0x1c24, 0x89d: 0x1c28, + 0x89e: 0x1c2c, 0x89f: 0x1c30, 0x8a0: 0x1c34, 0x8a1: 0x1c38, 0x8a2: 0x1c3c, 0x8a3: 0x1c40, + 0x8a4: 0x1c44, 0x8a5: 0x1c48, 0x8a6: 0x1c4c, 0x8a7: 0x1c50, 0x8a8: 0x1c54, 0x8a9: 0x1c58, + 0x8aa: 0x1c5c, 0x8ab: 0x1c60, 0x8ac: 0x1c64, 0x8ad: 0x1c68, 0x8ae: 0x1c6c, 0x8af: 0x1c70, + 0x8b0: 0x1c74, 0x8b1: 0x1c78, 0x8b2: 0x1c7c, 0x8b3: 0x1c80, 0x8b4: 0x1c84, 0x8b5: 0x1c88, + 0x8b6: 0x0043, 0x8b7: 0x0045, 0x8b8: 0x0047, 0x8b9: 0x0049, 0x8ba: 0x004b, 0x8bb: 0x004d, + 0x8bc: 0x004f, 0x8bd: 0x0051, 0x8be: 0x0053, 0x8bf: 0x0055, + // Block 0x23, offset 0x8c0 + 0x8c0: 0x07ba, 0x8c1: 0x07de, 0x8c2: 0x07ea, 0x8c3: 0x07fa, 0x8c4: 0x0802, 0x8c5: 0x080e, + 0x8c6: 0x0816, 0x8c7: 0x081e, 0x8c8: 0x082a, 0x8c9: 0x087e, 0x8ca: 0x0896, 0x8cb: 0x08a6, + 0x8cc: 0x08b6, 0x8cd: 0x08c6, 0x8ce: 0x08d6, 0x8cf: 0x08f6, 0x8d0: 0x08fa, 0x8d1: 0x08fe, + 0x8d2: 0x0932, 0x8d3: 0x095a, 0x8d4: 0x096a, 0x8d5: 0x0972, 0x8d6: 0x0976, 0x8d7: 0x0982, + 0x8d8: 0x099e, 0x8d9: 0x09a2, 0x8da: 0x09ba, 0x8db: 0x09be, 0x8dc: 0x09c6, 0x8dd: 0x09d6, + 0x8de: 0x0a72, 0x8df: 0x0a86, 0x8e0: 0x0ac6, 0x8e1: 0x0ada, 0x8e2: 0x0ae2, 0x8e3: 0x0ae6, + 0x8e4: 0x0af6, 0x8e5: 0x0b12, 0x8e6: 0x0b3e, 0x8e7: 0x0b4a, 0x8e8: 0x0b6a, 0x8e9: 0x0b76, + 0x8ea: 0x0b7a, 0x8eb: 0x0b7e, 0x8ec: 0x0b96, 0x8ed: 0x0b9a, 0x8ee: 0x0bc6, 0x8ef: 0x0bd2, + 0x8f0: 0x0bda, 0x8f1: 0x0be2, 0x8f2: 0x0bf2, 0x8f3: 0x0bfa, 0x8f4: 0x0c02, 0x8f5: 0x0c2e, + 0x8f6: 0x0c32, 0x8f7: 0x0c3a, 0x8f8: 0x0c3e, 0x8f9: 0x0c46, 0x8fa: 0x0c4e, 0x8fb: 0x0c5e, + 0x8fc: 0x0c7a, 0x8fd: 0x0cf2, 0x8fe: 0x0d06, 0x8ff: 0x0d0a, + // Block 0x24, offset 0x900 + 0x900: 0x0d8a, 0x901: 0x0d8e, 0x902: 0x0da2, 0x903: 0x0da6, 0x904: 0x0dae, 0x905: 0x0db6, + 0x906: 0x0dbe, 0x907: 0x0dca, 0x908: 0x0df2, 0x909: 0x0e02, 0x90a: 0x0e16, 0x90b: 0x0e86, + 0x90c: 0x0e92, 0x90d: 0x0ea2, 0x90e: 0x0eae, 0x90f: 0x0eba, 0x910: 0x0ec2, 0x911: 0x0ec6, + 0x912: 0x0eca, 0x913: 0x0ece, 0x914: 0x0ed2, 0x915: 0x0f8a, 0x916: 0x0fd2, 0x917: 0x0fde, + 0x918: 0x0fe2, 0x919: 0x0fe6, 0x91a: 0x0fea, 0x91b: 0x0ff2, 0x91c: 0x0ff6, 0x91d: 0x100a, + 0x91e: 0x1026, 0x91f: 0x102e, 0x920: 0x106e, 0x921: 0x1072, 0x922: 0x107a, 0x923: 0x107e, + 0x924: 0x1086, 0x925: 0x108a, 0x926: 0x10ae, 0x927: 0x10b2, 0x928: 0x10ce, 0x929: 0x10d2, + 0x92a: 0x10d6, 0x92b: 0x10da, 0x92c: 0x10ee, 0x92d: 0x1112, 0x92e: 0x1116, 0x92f: 0x111a, + 0x930: 0x113e, 0x931: 0x117e, 0x932: 0x1182, 0x933: 0x11a2, 0x934: 0x11b2, 0x935: 0x11ba, + 0x936: 0x11da, 0x937: 0x11fe, 0x938: 0x1242, 0x939: 0x124a, 0x93a: 0x125e, 0x93b: 0x126a, + 0x93c: 0x1272, 0x93d: 0x127a, 0x93e: 0x127e, 0x93f: 0x1282, + // Block 0x25, offset 0x940 + 0x940: 0x129a, 0x941: 0x129e, 0x942: 0x12ba, 0x943: 0x12c2, 0x944: 0x12ca, 0x945: 0x12ce, + 0x946: 0x12da, 0x947: 0x12e2, 0x948: 0x12e6, 0x949: 0x12ea, 0x94a: 0x12f2, 0x94b: 0x12f6, + 0x94c: 0x1396, 0x94d: 0x13aa, 0x94e: 0x13de, 0x94f: 0x13e2, 0x950: 0x13ea, 0x951: 0x1416, + 0x952: 0x141e, 0x953: 0x1426, 0x954: 0x142e, 0x955: 0x146a, 0x956: 0x146e, 0x957: 0x1476, + 0x958: 0x147a, 0x959: 0x147e, 0x95a: 0x14aa, 0x95b: 0x14ae, 0x95c: 0x14b6, 0x95d: 0x14ca, + 0x95e: 0x14ce, 0x95f: 0x14ea, 0x960: 0x14f2, 0x961: 0x14f6, 0x962: 0x151a, 0x963: 0x153a, + 0x964: 0x154e, 0x965: 0x1552, 0x966: 0x155a, 0x967: 0x1586, 0x968: 0x158a, 0x969: 0x159a, + 0x96a: 0x15be, 0x96b: 0x15ca, 0x96c: 0x15da, 0x96d: 0x15f2, 0x96e: 0x15fa, 0x96f: 0x15fe, + 0x970: 0x1602, 0x971: 0x1606, 0x972: 0x1612, 0x973: 0x1616, 0x974: 0x161e, 0x975: 0x163a, + 0x976: 0x163e, 0x977: 0x1642, 0x978: 0x165a, 0x979: 0x165e, 0x97a: 0x1666, 0x97b: 0x167a, + 0x97c: 0x167e, 0x97d: 0x1682, 0x97e: 0x168a, 0x97f: 0x168e, + // Block 0x26, offset 0x980 + 0x986: 0xa000, 0x98b: 0xa000, + 0x98c: 0x4049, 0x98d: 0xa000, 0x98e: 0x4051, 0x98f: 0xa000, 0x990: 0x4059, 0x991: 0xa000, + 0x992: 0x4061, 0x993: 0xa000, 0x994: 0x4069, 0x995: 0xa000, 0x996: 0x4071, 0x997: 0xa000, + 0x998: 0x4079, 0x999: 0xa000, 0x99a: 0x4081, 0x99b: 0xa000, 0x99c: 0x4089, 0x99d: 0xa000, + 0x99e: 0x4091, 0x99f: 0xa000, 0x9a0: 0x4099, 0x9a1: 0xa000, 0x9a2: 0x40a1, + 0x9a4: 0xa000, 0x9a5: 0x40a9, 0x9a6: 0xa000, 0x9a7: 0x40b1, 0x9a8: 0xa000, 0x9a9: 0x40b9, + 0x9af: 0xa000, + 0x9b0: 0x40c1, 0x9b1: 0x40c9, 0x9b2: 0xa000, 0x9b3: 0x40d1, 0x9b4: 0x40d9, 0x9b5: 0xa000, + 0x9b6: 0x40e1, 0x9b7: 0x40e9, 0x9b8: 0xa000, 0x9b9: 0x40f1, 0x9ba: 0x40f9, 0x9bb: 0xa000, + 0x9bc: 0x4101, 0x9bd: 0x4109, + // Block 0x27, offset 0x9c0 + 0x9d4: 0x4041, + 0x9d9: 0x9904, 0x9da: 0x9904, 0x9db: 0x441d, 0x9dc: 0x4423, 0x9dd: 0xa000, + 0x9de: 0x4111, 0x9df: 0x27e4, + 0x9e6: 0xa000, + 0x9eb: 0xa000, 0x9ec: 0x4121, 0x9ed: 0xa000, 0x9ee: 0x4129, 0x9ef: 0xa000, + 0x9f0: 0x4131, 0x9f1: 0xa000, 0x9f2: 0x4139, 0x9f3: 0xa000, 0x9f4: 0x4141, 0x9f5: 0xa000, + 0x9f6: 0x4149, 0x9f7: 0xa000, 0x9f8: 0x4151, 0x9f9: 0xa000, 0x9fa: 0x4159, 0x9fb: 0xa000, + 0x9fc: 0x4161, 0x9fd: 0xa000, 0x9fe: 0x4169, 0x9ff: 0xa000, + // Block 0x28, offset 0xa00 + 0xa00: 0x4171, 0xa01: 0xa000, 0xa02: 0x4179, 0xa04: 0xa000, 0xa05: 0x4181, + 0xa06: 0xa000, 0xa07: 0x4189, 0xa08: 0xa000, 0xa09: 0x4191, + 0xa0f: 0xa000, 0xa10: 0x4199, 0xa11: 0x41a1, + 0xa12: 0xa000, 0xa13: 0x41a9, 0xa14: 0x41b1, 0xa15: 0xa000, 0xa16: 0x41b9, 0xa17: 0x41c1, + 0xa18: 0xa000, 0xa19: 0x41c9, 0xa1a: 0x41d1, 0xa1b: 0xa000, 0xa1c: 0x41d9, 0xa1d: 0x41e1, + 0xa2f: 0xa000, + 0xa30: 0xa000, 0xa31: 0xa000, 0xa32: 0xa000, 0xa34: 0x4119, + 0xa37: 0x41e9, 0xa38: 0x41f1, 0xa39: 0x41f9, 0xa3a: 0x4201, + 0xa3d: 0xa000, 0xa3e: 0x4209, 0xa3f: 0x27f9, + // Block 0x29, offset 0xa40 + 0xa40: 0x045a, 0xa41: 0x041e, 0xa42: 0x0422, 0xa43: 0x0426, 0xa44: 0x046e, 0xa45: 0x042a, + 0xa46: 0x042e, 0xa47: 0x0432, 0xa48: 0x0436, 0xa49: 0x043a, 0xa4a: 0x043e, 0xa4b: 0x0442, + 0xa4c: 0x0446, 0xa4d: 0x044a, 0xa4e: 0x044e, 0xa4f: 0x4afe, 0xa50: 0x4b04, 0xa51: 0x4b0a, + 0xa52: 0x4b10, 0xa53: 0x4b16, 0xa54: 0x4b1c, 0xa55: 0x4b22, 0xa56: 0x4b28, 0xa57: 0x4b2e, + 0xa58: 0x4b34, 0xa59: 0x4b3a, 0xa5a: 0x4b40, 0xa5b: 0x4b46, 0xa5c: 0x4b4c, 0xa5d: 0x4b52, + 0xa5e: 0x4b58, 0xa5f: 0x4b5e, 0xa60: 0x4b64, 0xa61: 0x4b6a, 0xa62: 0x4b70, 0xa63: 0x4b76, + 0xa64: 0x04b6, 0xa65: 0x0452, 0xa66: 0x0456, 0xa67: 0x04da, 0xa68: 0x04de, 0xa69: 0x04e2, + 0xa6a: 0x04e6, 0xa6b: 0x04ea, 0xa6c: 0x04ee, 0xa6d: 0x04f2, 0xa6e: 0x045e, 0xa6f: 0x04f6, + 0xa70: 0x04fa, 0xa71: 0x0462, 0xa72: 0x0466, 0xa73: 0x046a, 0xa74: 0x0472, 0xa75: 0x0476, + 0xa76: 0x047a, 0xa77: 0x047e, 0xa78: 0x0482, 0xa79: 0x0486, 0xa7a: 0x048a, 0xa7b: 0x048e, + 0xa7c: 0x0492, 0xa7d: 0x0496, 0xa7e: 0x049a, 0xa7f: 0x049e, + // Block 0x2a, offset 0xa80 + 0xa80: 0x04a2, 0xa81: 0x04a6, 0xa82: 0x04fe, 0xa83: 0x0502, 0xa84: 0x04aa, 0xa85: 0x04ae, + 0xa86: 0x04b2, 0xa87: 0x04ba, 0xa88: 0x04be, 0xa89: 0x04c2, 0xa8a: 0x04c6, 0xa8b: 0x04ca, + 0xa8c: 0x04ce, 0xa8d: 0x04d2, 0xa8e: 0x04d6, + 0xa92: 0x07ba, 0xa93: 0x0816, 0xa94: 0x07c6, 0xa95: 0x0a76, 0xa96: 0x07ca, 0xa97: 0x07e2, + 0xa98: 0x07ce, 0xa99: 0x108e, 0xa9a: 0x0802, 0xa9b: 0x07d6, 0xa9c: 0x07be, 0xa9d: 0x0afa, + 0xa9e: 0x0a8a, 0xa9f: 0x082a, + // Block 0x2b, offset 0xac0 + 0xac0: 0x2184, 0xac1: 0x218a, 0xac2: 0x2190, 0xac3: 0x2196, 0xac4: 0x219c, 0xac5: 0x21a2, + 0xac6: 0x21a8, 0xac7: 0x21ae, 0xac8: 0x21b4, 0xac9: 0x21ba, 0xaca: 0x21c0, 0xacb: 0x21c6, + 0xacc: 0x21cc, 0xacd: 0x21d2, 0xace: 0x285d, 0xacf: 0x2866, 0xad0: 0x286f, 0xad1: 0x2878, + 0xad2: 0x2881, 0xad3: 0x288a, 0xad4: 0x2893, 0xad5: 0x289c, 0xad6: 0x28a5, 0xad7: 0x28b7, + 0xad8: 0x28c0, 0xad9: 0x28c9, 0xada: 0x28d2, 0xadb: 0x28db, 0xadc: 0x28ae, 0xadd: 0x2ce3, + 0xade: 0x2c24, 0xae0: 0x21d8, 0xae1: 0x21f0, 0xae2: 0x21e4, 0xae3: 0x2238, + 0xae4: 0x21f6, 0xae5: 0x2214, 0xae6: 0x21de, 0xae7: 0x220e, 0xae8: 0x21ea, 0xae9: 0x2220, + 0xaea: 0x2250, 0xaeb: 0x226e, 0xaec: 0x2268, 0xaed: 0x225c, 0xaee: 0x22aa, 0xaef: 0x223e, + 0xaf0: 0x224a, 0xaf1: 0x2262, 0xaf2: 0x2256, 0xaf3: 0x2280, 0xaf4: 0x222c, 0xaf5: 0x2274, + 0xaf6: 0x229e, 0xaf7: 0x2286, 0xaf8: 0x221a, 0xaf9: 0x21fc, 0xafa: 0x2232, 0xafb: 0x2244, + 0xafc: 0x227a, 0xafd: 0x2202, 0xafe: 0x22a4, 0xaff: 0x2226, + // Block 0x2c, offset 0xb00 + 0xb00: 0x228c, 0xb01: 0x2208, 0xb02: 0x2292, 0xb03: 0x2298, 0xb04: 0x0a2a, 0xb05: 0x0bfe, + 0xb06: 0x0da2, 0xb07: 0x11c2, + 0xb10: 0x1cf4, 0xb11: 0x19d6, + 0xb12: 0x19d9, 0xb13: 0x19dc, 0xb14: 0x19df, 0xb15: 0x19e2, 0xb16: 0x19e5, 0xb17: 0x19e8, + 0xb18: 0x19eb, 0xb19: 0x19ee, 0xb1a: 0x19f7, 0xb1b: 0x19fa, 0xb1c: 0x19fd, 0xb1d: 0x1a00, + 0xb1e: 0x1a03, 0xb1f: 0x1a06, 0xb20: 0x0406, 0xb21: 0x040e, 0xb22: 0x0412, 0xb23: 0x041a, + 0xb24: 0x041e, 0xb25: 0x0422, 0xb26: 0x042a, 0xb27: 0x0432, 0xb28: 0x0436, 0xb29: 0x043e, + 0xb2a: 0x0442, 0xb2b: 0x0446, 0xb2c: 0x044a, 0xb2d: 0x044e, 0xb2e: 0x2f59, 0xb2f: 0x2f61, + 0xb30: 0x2f69, 0xb31: 0x2f71, 0xb32: 0x2f79, 0xb33: 0x2f81, 0xb34: 0x2f89, 0xb35: 0x2f91, + 0xb36: 0x2fa1, 0xb37: 0x2fa9, 0xb38: 0x2fb1, 0xb39: 0x2fb9, 0xb3a: 0x2fc1, 0xb3b: 0x2fc9, + 0xb3c: 0x3014, 0xb3d: 0x2fdc, 0xb3e: 0x2f99, + // Block 0x2d, offset 0xb40 + 0xb40: 0x07ba, 0xb41: 0x0816, 0xb42: 0x07c6, 0xb43: 0x0a76, 0xb44: 0x081a, 0xb45: 0x08aa, + 0xb46: 0x07c2, 0xb47: 0x08a6, 0xb48: 0x0806, 0xb49: 0x0982, 0xb4a: 0x0e02, 0xb4b: 0x0f8a, + 0xb4c: 0x0ed2, 0xb4d: 0x0e16, 0xb4e: 0x155a, 0xb4f: 0x0a86, 0xb50: 0x0dca, 0xb51: 0x0e46, + 0xb52: 0x0e06, 0xb53: 0x1146, 0xb54: 0x09f6, 0xb55: 0x0ffe, 0xb56: 0x1482, 0xb57: 0x115a, + 0xb58: 0x093e, 0xb59: 0x118a, 0xb5a: 0x1096, 0xb5b: 0x0b12, 0xb5c: 0x150a, 0xb5d: 0x087a, + 0xb5e: 0x09a6, 0xb5f: 0x0ef2, 0xb60: 0x1622, 0xb61: 0x083e, 0xb62: 0x08ce, 0xb63: 0x0e96, + 0xb64: 0x07ca, 0xb65: 0x07e2, 0xb66: 0x07ce, 0xb67: 0x0bd6, 0xb68: 0x09ea, 0xb69: 0x097a, + 0xb6a: 0x0b52, 0xb6b: 0x0b46, 0xb6c: 0x10e6, 0xb6d: 0x083a, 0xb6e: 0x1496, 0xb6f: 0x0996, + 0xb70: 0x0aee, 0xb71: 0x1a09, 0xb72: 0x1a0c, 0xb73: 0x1a0f, 0xb74: 0x1a12, 0xb75: 0x1a1b, + 0xb76: 0x1a1e, 0xb77: 0x1a21, 0xb78: 0x1a24, 0xb79: 0x1a27, 0xb7a: 0x1a2a, 0xb7b: 0x1a2d, + 0xb7c: 0x1a30, 0xb7d: 0x1a33, 0xb7e: 0x1a36, 0xb7f: 0x1a3f, + // Block 0x2e, offset 0xb80 + 0xb80: 0x1df6, 0xb81: 0x1e05, 0xb82: 0x1e14, 0xb83: 0x1e23, 0xb84: 0x1e32, 0xb85: 0x1e41, + 0xb86: 0x1e50, 0xb87: 0x1e5f, 0xb88: 0x1e6e, 0xb89: 0x22bc, 0xb8a: 0x22ce, 0xb8b: 0x22e0, + 0xb8c: 0x1a81, 0xb8d: 0x1d34, 0xb8e: 0x1b02, 0xb8f: 0x1cd8, 0xb90: 0x05c6, 0xb91: 0x05ce, + 0xb92: 0x05d6, 0xb93: 0x05de, 0xb94: 0x05e6, 0xb95: 0x05ea, 0xb96: 0x05ee, 0xb97: 0x05f2, + 0xb98: 0x05f6, 0xb99: 0x05fa, 0xb9a: 0x05fe, 0xb9b: 0x0602, 0xb9c: 0x0606, 0xb9d: 0x060a, + 0xb9e: 0x060e, 0xb9f: 0x0612, 0xba0: 0x0616, 0xba1: 0x061e, 0xba2: 0x0622, 0xba3: 0x0626, + 0xba4: 0x062a, 0xba5: 0x062e, 0xba6: 0x0632, 0xba7: 0x0636, 0xba8: 0x063a, 0xba9: 0x063e, + 0xbaa: 0x0642, 0xbab: 0x0646, 0xbac: 0x064a, 0xbad: 0x064e, 0xbae: 0x0652, 0xbaf: 0x0656, + 0xbb0: 0x065a, 0xbb1: 0x065e, 0xbb2: 0x0662, 0xbb3: 0x066a, 0xbb4: 0x0672, 0xbb5: 0x067a, + 0xbb6: 0x067e, 0xbb7: 0x0682, 0xbb8: 0x0686, 0xbb9: 0x068a, 0xbba: 0x068e, 0xbbb: 0x0692, + 0xbbc: 0x0696, 0xbbd: 0x069a, 0xbbe: 0x069e, 0xbbf: 0x282a, + // Block 0x2f, offset 0xbc0 + 0xbc0: 0x2c43, 0xbc1: 0x2adf, 0xbc2: 0x2c53, 0xbc3: 0x29b7, 0xbc4: 0x3025, 0xbc5: 0x29c1, + 0xbc6: 0x29cb, 0xbc7: 0x3069, 0xbc8: 0x2aec, 0xbc9: 0x29d5, 0xbca: 0x29df, 0xbcb: 0x29e9, + 0xbcc: 0x2b13, 0xbcd: 0x2b20, 0xbce: 0x2af9, 0xbcf: 0x2b06, 0xbd0: 0x2fea, 0xbd1: 0x2b2d, + 0xbd2: 0x2b3a, 0xbd3: 0x2cf5, 0xbd4: 0x27eb, 0xbd5: 0x2d08, 0xbd6: 0x2d1b, 0xbd7: 0x2c63, + 0xbd8: 0x2b47, 0xbd9: 0x2d2e, 0xbda: 0x2d41, 0xbdb: 0x2b54, 0xbdc: 0x29f3, 0xbdd: 0x29fd, + 0xbde: 0x2ff8, 0xbdf: 0x2b61, 0xbe0: 0x2c73, 0xbe1: 0x3036, 0xbe2: 0x2a07, 0xbe3: 0x2a11, + 0xbe4: 0x2b6e, 0xbe5: 0x2a1b, 0xbe6: 0x2a25, 0xbe7: 0x2800, 0xbe8: 0x2807, 0xbe9: 0x2a2f, + 0xbea: 0x2a39, 0xbeb: 0x2d54, 0xbec: 0x2b7b, 0xbed: 0x2c83, 0xbee: 0x2d67, 0xbef: 0x2b88, + 0xbf0: 0x2a4d, 0xbf1: 0x2a43, 0xbf2: 0x307d, 0xbf3: 0x2b95, 0xbf4: 0x2d7a, 0xbf5: 0x2a57, + 0xbf6: 0x2c93, 0xbf7: 0x2a61, 0xbf8: 0x2baf, 0xbf9: 0x2a6b, 0xbfa: 0x2bbc, 0xbfb: 0x3047, + 0xbfc: 0x2ba2, 0xbfd: 0x2ca3, 0xbfe: 0x2bc9, 0xbff: 0x280e, + // Block 0x30, offset 0xc00 + 0xc00: 0x3058, 0xc01: 0x2a75, 0xc02: 0x2a7f, 0xc03: 0x2bd6, 0xc04: 0x2a89, 0xc05: 0x2a93, + 0xc06: 0x2a9d, 0xc07: 0x2cb3, 0xc08: 0x2be3, 0xc09: 0x2815, 0xc0a: 0x2d8d, 0xc0b: 0x2fd1, + 0xc0c: 0x2cc3, 0xc0d: 0x2bf0, 0xc0e: 0x3006, 0xc0f: 0x2aa7, 0xc10: 0x2ab1, 0xc11: 0x2bfd, + 0xc12: 0x281c, 0xc13: 0x2c0a, 0xc14: 0x2cd3, 0xc15: 0x2823, 0xc16: 0x2da0, 0xc17: 0x2abb, + 0xc18: 0x1de7, 0xc19: 0x1dfb, 0xc1a: 0x1e0a, 0xc1b: 0x1e19, 0xc1c: 0x1e28, 0xc1d: 0x1e37, + 0xc1e: 0x1e46, 0xc1f: 0x1e55, 0xc20: 0x1e64, 0xc21: 0x1e73, 0xc22: 0x22c2, 0xc23: 0x22d4, + 0xc24: 0x22e6, 0xc25: 0x22f2, 0xc26: 0x22fe, 0xc27: 0x230a, 0xc28: 0x2316, 0xc29: 0x2322, + 0xc2a: 0x232e, 0xc2b: 0x233a, 0xc2c: 0x2376, 0xc2d: 0x2382, 0xc2e: 0x238e, 0xc2f: 0x239a, + 0xc30: 0x23a6, 0xc31: 0x1d44, 0xc32: 0x1af6, 0xc33: 0x1a63, 0xc34: 0x1d14, 0xc35: 0x1b77, + 0xc36: 0x1b86, 0xc37: 0x1afc, 0xc38: 0x1d2c, 0xc39: 0x1d30, 0xc3a: 0x1a8d, 0xc3b: 0x2838, + 0xc3c: 0x2846, 0xc3d: 0x2831, 0xc3e: 0x283f, 0xc3f: 0x2c17, + // Block 0x31, offset 0xc40 + 0xc40: 0x1b7a, 0xc41: 0x1b62, 0xc42: 0x1d90, 0xc43: 0x1b4a, 0xc44: 0x1b23, 0xc45: 0x1a96, + 0xc46: 0x1aa5, 0xc47: 0x1a75, 0xc48: 0x1d20, 0xc49: 0x1e82, 0xc4a: 0x1b7d, 0xc4b: 0x1b65, + 0xc4c: 0x1d94, 0xc4d: 0x1da0, 0xc4e: 0x1b56, 0xc4f: 0x1b2c, 0xc50: 0x1a84, 0xc51: 0x1d4c, + 0xc52: 0x1ce0, 0xc53: 0x1ccc, 0xc54: 0x1cfc, 0xc55: 0x1da4, 0xc56: 0x1b59, 0xc57: 0x1af9, + 0xc58: 0x1b2f, 0xc59: 0x1b0e, 0xc5a: 0x1b71, 0xc5b: 0x1da8, 0xc5c: 0x1b5c, 0xc5d: 0x1af0, + 0xc5e: 0x1b32, 0xc5f: 0x1d6c, 0xc60: 0x1d24, 0xc61: 0x1b44, 0xc62: 0x1d54, 0xc63: 0x1d70, + 0xc64: 0x1d28, 0xc65: 0x1b47, 0xc66: 0x1d58, 0xc67: 0x2418, 0xc68: 0x242c, 0xc69: 0x1ac6, + 0xc6a: 0x1d50, 0xc6b: 0x1ce4, 0xc6c: 0x1cd0, 0xc6d: 0x1d78, 0xc6e: 0x284d, 0xc6f: 0x28e4, + 0xc70: 0x1b89, 0xc71: 0x1b74, 0xc72: 0x1dac, 0xc73: 0x1b5f, 0xc74: 0x1b80, 0xc75: 0x1b68, + 0xc76: 0x1d98, 0xc77: 0x1b4d, 0xc78: 0x1b26, 0xc79: 0x1ab1, 0xc7a: 0x1b83, 0xc7b: 0x1b6b, + 0xc7c: 0x1d9c, 0xc7d: 0x1b50, 0xc7e: 0x1b29, 0xc7f: 0x1ab4, + // Block 0x32, offset 0xc80 + 0xc80: 0x1d5c, 0xc81: 0x1ce8, 0xc82: 0x1e7d, 0xc83: 0x1a66, 0xc84: 0x1aea, 0xc85: 0x1aed, + 0xc86: 0x2425, 0xc87: 0x1cc4, 0xc88: 0x1af3, 0xc89: 0x1a78, 0xc8a: 0x1b11, 0xc8b: 0x1a7b, + 0xc8c: 0x1b1a, 0xc8d: 0x1a99, 0xc8e: 0x1a9c, 0xc8f: 0x1b35, 0xc90: 0x1b3b, 0xc91: 0x1b3e, + 0xc92: 0x1d60, 0xc93: 0x1b41, 0xc94: 0x1b53, 0xc95: 0x1d68, 0xc96: 0x1d74, 0xc97: 0x1ac0, + 0xc98: 0x1e87, 0xc99: 0x1cec, 0xc9a: 0x1ac3, 0xc9b: 0x1b8c, 0xc9c: 0x1ad5, 0xc9d: 0x1ae4, + 0xc9e: 0x2412, 0xc9f: 0x240c, 0xca0: 0x1df1, 0xca1: 0x1e00, 0xca2: 0x1e0f, 0xca3: 0x1e1e, + 0xca4: 0x1e2d, 0xca5: 0x1e3c, 0xca6: 0x1e4b, 0xca7: 0x1e5a, 0xca8: 0x1e69, 0xca9: 0x22b6, + 0xcaa: 0x22c8, 0xcab: 0x22da, 0xcac: 0x22ec, 0xcad: 0x22f8, 0xcae: 0x2304, 0xcaf: 0x2310, + 0xcb0: 0x231c, 0xcb1: 0x2328, 0xcb2: 0x2334, 0xcb3: 0x2370, 0xcb4: 0x237c, 0xcb5: 0x2388, + 0xcb6: 0x2394, 0xcb7: 0x23a0, 0xcb8: 0x23ac, 0xcb9: 0x23b2, 0xcba: 0x23b8, 0xcbb: 0x23be, + 0xcbc: 0x23c4, 0xcbd: 0x23d6, 0xcbe: 0x23dc, 0xcbf: 0x1d40, + // Block 0x33, offset 0xcc0 + 0xcc0: 0x1472, 0xcc1: 0x0df6, 0xcc2: 0x14ce, 0xcc3: 0x149a, 0xcc4: 0x0f52, 0xcc5: 0x07e6, + 0xcc6: 0x09da, 0xcc7: 0x1726, 0xcc8: 0x1726, 0xcc9: 0x0b06, 0xcca: 0x155a, 0xccb: 0x0a3e, + 0xccc: 0x0b02, 0xccd: 0x0cea, 0xcce: 0x10ca, 0xccf: 0x125a, 0xcd0: 0x1392, 0xcd1: 0x13ce, + 0xcd2: 0x1402, 0xcd3: 0x1516, 0xcd4: 0x0e6e, 0xcd5: 0x0efa, 0xcd6: 0x0fa6, 0xcd7: 0x103e, + 0xcd8: 0x135a, 0xcd9: 0x1542, 0xcda: 0x166e, 0xcdb: 0x080a, 0xcdc: 0x09ae, 0xcdd: 0x0e82, + 0xcde: 0x0fca, 0xcdf: 0x138e, 0xce0: 0x16be, 0xce1: 0x0bae, 0xce2: 0x0f72, 0xce3: 0x137e, + 0xce4: 0x1412, 0xce5: 0x0d1e, 0xce6: 0x12b6, 0xce7: 0x13da, 0xce8: 0x0c1a, 0xce9: 0x0e0a, + 0xcea: 0x0f12, 0xceb: 0x1016, 0xcec: 0x1522, 0xced: 0x084a, 0xcee: 0x08e2, 0xcef: 0x094e, + 0xcf0: 0x0d86, 0xcf1: 0x0e7a, 0xcf2: 0x0fc6, 0xcf3: 0x10ea, 0xcf4: 0x1272, 0xcf5: 0x1386, + 0xcf6: 0x139e, 0xcf7: 0x14c2, 0xcf8: 0x15ea, 0xcf9: 0x169e, 0xcfa: 0x16ba, 0xcfb: 0x1126, + 0xcfc: 0x1166, 0xcfd: 0x121e, 0xcfe: 0x133e, 0xcff: 0x1576, + // Block 0x34, offset 0xd00 + 0xd00: 0x16c6, 0xd01: 0x1446, 0xd02: 0x0ac2, 0xd03: 0x0c36, 0xd04: 0x11d6, 0xd05: 0x1296, + 0xd06: 0x0ffa, 0xd07: 0x112e, 0xd08: 0x1492, 0xd09: 0x15e2, 0xd0a: 0x0abe, 0xd0b: 0x0b8a, + 0xd0c: 0x0e72, 0xd0d: 0x0f26, 0xd0e: 0x0f5a, 0xd0f: 0x120e, 0xd10: 0x1236, 0xd11: 0x15a2, + 0xd12: 0x094a, 0xd13: 0x12a2, 0xd14: 0x08ee, 0xd15: 0x08ea, 0xd16: 0x1192, 0xd17: 0x1222, + 0xd18: 0x1356, 0xd19: 0x15aa, 0xd1a: 0x1462, 0xd1b: 0x0d22, 0xd1c: 0x0e6e, 0xd1d: 0x1452, + 0xd1e: 0x07f2, 0xd1f: 0x0b5e, 0xd20: 0x0c8e, 0xd21: 0x102a, 0xd22: 0x10aa, 0xd23: 0x096e, + 0xd24: 0x1136, 0xd25: 0x085a, 0xd26: 0x0c72, 0xd27: 0x07d2, 0xd28: 0x0ee6, 0xd29: 0x0d9e, + 0xd2a: 0x120a, 0xd2b: 0x09c2, 0xd2c: 0x0aae, 0xd2d: 0x10f6, 0xd2e: 0x135e, 0xd2f: 0x1436, + 0xd30: 0x0eb2, 0xd31: 0x14f2, 0xd32: 0x0ede, 0xd33: 0x0d32, 0xd34: 0x1316, 0xd35: 0x0d52, + 0xd36: 0x10a6, 0xd37: 0x0826, 0xd38: 0x08a2, 0xd39: 0x08e6, 0xd3a: 0x0e4e, 0xd3b: 0x11f6, + 0xd3c: 0x12ee, 0xd3d: 0x1442, 0xd3e: 0x1556, 0xd3f: 0x0956, + // Block 0x35, offset 0xd40 + 0xd40: 0x0a0a, 0xd41: 0x0b12, 0xd42: 0x0c2a, 0xd43: 0x0dba, 0xd44: 0x0f76, 0xd45: 0x113a, + 0xd46: 0x1592, 0xd47: 0x1676, 0xd48: 0x16ca, 0xd49: 0x16e2, 0xd4a: 0x0932, 0xd4b: 0x0dee, + 0xd4c: 0x0e9e, 0xd4d: 0x14e6, 0xd4e: 0x0bf6, 0xd4f: 0x0cd2, 0xd50: 0x0cee, 0xd51: 0x0d7e, + 0xd52: 0x0f66, 0xd53: 0x0fb2, 0xd54: 0x1062, 0xd55: 0x1186, 0xd56: 0x122a, 0xd57: 0x128e, + 0xd58: 0x14d6, 0xd59: 0x1366, 0xd5a: 0x14fe, 0xd5b: 0x157a, 0xd5c: 0x090a, 0xd5d: 0x0936, + 0xd5e: 0x0a1e, 0xd5f: 0x0fa2, 0xd60: 0x13ee, 0xd61: 0x1436, 0xd62: 0x0c16, 0xd63: 0x0c86, + 0xd64: 0x0d4a, 0xd65: 0x0eaa, 0xd66: 0x11d2, 0xd67: 0x101e, 0xd68: 0x0836, 0xd69: 0x0a7a, + 0xd6a: 0x0b5e, 0xd6b: 0x0bc2, 0xd6c: 0x0c92, 0xd6d: 0x103a, 0xd6e: 0x1056, 0xd6f: 0x1266, + 0xd70: 0x1286, 0xd71: 0x155e, 0xd72: 0x15de, 0xd73: 0x15ee, 0xd74: 0x162a, 0xd75: 0x084e, + 0xd76: 0x117a, 0xd77: 0x154a, 0xd78: 0x15c6, 0xd79: 0x0caa, 0xd7a: 0x0812, 0xd7b: 0x0872, + 0xd7c: 0x0b62, 0xd7d: 0x0b82, 0xd7e: 0x0daa, 0xd7f: 0x0e6e, + // Block 0x36, offset 0xd80 + 0xd80: 0x0fbe, 0xd81: 0x10c6, 0xd82: 0x1372, 0xd83: 0x1512, 0xd84: 0x171e, 0xd85: 0x0dde, + 0xd86: 0x159e, 0xd87: 0x092e, 0xd88: 0x0e2a, 0xd89: 0x0e36, 0xd8a: 0x0f0a, 0xd8b: 0x0f42, + 0xd8c: 0x1046, 0xd8d: 0x10a2, 0xd8e: 0x1122, 0xd8f: 0x1206, 0xd90: 0x1636, 0xd91: 0x08aa, + 0xd92: 0x0cfe, 0xd93: 0x15ae, 0xd94: 0x0862, 0xd95: 0x0ba6, 0xd96: 0x0f2a, 0xd97: 0x14da, + 0xd98: 0x0c62, 0xd99: 0x0cb2, 0xd9a: 0x0e3e, 0xd9b: 0x102a, 0xd9c: 0x15b6, 0xd9d: 0x0912, + 0xd9e: 0x09fa, 0xd9f: 0x0b92, 0xda0: 0x0dce, 0xda1: 0x0e1a, 0xda2: 0x0e5a, 0xda3: 0x0eee, + 0xda4: 0x1042, 0xda5: 0x10b6, 0xda6: 0x1252, 0xda7: 0x13f2, 0xda8: 0x13fe, 0xda9: 0x1552, + 0xdaa: 0x15d2, 0xdab: 0x097e, 0xdac: 0x0f46, 0xdad: 0x09fe, 0xdae: 0x0fc2, 0xdaf: 0x1066, + 0xdb0: 0x1382, 0xdb1: 0x15ba, 0xdb2: 0x16a6, 0xdb3: 0x16ce, 0xdb4: 0x0e32, 0xdb5: 0x0f22, + 0xdb6: 0x12be, 0xdb7: 0x11b2, 0xdb8: 0x11be, 0xdb9: 0x11e2, 0xdba: 0x1012, 0xdbb: 0x0f9a, + 0xdbc: 0x145e, 0xdbd: 0x082e, 0xdbe: 0x1326, 0xdbf: 0x0916, + // Block 0x37, offset 0xdc0 + 0xdc0: 0x0906, 0xdc1: 0x0c06, 0xdc2: 0x0d26, 0xdc3: 0x11ee, 0xdc4: 0x0b4e, 0xdc5: 0x0efe, + 0xdc6: 0x0dea, 0xdc7: 0x14e2, 0xdc8: 0x13e2, 0xdc9: 0x15a6, 0xdca: 0x141e, 0xdcb: 0x0c22, + 0xdcc: 0x0882, 0xdcd: 0x0a56, 0xdd0: 0x0aaa, + 0xdd2: 0x0dda, 0xdd5: 0x08f2, 0xdd6: 0x101a, 0xdd7: 0x10de, + 0xdd8: 0x1142, 0xdd9: 0x115e, 0xdda: 0x1162, 0xddb: 0x1176, 0xddc: 0x15f6, 0xddd: 0x11e6, + 0xdde: 0x126a, 0xde0: 0x138a, 0xde2: 0x144e, + 0xde5: 0x1502, 0xde6: 0x152e, + 0xdea: 0x164a, 0xdeb: 0x164e, 0xdec: 0x1652, 0xded: 0x16b6, 0xdee: 0x1526, 0xdef: 0x15c2, + 0xdf0: 0x0852, 0xdf1: 0x0876, 0xdf2: 0x088a, 0xdf3: 0x0946, 0xdf4: 0x0952, 0xdf5: 0x0992, + 0xdf6: 0x0a46, 0xdf7: 0x0a62, 0xdf8: 0x0a6a, 0xdf9: 0x0aa6, 0xdfa: 0x0ab2, 0xdfb: 0x0b8e, + 0xdfc: 0x0b96, 0xdfd: 0x0c9e, 0xdfe: 0x0cc6, 0xdff: 0x0cce, + // Block 0x38, offset 0xe00 + 0xe00: 0x0ce6, 0xe01: 0x0d92, 0xe02: 0x0dc2, 0xe03: 0x0de2, 0xe04: 0x0e52, 0xe05: 0x0f16, + 0xe06: 0x0f32, 0xe07: 0x0f62, 0xe08: 0x0fb6, 0xe09: 0x0fd6, 0xe0a: 0x104a, 0xe0b: 0x112a, + 0xe0c: 0x1146, 0xe0d: 0x114e, 0xe0e: 0x114a, 0xe0f: 0x1152, 0xe10: 0x1156, 0xe11: 0x115a, + 0xe12: 0x116e, 0xe13: 0x1172, 0xe14: 0x1196, 0xe15: 0x11aa, 0xe16: 0x11c6, 0xe17: 0x122a, + 0xe18: 0x1232, 0xe19: 0x123a, 0xe1a: 0x124e, 0xe1b: 0x1276, 0xe1c: 0x12c6, 0xe1d: 0x12fa, + 0xe1e: 0x12fa, 0xe1f: 0x1362, 0xe20: 0x140a, 0xe21: 0x1422, 0xe22: 0x1456, 0xe23: 0x145a, + 0xe24: 0x149e, 0xe25: 0x14a2, 0xe26: 0x14fa, 0xe27: 0x1502, 0xe28: 0x15d6, 0xe29: 0x161a, + 0xe2a: 0x1632, 0xe2b: 0x0c96, 0xe2c: 0x184b, 0xe2d: 0x12de, + 0xe30: 0x07da, 0xe31: 0x08de, 0xe32: 0x089e, 0xe33: 0x0846, 0xe34: 0x0886, 0xe35: 0x08b2, + 0xe36: 0x0942, 0xe37: 0x095e, 0xe38: 0x0a46, 0xe39: 0x0a32, 0xe3a: 0x0a42, 0xe3b: 0x0a5e, + 0xe3c: 0x0aaa, 0xe3d: 0x0aba, 0xe3e: 0x0afe, 0xe3f: 0x0b0a, + // Block 0x39, offset 0xe40 + 0xe40: 0x0b26, 0xe41: 0x0b36, 0xe42: 0x0c1e, 0xe43: 0x0c26, 0xe44: 0x0c56, 0xe45: 0x0c76, + 0xe46: 0x0ca6, 0xe47: 0x0cbe, 0xe48: 0x0cae, 0xe49: 0x0cce, 0xe4a: 0x0cc2, 0xe4b: 0x0ce6, + 0xe4c: 0x0d02, 0xe4d: 0x0d5a, 0xe4e: 0x0d66, 0xe4f: 0x0d6e, 0xe50: 0x0d96, 0xe51: 0x0dda, + 0xe52: 0x0e0a, 0xe53: 0x0e0e, 0xe54: 0x0e22, 0xe55: 0x0ea2, 0xe56: 0x0eb2, 0xe57: 0x0f0a, + 0xe58: 0x0f56, 0xe59: 0x0f4e, 0xe5a: 0x0f62, 0xe5b: 0x0f7e, 0xe5c: 0x0fb6, 0xe5d: 0x110e, + 0xe5e: 0x0fda, 0xe5f: 0x100e, 0xe60: 0x101a, 0xe61: 0x105a, 0xe62: 0x1076, 0xe63: 0x109a, + 0xe64: 0x10be, 0xe65: 0x10c2, 0xe66: 0x10de, 0xe67: 0x10e2, 0xe68: 0x10f2, 0xe69: 0x1106, + 0xe6a: 0x1102, 0xe6b: 0x1132, 0xe6c: 0x11ae, 0xe6d: 0x11c6, 0xe6e: 0x11de, 0xe6f: 0x1216, + 0xe70: 0x122a, 0xe71: 0x1246, 0xe72: 0x1276, 0xe73: 0x132a, 0xe74: 0x1352, 0xe75: 0x13c6, + 0xe76: 0x140e, 0xe77: 0x141a, 0xe78: 0x1422, 0xe79: 0x143a, 0xe7a: 0x144e, 0xe7b: 0x143e, + 0xe7c: 0x1456, 0xe7d: 0x1452, 0xe7e: 0x144a, 0xe7f: 0x145a, + // Block 0x3a, offset 0xe80 + 0xe80: 0x1466, 0xe81: 0x14a2, 0xe82: 0x14de, 0xe83: 0x150e, 0xe84: 0x1546, 0xe85: 0x1566, + 0xe86: 0x15b2, 0xe87: 0x15d6, 0xe88: 0x15f6, 0xe89: 0x160a, 0xe8a: 0x161a, 0xe8b: 0x1626, + 0xe8c: 0x1632, 0xe8d: 0x1686, 0xe8e: 0x1726, 0xe8f: 0x17e2, 0xe90: 0x17dd, 0xe91: 0x180f, + 0xe92: 0x0702, 0xe93: 0x072a, 0xe94: 0x072e, 0xe95: 0x1891, 0xe96: 0x18be, 0xe97: 0x1936, + 0xe98: 0x1712, 0xe99: 0x1722, + // Block 0x3b, offset 0xec0 + 0xec0: 0x1b05, 0xec1: 0x1b08, 0xec2: 0x1b0b, 0xec3: 0x1d38, 0xec4: 0x1d3c, 0xec5: 0x1b8f, + 0xec6: 0x1b8f, + 0xed3: 0x1ea5, 0xed4: 0x1e96, 0xed5: 0x1e9b, 0xed6: 0x1eaa, 0xed7: 0x1ea0, + 0xedd: 0x44d1, + 0xede: 0x8116, 0xedf: 0x4543, 0xee0: 0x0320, 0xee1: 0x0308, 0xee2: 0x0311, 0xee3: 0x0314, + 0xee4: 0x0317, 0xee5: 0x031a, 0xee6: 0x031d, 0xee7: 0x0323, 0xee8: 0x0326, 0xee9: 0x0017, + 0xeea: 0x4531, 0xeeb: 0x4537, 0xeec: 0x4635, 0xeed: 0x463d, 0xeee: 0x4489, 0xeef: 0x448f, + 0xef0: 0x4495, 0xef1: 0x449b, 0xef2: 0x44a7, 0xef3: 0x44ad, 0xef4: 0x44b3, 0xef5: 0x44bf, + 0xef6: 0x44c5, 0xef8: 0x44cb, 0xef9: 0x44d7, 0xefa: 0x44dd, 0xefb: 0x44e3, + 0xefc: 0x44ef, 0xefe: 0x44f5, + // Block 0x3c, offset 0xf00 + 0xf00: 0x44fb, 0xf01: 0x4501, 0xf03: 0x4507, 0xf04: 0x450d, + 0xf06: 0x4519, 0xf07: 0x451f, 0xf08: 0x4525, 0xf09: 0x452b, 0xf0a: 0x453d, 0xf0b: 0x44b9, + 0xf0c: 0x44a1, 0xf0d: 0x44e9, 0xf0e: 0x4513, 0xf0f: 0x1eaf, 0xf10: 0x038c, 0xf11: 0x038c, + 0xf12: 0x0395, 0xf13: 0x0395, 0xf14: 0x0395, 0xf15: 0x0395, 0xf16: 0x0398, 0xf17: 0x0398, + 0xf18: 0x0398, 0xf19: 0x0398, 0xf1a: 0x039e, 0xf1b: 0x039e, 0xf1c: 0x039e, 0xf1d: 0x039e, + 0xf1e: 0x0392, 0xf1f: 0x0392, 0xf20: 0x0392, 0xf21: 0x0392, 0xf22: 0x039b, 0xf23: 0x039b, + 0xf24: 0x039b, 0xf25: 0x039b, 0xf26: 0x038f, 0xf27: 0x038f, 0xf28: 0x038f, 0xf29: 0x038f, + 0xf2a: 0x03c2, 0xf2b: 0x03c2, 0xf2c: 0x03c2, 0xf2d: 0x03c2, 0xf2e: 0x03c5, 0xf2f: 0x03c5, + 0xf30: 0x03c5, 0xf31: 0x03c5, 0xf32: 0x03a4, 0xf33: 0x03a4, 0xf34: 0x03a4, 0xf35: 0x03a4, + 0xf36: 0x03a1, 0xf37: 0x03a1, 0xf38: 0x03a1, 0xf39: 0x03a1, 0xf3a: 0x03a7, 0xf3b: 0x03a7, + 0xf3c: 0x03a7, 0xf3d: 0x03a7, 0xf3e: 0x03aa, 0xf3f: 0x03aa, + // Block 0x3d, offset 0xf40 + 0xf40: 0x03aa, 0xf41: 0x03aa, 0xf42: 0x03b3, 0xf43: 0x03b3, 0xf44: 0x03b0, 0xf45: 0x03b0, + 0xf46: 0x03b6, 0xf47: 0x03b6, 0xf48: 0x03ad, 0xf49: 0x03ad, 0xf4a: 0x03bc, 0xf4b: 0x03bc, + 0xf4c: 0x03b9, 0xf4d: 0x03b9, 0xf4e: 0x03c8, 0xf4f: 0x03c8, 0xf50: 0x03c8, 0xf51: 0x03c8, + 0xf52: 0x03ce, 0xf53: 0x03ce, 0xf54: 0x03ce, 0xf55: 0x03ce, 0xf56: 0x03d4, 0xf57: 0x03d4, + 0xf58: 0x03d4, 0xf59: 0x03d4, 0xf5a: 0x03d1, 0xf5b: 0x03d1, 0xf5c: 0x03d1, 0xf5d: 0x03d1, + 0xf5e: 0x03d7, 0xf5f: 0x03d7, 0xf60: 0x03da, 0xf61: 0x03da, 0xf62: 0x03da, 0xf63: 0x03da, + 0xf64: 0x45af, 0xf65: 0x45af, 0xf66: 0x03e0, 0xf67: 0x03e0, 0xf68: 0x03e0, 0xf69: 0x03e0, + 0xf6a: 0x03dd, 0xf6b: 0x03dd, 0xf6c: 0x03dd, 0xf6d: 0x03dd, 0xf6e: 0x03fb, 0xf6f: 0x03fb, + 0xf70: 0x45a9, 0xf71: 0x45a9, + // Block 0x3e, offset 0xf80 + 0xf93: 0x03cb, 0xf94: 0x03cb, 0xf95: 0x03cb, 0xf96: 0x03cb, 0xf97: 0x03e9, + 0xf98: 0x03e9, 0xf99: 0x03e6, 0xf9a: 0x03e6, 0xf9b: 0x03ec, 0xf9c: 0x03ec, 0xf9d: 0x217f, + 0xf9e: 0x03f2, 0xf9f: 0x03f2, 0xfa0: 0x03e3, 0xfa1: 0x03e3, 0xfa2: 0x03ef, 0xfa3: 0x03ef, + 0xfa4: 0x03f8, 0xfa5: 0x03f8, 0xfa6: 0x03f8, 0xfa7: 0x03f8, 0xfa8: 0x0380, 0xfa9: 0x0380, + 0xfaa: 0x26da, 0xfab: 0x26da, 0xfac: 0x274a, 0xfad: 0x274a, 0xfae: 0x2719, 0xfaf: 0x2719, + 0xfb0: 0x2735, 0xfb1: 0x2735, 0xfb2: 0x272e, 0xfb3: 0x272e, 0xfb4: 0x273c, 0xfb5: 0x273c, + 0xfb6: 0x2743, 0xfb7: 0x2743, 0xfb8: 0x2743, 0xfb9: 0x2720, 0xfba: 0x2720, 0xfbb: 0x2720, + 0xfbc: 0x03f5, 0xfbd: 0x03f5, 0xfbe: 0x03f5, 0xfbf: 0x03f5, + // Block 0x3f, offset 0xfc0 + 0xfc0: 0x26e1, 0xfc1: 0x26e8, 0xfc2: 0x2704, 0xfc3: 0x2720, 0xfc4: 0x2727, 0xfc5: 0x1eb9, + 0xfc6: 0x1ebe, 0xfc7: 0x1ec3, 0xfc8: 0x1ed2, 0xfc9: 0x1ee1, 0xfca: 0x1ee6, 0xfcb: 0x1eeb, + 0xfcc: 0x1ef0, 0xfcd: 0x1ef5, 0xfce: 0x1f04, 0xfcf: 0x1f13, 0xfd0: 0x1f18, 0xfd1: 0x1f1d, + 0xfd2: 0x1f2c, 0xfd3: 0x1f3b, 0xfd4: 0x1f40, 0xfd5: 0x1f45, 0xfd6: 0x1f4a, 0xfd7: 0x1f59, + 0xfd8: 0x1f5e, 0xfd9: 0x1f6d, 0xfda: 0x1f72, 0xfdb: 0x1f77, 0xfdc: 0x1f86, 0xfdd: 0x1f8b, + 0xfde: 0x1f90, 0xfdf: 0x1f9a, 0xfe0: 0x1fd6, 0xfe1: 0x1fe5, 0xfe2: 0x1ff4, 0xfe3: 0x1ff9, + 0xfe4: 0x1ffe, 0xfe5: 0x2008, 0xfe6: 0x2017, 0xfe7: 0x201c, 0xfe8: 0x202b, 0xfe9: 0x2030, + 0xfea: 0x2035, 0xfeb: 0x2044, 0xfec: 0x2049, 0xfed: 0x2058, 0xfee: 0x205d, 0xfef: 0x2062, + 0xff0: 0x2067, 0xff1: 0x206c, 0xff2: 0x2071, 0xff3: 0x2076, 0xff4: 0x207b, 0xff5: 0x2080, + 0xff6: 0x2085, 0xff7: 0x208a, 0xff8: 0x208f, 0xff9: 0x2094, 0xffa: 0x2099, 0xffb: 0x209e, + 0xffc: 0x20a3, 0xffd: 0x20a8, 0xffe: 0x20ad, 0xfff: 0x20b7, + // Block 0x40, offset 0x1000 + 0x1000: 0x20bc, 0x1001: 0x20c1, 0x1002: 0x20c6, 0x1003: 0x20d0, 0x1004: 0x20d5, 0x1005: 0x20df, + 0x1006: 0x20e4, 0x1007: 0x20e9, 0x1008: 0x20ee, 0x1009: 0x20f3, 0x100a: 0x20f8, 0x100b: 0x20fd, + 0x100c: 0x2102, 0x100d: 0x2107, 0x100e: 0x2116, 0x100f: 0x2125, 0x1010: 0x212a, 0x1011: 0x212f, + 0x1012: 0x2134, 0x1013: 0x2139, 0x1014: 0x213e, 0x1015: 0x2148, 0x1016: 0x214d, 0x1017: 0x2152, + 0x1018: 0x2161, 0x1019: 0x2170, 0x101a: 0x2175, 0x101b: 0x4561, 0x101c: 0x4567, 0x101d: 0x459d, + 0x101e: 0x45f4, 0x101f: 0x45fb, 0x1020: 0x4602, 0x1021: 0x4609, 0x1022: 0x4610, 0x1023: 0x4617, + 0x1024: 0x26f6, 0x1025: 0x26fd, 0x1026: 0x2704, 0x1027: 0x270b, 0x1028: 0x2720, 0x1029: 0x2727, + 0x102a: 0x1ec8, 0x102b: 0x1ecd, 0x102c: 0x1ed2, 0x102d: 0x1ed7, 0x102e: 0x1ee1, 0x102f: 0x1ee6, + 0x1030: 0x1efa, 0x1031: 0x1eff, 0x1032: 0x1f04, 0x1033: 0x1f09, 0x1034: 0x1f13, 0x1035: 0x1f18, + 0x1036: 0x1f22, 0x1037: 0x1f27, 0x1038: 0x1f2c, 0x1039: 0x1f31, 0x103a: 0x1f3b, 0x103b: 0x1f40, + 0x103c: 0x206c, 0x103d: 0x2071, 0x103e: 0x2080, 0x103f: 0x2085, + // Block 0x41, offset 0x1040 + 0x1040: 0x208a, 0x1041: 0x209e, 0x1042: 0x20a3, 0x1043: 0x20a8, 0x1044: 0x20ad, 0x1045: 0x20c6, + 0x1046: 0x20d0, 0x1047: 0x20d5, 0x1048: 0x20da, 0x1049: 0x20ee, 0x104a: 0x210c, 0x104b: 0x2111, + 0x104c: 0x2116, 0x104d: 0x211b, 0x104e: 0x2125, 0x104f: 0x212a, 0x1050: 0x459d, 0x1051: 0x2157, + 0x1052: 0x215c, 0x1053: 0x2161, 0x1054: 0x2166, 0x1055: 0x2170, 0x1056: 0x2175, 0x1057: 0x26e1, + 0x1058: 0x26e8, 0x1059: 0x26ef, 0x105a: 0x2704, 0x105b: 0x2712, 0x105c: 0x1eb9, 0x105d: 0x1ebe, + 0x105e: 0x1ec3, 0x105f: 0x1ed2, 0x1060: 0x1edc, 0x1061: 0x1eeb, 0x1062: 0x1ef0, 0x1063: 0x1ef5, + 0x1064: 0x1f04, 0x1065: 0x1f0e, 0x1066: 0x1f2c, 0x1067: 0x1f45, 0x1068: 0x1f4a, 0x1069: 0x1f59, + 0x106a: 0x1f5e, 0x106b: 0x1f6d, 0x106c: 0x1f77, 0x106d: 0x1f86, 0x106e: 0x1f8b, 0x106f: 0x1f90, + 0x1070: 0x1f9a, 0x1071: 0x1fd6, 0x1072: 0x1fdb, 0x1073: 0x1fe5, 0x1074: 0x1ff4, 0x1075: 0x1ff9, + 0x1076: 0x1ffe, 0x1077: 0x2008, 0x1078: 0x2017, 0x1079: 0x202b, 0x107a: 0x2030, 0x107b: 0x2035, + 0x107c: 0x2044, 0x107d: 0x2049, 0x107e: 0x2058, 0x107f: 0x205d, + // Block 0x42, offset 0x1080 + 0x1080: 0x2062, 0x1081: 0x2067, 0x1082: 0x2076, 0x1083: 0x207b, 0x1084: 0x208f, 0x1085: 0x2094, + 0x1086: 0x2099, 0x1087: 0x209e, 0x1088: 0x20a3, 0x1089: 0x20b7, 0x108a: 0x20bc, 0x108b: 0x20c1, + 0x108c: 0x20c6, 0x108d: 0x20cb, 0x108e: 0x20df, 0x108f: 0x20e4, 0x1090: 0x20e9, 0x1091: 0x20ee, + 0x1092: 0x20fd, 0x1093: 0x2102, 0x1094: 0x2107, 0x1095: 0x2116, 0x1096: 0x2120, 0x1097: 0x212f, + 0x1098: 0x2134, 0x1099: 0x4591, 0x109a: 0x2148, 0x109b: 0x214d, 0x109c: 0x2152, 0x109d: 0x2161, + 0x109e: 0x216b, 0x109f: 0x2704, 0x10a0: 0x2712, 0x10a1: 0x1ed2, 0x10a2: 0x1edc, 0x10a3: 0x1f04, + 0x10a4: 0x1f0e, 0x10a5: 0x1f2c, 0x10a6: 0x1f36, 0x10a7: 0x1f9a, 0x10a8: 0x1f9f, 0x10a9: 0x1fc2, + 0x10aa: 0x1fc7, 0x10ab: 0x209e, 0x10ac: 0x20a3, 0x10ad: 0x20c6, 0x10ae: 0x2116, 0x10af: 0x2120, + 0x10b0: 0x2161, 0x10b1: 0x216b, 0x10b2: 0x4645, 0x10b3: 0x464d, 0x10b4: 0x4655, 0x10b5: 0x2021, + 0x10b6: 0x2026, 0x10b7: 0x203a, 0x10b8: 0x203f, 0x10b9: 0x204e, 0x10ba: 0x2053, 0x10bb: 0x1fa4, + 0x10bc: 0x1fa9, 0x10bd: 0x1fcc, 0x10be: 0x1fd1, 0x10bf: 0x1f63, + // Block 0x43, offset 0x10c0 + 0x10c0: 0x1f68, 0x10c1: 0x1f4f, 0x10c2: 0x1f54, 0x10c3: 0x1f7c, 0x10c4: 0x1f81, 0x10c5: 0x1fea, + 0x10c6: 0x1fef, 0x10c7: 0x200d, 0x10c8: 0x2012, 0x10c9: 0x1fae, 0x10ca: 0x1fb3, 0x10cb: 0x1fb8, + 0x10cc: 0x1fc2, 0x10cd: 0x1fbd, 0x10ce: 0x1f95, 0x10cf: 0x1fe0, 0x10d0: 0x2003, 0x10d1: 0x2021, + 0x10d2: 0x2026, 0x10d3: 0x203a, 0x10d4: 0x203f, 0x10d5: 0x204e, 0x10d6: 0x2053, 0x10d7: 0x1fa4, + 0x10d8: 0x1fa9, 0x10d9: 0x1fcc, 0x10da: 0x1fd1, 0x10db: 0x1f63, 0x10dc: 0x1f68, 0x10dd: 0x1f4f, + 0x10de: 0x1f54, 0x10df: 0x1f7c, 0x10e0: 0x1f81, 0x10e1: 0x1fea, 0x10e2: 0x1fef, 0x10e3: 0x200d, + 0x10e4: 0x2012, 0x10e5: 0x1fae, 0x10e6: 0x1fb3, 0x10e7: 0x1fb8, 0x10e8: 0x1fc2, 0x10e9: 0x1fbd, + 0x10ea: 0x1f95, 0x10eb: 0x1fe0, 0x10ec: 0x2003, 0x10ed: 0x1fae, 0x10ee: 0x1fb3, 0x10ef: 0x1fb8, + 0x10f0: 0x1fc2, 0x10f1: 0x1f9f, 0x10f2: 0x1fc7, 0x10f3: 0x201c, 0x10f4: 0x1f86, 0x10f5: 0x1f8b, + 0x10f6: 0x1f90, 0x10f7: 0x1fae, 0x10f8: 0x1fb3, 0x10f9: 0x1fb8, 0x10fa: 0x201c, 0x10fb: 0x202b, + 0x10fc: 0x4549, 0x10fd: 0x4549, + // Block 0x44, offset 0x1100 + 0x1110: 0x2441, 0x1111: 0x2456, + 0x1112: 0x2456, 0x1113: 0x245d, 0x1114: 0x2464, 0x1115: 0x2479, 0x1116: 0x2480, 0x1117: 0x2487, + 0x1118: 0x24aa, 0x1119: 0x24aa, 0x111a: 0x24cd, 0x111b: 0x24c6, 0x111c: 0x24e2, 0x111d: 0x24d4, + 0x111e: 0x24db, 0x111f: 0x24fe, 0x1120: 0x24fe, 0x1121: 0x24f7, 0x1122: 0x2505, 0x1123: 0x2505, + 0x1124: 0x252f, 0x1125: 0x252f, 0x1126: 0x254b, 0x1127: 0x2513, 0x1128: 0x2513, 0x1129: 0x250c, + 0x112a: 0x2521, 0x112b: 0x2521, 0x112c: 0x2528, 0x112d: 0x2528, 0x112e: 0x2552, 0x112f: 0x2560, + 0x1130: 0x2560, 0x1131: 0x2567, 0x1132: 0x2567, 0x1133: 0x256e, 0x1134: 0x2575, 0x1135: 0x257c, + 0x1136: 0x2583, 0x1137: 0x2583, 0x1138: 0x258a, 0x1139: 0x2598, 0x113a: 0x25a6, 0x113b: 0x259f, + 0x113c: 0x25ad, 0x113d: 0x25ad, 0x113e: 0x25c2, 0x113f: 0x25c9, + // Block 0x45, offset 0x1140 + 0x1140: 0x25fa, 0x1141: 0x2608, 0x1142: 0x2601, 0x1143: 0x25e5, 0x1144: 0x25e5, 0x1145: 0x260f, + 0x1146: 0x260f, 0x1147: 0x2616, 0x1148: 0x2616, 0x1149: 0x2640, 0x114a: 0x2647, 0x114b: 0x264e, + 0x114c: 0x2624, 0x114d: 0x2632, 0x114e: 0x2655, 0x114f: 0x265c, + 0x1152: 0x262b, 0x1153: 0x26b0, 0x1154: 0x26b7, 0x1155: 0x268d, 0x1156: 0x2694, 0x1157: 0x2678, + 0x1158: 0x2678, 0x1159: 0x267f, 0x115a: 0x26a9, 0x115b: 0x26a2, 0x115c: 0x26cc, 0x115d: 0x26cc, + 0x115e: 0x243a, 0x115f: 0x244f, 0x1160: 0x2448, 0x1161: 0x2472, 0x1162: 0x246b, 0x1163: 0x2495, + 0x1164: 0x248e, 0x1165: 0x24b8, 0x1166: 0x249c, 0x1167: 0x24b1, 0x1168: 0x24e9, 0x1169: 0x2536, + 0x116a: 0x251a, 0x116b: 0x2559, 0x116c: 0x25f3, 0x116d: 0x261d, 0x116e: 0x26c5, 0x116f: 0x26be, + 0x1170: 0x26d3, 0x1171: 0x266a, 0x1172: 0x25d0, 0x1173: 0x269b, 0x1174: 0x25c2, 0x1175: 0x25fa, + 0x1176: 0x2591, 0x1177: 0x25de, 0x1178: 0x2671, 0x1179: 0x2663, 0x117a: 0x25ec, 0x117b: 0x25d7, + 0x117c: 0x25ec, 0x117d: 0x2671, 0x117e: 0x24a3, 0x117f: 0x24bf, + // Block 0x46, offset 0x1180 + 0x1180: 0x2639, 0x1181: 0x25b4, 0x1182: 0x2433, 0x1183: 0x25d7, 0x1184: 0x257c, 0x1185: 0x254b, + 0x1186: 0x24f0, 0x1187: 0x2686, + 0x11b0: 0x2544, 0x11b1: 0x25bb, 0x11b2: 0x28f6, 0x11b3: 0x28ed, 0x11b4: 0x2923, 0x11b5: 0x2911, + 0x11b6: 0x28ff, 0x11b7: 0x291a, 0x11b8: 0x292c, 0x11b9: 0x253d, 0x11ba: 0x2db3, 0x11bb: 0x2c33, + 0x11bc: 0x2908, + // Block 0x47, offset 0x11c0 + 0x11d0: 0x0019, 0x11d1: 0x057e, + 0x11d2: 0x0582, 0x11d3: 0x0035, 0x11d4: 0x0037, 0x11d5: 0x0003, 0x11d6: 0x003f, 0x11d7: 0x05ba, + 0x11d8: 0x05be, 0x11d9: 0x1c8c, + 0x11e0: 0x8133, 0x11e1: 0x8133, 0x11e2: 0x8133, 0x11e3: 0x8133, + 0x11e4: 0x8133, 0x11e5: 0x8133, 0x11e6: 0x8133, 0x11e7: 0x812e, 0x11e8: 0x812e, 0x11e9: 0x812e, + 0x11ea: 0x812e, 0x11eb: 0x812e, 0x11ec: 0x812e, 0x11ed: 0x812e, 0x11ee: 0x8133, 0x11ef: 0x8133, + 0x11f0: 0x19a0, 0x11f1: 0x053a, 0x11f2: 0x0536, 0x11f3: 0x007f, 0x11f4: 0x007f, 0x11f5: 0x0011, + 0x11f6: 0x0013, 0x11f7: 0x00b7, 0x11f8: 0x00bb, 0x11f9: 0x05b2, 0x11fa: 0x05b6, 0x11fb: 0x05a6, + 0x11fc: 0x05aa, 0x11fd: 0x058e, 0x11fe: 0x0592, 0x11ff: 0x0586, + // Block 0x48, offset 0x1200 + 0x1200: 0x058a, 0x1201: 0x0596, 0x1202: 0x059a, 0x1203: 0x059e, 0x1204: 0x05a2, + 0x1207: 0x0077, 0x1208: 0x007b, 0x1209: 0x43aa, 0x120a: 0x43aa, 0x120b: 0x43aa, + 0x120c: 0x43aa, 0x120d: 0x007f, 0x120e: 0x007f, 0x120f: 0x007f, 0x1210: 0x0019, 0x1211: 0x057e, + 0x1212: 0x001d, 0x1214: 0x0037, 0x1215: 0x0035, 0x1216: 0x003f, 0x1217: 0x0003, + 0x1218: 0x053a, 0x1219: 0x0011, 0x121a: 0x0013, 0x121b: 0x00b7, 0x121c: 0x00bb, 0x121d: 0x05b2, + 0x121e: 0x05b6, 0x121f: 0x0007, 0x1220: 0x000d, 0x1221: 0x0015, 0x1222: 0x0017, 0x1223: 0x001b, + 0x1224: 0x0039, 0x1225: 0x003d, 0x1226: 0x003b, 0x1228: 0x0079, 0x1229: 0x0009, + 0x122a: 0x000b, 0x122b: 0x0041, + 0x1230: 0x43eb, 0x1231: 0x456d, 0x1232: 0x43f0, 0x1234: 0x43f5, + 0x1236: 0x43fa, 0x1237: 0x4573, 0x1238: 0x43ff, 0x1239: 0x4579, 0x123a: 0x4404, 0x123b: 0x457f, + 0x123c: 0x4409, 0x123d: 0x4585, 0x123e: 0x440e, 0x123f: 0x458b, + // Block 0x49, offset 0x1240 + 0x1240: 0x0329, 0x1241: 0x454f, 0x1242: 0x454f, 0x1243: 0x4555, 0x1244: 0x4555, 0x1245: 0x4597, + 0x1246: 0x4597, 0x1247: 0x455b, 0x1248: 0x455b, 0x1249: 0x45a3, 0x124a: 0x45a3, 0x124b: 0x45a3, + 0x124c: 0x45a3, 0x124d: 0x032c, 0x124e: 0x032c, 0x124f: 0x032f, 0x1250: 0x032f, 0x1251: 0x032f, + 0x1252: 0x032f, 0x1253: 0x0332, 0x1254: 0x0332, 0x1255: 0x0335, 0x1256: 0x0335, 0x1257: 0x0335, + 0x1258: 0x0335, 0x1259: 0x0338, 0x125a: 0x0338, 0x125b: 0x0338, 0x125c: 0x0338, 0x125d: 0x033b, + 0x125e: 0x033b, 0x125f: 0x033b, 0x1260: 0x033b, 0x1261: 0x033e, 0x1262: 0x033e, 0x1263: 0x033e, + 0x1264: 0x033e, 0x1265: 0x0341, 0x1266: 0x0341, 0x1267: 0x0341, 0x1268: 0x0341, 0x1269: 0x0344, + 0x126a: 0x0344, 0x126b: 0x0347, 0x126c: 0x0347, 0x126d: 0x034a, 0x126e: 0x034a, 0x126f: 0x034d, + 0x1270: 0x034d, 0x1271: 0x0350, 0x1272: 0x0350, 0x1273: 0x0350, 0x1274: 0x0350, 0x1275: 0x0353, + 0x1276: 0x0353, 0x1277: 0x0353, 0x1278: 0x0353, 0x1279: 0x0356, 0x127a: 0x0356, 0x127b: 0x0356, + 0x127c: 0x0356, 0x127d: 0x0359, 0x127e: 0x0359, 0x127f: 0x0359, + // Block 0x4a, offset 0x1280 + 0x1280: 0x0359, 0x1281: 0x035c, 0x1282: 0x035c, 0x1283: 0x035c, 0x1284: 0x035c, 0x1285: 0x035f, + 0x1286: 0x035f, 0x1287: 0x035f, 0x1288: 0x035f, 0x1289: 0x0362, 0x128a: 0x0362, 0x128b: 0x0362, + 0x128c: 0x0362, 0x128d: 0x0365, 0x128e: 0x0365, 0x128f: 0x0365, 0x1290: 0x0365, 0x1291: 0x0368, + 0x1292: 0x0368, 0x1293: 0x0368, 0x1294: 0x0368, 0x1295: 0x036b, 0x1296: 0x036b, 0x1297: 0x036b, + 0x1298: 0x036b, 0x1299: 0x036e, 0x129a: 0x036e, 0x129b: 0x036e, 0x129c: 0x036e, 0x129d: 0x0371, + 0x129e: 0x0371, 0x129f: 0x0371, 0x12a0: 0x0371, 0x12a1: 0x0374, 0x12a2: 0x0374, 0x12a3: 0x0374, + 0x12a4: 0x0374, 0x12a5: 0x0377, 0x12a6: 0x0377, 0x12a7: 0x0377, 0x12a8: 0x0377, 0x12a9: 0x037a, + 0x12aa: 0x037a, 0x12ab: 0x037a, 0x12ac: 0x037a, 0x12ad: 0x037d, 0x12ae: 0x037d, 0x12af: 0x0380, + 0x12b0: 0x0380, 0x12b1: 0x0383, 0x12b2: 0x0383, 0x12b3: 0x0383, 0x12b4: 0x0383, 0x12b5: 0x2f41, + 0x12b6: 0x2f41, 0x12b7: 0x2f49, 0x12b8: 0x2f49, 0x12b9: 0x2f51, 0x12ba: 0x2f51, 0x12bb: 0x20b2, + 0x12bc: 0x20b2, + // Block 0x4b, offset 0x12c0 + 0x12c0: 0x0081, 0x12c1: 0x0083, 0x12c2: 0x0085, 0x12c3: 0x0087, 0x12c4: 0x0089, 0x12c5: 0x008b, + 0x12c6: 0x008d, 0x12c7: 0x008f, 0x12c8: 0x0091, 0x12c9: 0x0093, 0x12ca: 0x0095, 0x12cb: 0x0097, + 0x12cc: 0x0099, 0x12cd: 0x009b, 0x12ce: 0x009d, 0x12cf: 0x009f, 0x12d0: 0x00a1, 0x12d1: 0x00a3, + 0x12d2: 0x00a5, 0x12d3: 0x00a7, 0x12d4: 0x00a9, 0x12d5: 0x00ab, 0x12d6: 0x00ad, 0x12d7: 0x00af, + 0x12d8: 0x00b1, 0x12d9: 0x00b3, 0x12da: 0x00b5, 0x12db: 0x00b7, 0x12dc: 0x00b9, 0x12dd: 0x00bb, + 0x12de: 0x00bd, 0x12df: 0x056e, 0x12e0: 0x0572, 0x12e1: 0x0582, 0x12e2: 0x0596, 0x12e3: 0x059a, + 0x12e4: 0x057e, 0x12e5: 0x06a6, 0x12e6: 0x069e, 0x12e7: 0x05c2, 0x12e8: 0x05ca, 0x12e9: 0x05d2, + 0x12ea: 0x05da, 0x12eb: 0x05e2, 0x12ec: 0x0666, 0x12ed: 0x066e, 0x12ee: 0x0676, 0x12ef: 0x061a, + 0x12f0: 0x06aa, 0x12f1: 0x05c6, 0x12f2: 0x05ce, 0x12f3: 0x05d6, 0x12f4: 0x05de, 0x12f5: 0x05e6, + 0x12f6: 0x05ea, 0x12f7: 0x05ee, 0x12f8: 0x05f2, 0x12f9: 0x05f6, 0x12fa: 0x05fa, 0x12fb: 0x05fe, + 0x12fc: 0x0602, 0x12fd: 0x0606, 0x12fe: 0x060a, 0x12ff: 0x060e, + // Block 0x4c, offset 0x1300 + 0x1300: 0x0612, 0x1301: 0x0616, 0x1302: 0x061e, 0x1303: 0x0622, 0x1304: 0x0626, 0x1305: 0x062a, + 0x1306: 0x062e, 0x1307: 0x0632, 0x1308: 0x0636, 0x1309: 0x063a, 0x130a: 0x063e, 0x130b: 0x0642, + 0x130c: 0x0646, 0x130d: 0x064a, 0x130e: 0x064e, 0x130f: 0x0652, 0x1310: 0x0656, 0x1311: 0x065a, + 0x1312: 0x065e, 0x1313: 0x0662, 0x1314: 0x066a, 0x1315: 0x0672, 0x1316: 0x067a, 0x1317: 0x067e, + 0x1318: 0x0682, 0x1319: 0x0686, 0x131a: 0x068a, 0x131b: 0x068e, 0x131c: 0x0692, 0x131d: 0x06a2, + 0x131e: 0x4bb9, 0x131f: 0x4bbf, 0x1320: 0x04b6, 0x1321: 0x0406, 0x1322: 0x040a, 0x1323: 0x4b7c, + 0x1324: 0x040e, 0x1325: 0x4b82, 0x1326: 0x4b88, 0x1327: 0x0412, 0x1328: 0x0416, 0x1329: 0x041a, + 0x132a: 0x4b8e, 0x132b: 0x4b94, 0x132c: 0x4b9a, 0x132d: 0x4ba0, 0x132e: 0x4ba6, 0x132f: 0x4bac, + 0x1330: 0x045a, 0x1331: 0x041e, 0x1332: 0x0422, 0x1333: 0x0426, 0x1334: 0x046e, 0x1335: 0x042a, + 0x1336: 0x042e, 0x1337: 0x0432, 0x1338: 0x0436, 0x1339: 0x043a, 0x133a: 0x043e, 0x133b: 0x0442, + 0x133c: 0x0446, 0x133d: 0x044a, 0x133e: 0x044e, + // Block 0x4d, offset 0x1340 + 0x1342: 0x4afe, 0x1343: 0x4b04, 0x1344: 0x4b0a, 0x1345: 0x4b10, + 0x1346: 0x4b16, 0x1347: 0x4b1c, 0x134a: 0x4b22, 0x134b: 0x4b28, + 0x134c: 0x4b2e, 0x134d: 0x4b34, 0x134e: 0x4b3a, 0x134f: 0x4b40, + 0x1352: 0x4b46, 0x1353: 0x4b4c, 0x1354: 0x4b52, 0x1355: 0x4b58, 0x1356: 0x4b5e, 0x1357: 0x4b64, + 0x135a: 0x4b6a, 0x135b: 0x4b70, 0x135c: 0x4b76, + 0x1360: 0x00bf, 0x1361: 0x00c2, 0x1362: 0x00cb, 0x1363: 0x43a5, + 0x1364: 0x00c8, 0x1365: 0x00c5, 0x1366: 0x053e, 0x1368: 0x0562, 0x1369: 0x0542, + 0x136a: 0x0546, 0x136b: 0x054a, 0x136c: 0x054e, 0x136d: 0x0566, 0x136e: 0x056a, + // Block 0x4e, offset 0x1380 + 0x1381: 0x01f1, 0x1382: 0x01f4, 0x1383: 0x00d4, 0x1384: 0x01be, 0x1385: 0x010d, + 0x1387: 0x01d3, 0x1388: 0x174e, 0x1389: 0x01d9, 0x138a: 0x01d6, 0x138b: 0x0116, + 0x138c: 0x0119, 0x138d: 0x0526, 0x138e: 0x011c, 0x138f: 0x0128, 0x1390: 0x01e5, 0x1391: 0x013a, + 0x1392: 0x0134, 0x1393: 0x012e, 0x1394: 0x01c1, 0x1395: 0x00e0, 0x1396: 0x01c4, 0x1397: 0x0143, + 0x1398: 0x0194, 0x1399: 0x01e8, 0x139a: 0x01eb, 0x139b: 0x0152, 0x139c: 0x1756, 0x139d: 0x1742, + 0x139e: 0x0158, 0x139f: 0x175b, 0x13a0: 0x01a9, 0x13a1: 0x1760, 0x13a2: 0x00da, 0x13a3: 0x0170, + 0x13a4: 0x0173, 0x13a5: 0x00a3, 0x13a6: 0x017c, 0x13a7: 0x1765, 0x13a8: 0x0182, 0x13a9: 0x0185, + 0x13aa: 0x0188, 0x13ab: 0x01e2, 0x13ac: 0x01dc, 0x13ad: 0x1752, 0x13ae: 0x01df, 0x13af: 0x0197, + 0x13b0: 0x0576, 0x13b2: 0x01ac, 0x13b3: 0x01cd, 0x13b4: 0x01d0, 0x13b5: 0x01bb, + 0x13b6: 0x00f5, 0x13b7: 0x00f8, 0x13b8: 0x00fb, 0x13b9: 0x176a, 0x13ba: 0x176f, + // Block 0x4f, offset 0x13c0 + 0x13c0: 0x0063, 0x13c1: 0x0065, 0x13c2: 0x0067, 0x13c3: 0x0069, 0x13c4: 0x006b, 0x13c5: 0x006d, + 0x13c6: 0x006f, 0x13c7: 0x0071, 0x13c8: 0x0073, 0x13c9: 0x0075, 0x13ca: 0x0083, 0x13cb: 0x0085, + 0x13cc: 0x0087, 0x13cd: 0x0089, 0x13ce: 0x008b, 0x13cf: 0x008d, 0x13d0: 0x008f, 0x13d1: 0x0091, + 0x13d2: 0x0093, 0x13d3: 0x0095, 0x13d4: 0x0097, 0x13d5: 0x0099, 0x13d6: 0x009b, 0x13d7: 0x009d, + 0x13d8: 0x009f, 0x13d9: 0x00a1, 0x13da: 0x00a3, 0x13db: 0x00a5, 0x13dc: 0x00a7, 0x13dd: 0x00a9, + 0x13de: 0x00ab, 0x13df: 0x00ad, 0x13e0: 0x00af, 0x13e1: 0x00b1, 0x13e2: 0x00b3, 0x13e3: 0x00b5, + 0x13e4: 0x00e3, 0x13e5: 0x0101, 0x13e8: 0x01f7, 0x13e9: 0x01fa, + 0x13ea: 0x01fd, 0x13eb: 0x0200, 0x13ec: 0x0203, 0x13ed: 0x0206, 0x13ee: 0x0209, 0x13ef: 0x020c, + 0x13f0: 0x020f, 0x13f1: 0x0212, 0x13f2: 0x0215, 0x13f3: 0x0218, 0x13f4: 0x021b, 0x13f5: 0x021e, + 0x13f6: 0x0221, 0x13f7: 0x0224, 0x13f8: 0x0227, 0x13f9: 0x020c, 0x13fa: 0x022a, 0x13fb: 0x022d, + 0x13fc: 0x0230, 0x13fd: 0x0233, 0x13fe: 0x0236, 0x13ff: 0x0239, + // Block 0x50, offset 0x1400 + 0x1400: 0x0281, 0x1401: 0x0284, 0x1402: 0x0287, 0x1403: 0x0552, 0x1404: 0x024b, 0x1405: 0x0254, + 0x1406: 0x025a, 0x1407: 0x027e, 0x1408: 0x026f, 0x1409: 0x026c, 0x140a: 0x028a, 0x140b: 0x028d, + 0x140e: 0x0021, 0x140f: 0x0023, 0x1410: 0x0025, 0x1411: 0x0027, + 0x1412: 0x0029, 0x1413: 0x002b, 0x1414: 0x002d, 0x1415: 0x002f, 0x1416: 0x0031, 0x1417: 0x0033, + 0x1418: 0x0021, 0x1419: 0x0023, 0x141a: 0x0025, 0x141b: 0x0027, 0x141c: 0x0029, 0x141d: 0x002b, + 0x141e: 0x002d, 0x141f: 0x002f, 0x1420: 0x0031, 0x1421: 0x0033, 0x1422: 0x0021, 0x1423: 0x0023, + 0x1424: 0x0025, 0x1425: 0x0027, 0x1426: 0x0029, 0x1427: 0x002b, 0x1428: 0x002d, 0x1429: 0x002f, + 0x142a: 0x0031, 0x142b: 0x0033, 0x142c: 0x0021, 0x142d: 0x0023, 0x142e: 0x0025, 0x142f: 0x0027, + 0x1430: 0x0029, 0x1431: 0x002b, 0x1432: 0x002d, 0x1433: 0x002f, 0x1434: 0x0031, 0x1435: 0x0033, + 0x1436: 0x0021, 0x1437: 0x0023, 0x1438: 0x0025, 0x1439: 0x0027, 0x143a: 0x0029, 0x143b: 0x002b, + 0x143c: 0x002d, 0x143d: 0x002f, 0x143e: 0x0031, 0x143f: 0x0033, + // Block 0x51, offset 0x1440 + 0x1440: 0x8133, 0x1441: 0x8133, 0x1442: 0x8133, 0x1443: 0x8133, 0x1444: 0x8133, 0x1445: 0x8133, + 0x1446: 0x8133, 0x1448: 0x8133, 0x1449: 0x8133, 0x144a: 0x8133, 0x144b: 0x8133, + 0x144c: 0x8133, 0x144d: 0x8133, 0x144e: 0x8133, 0x144f: 0x8133, 0x1450: 0x8133, 0x1451: 0x8133, + 0x1452: 0x8133, 0x1453: 0x8133, 0x1454: 0x8133, 0x1455: 0x8133, 0x1456: 0x8133, 0x1457: 0x8133, + 0x1458: 0x8133, 0x145b: 0x8133, 0x145c: 0x8133, 0x145d: 0x8133, + 0x145e: 0x8133, 0x145f: 0x8133, 0x1460: 0x8133, 0x1461: 0x8133, 0x1463: 0x8133, + 0x1464: 0x8133, 0x1466: 0x8133, 0x1467: 0x8133, 0x1468: 0x8133, 0x1469: 0x8133, + 0x146a: 0x8133, + 0x1470: 0x0290, 0x1471: 0x0293, 0x1472: 0x0296, 0x1473: 0x0299, 0x1474: 0x029c, 0x1475: 0x029f, + 0x1476: 0x02a2, 0x1477: 0x02a5, 0x1478: 0x02a8, 0x1479: 0x02ab, 0x147a: 0x02ae, 0x147b: 0x02b1, + 0x147c: 0x02b7, 0x147d: 0x02ba, 0x147e: 0x02bd, 0x147f: 0x02c0, + // Block 0x52, offset 0x1480 + 0x1480: 0x02c3, 0x1481: 0x02c6, 0x1482: 0x02c9, 0x1483: 0x02cc, 0x1484: 0x02cf, 0x1485: 0x02d2, + 0x1486: 0x02d5, 0x1487: 0x02db, 0x1488: 0x02e1, 0x1489: 0x02e4, 0x148a: 0x1736, 0x148b: 0x0302, + 0x148c: 0x02ea, 0x148d: 0x02ed, 0x148e: 0x0305, 0x148f: 0x02f9, 0x1490: 0x02ff, 0x1491: 0x0290, + 0x1492: 0x0293, 0x1493: 0x0296, 0x1494: 0x0299, 0x1495: 0x029c, 0x1496: 0x029f, 0x1497: 0x02a2, + 0x1498: 0x02a5, 0x1499: 0x02a8, 0x149a: 0x02ab, 0x149b: 0x02ae, 0x149c: 0x02b7, 0x149d: 0x02ba, + 0x149e: 0x02c0, 0x149f: 0x02c6, 0x14a0: 0x02c9, 0x14a1: 0x02cc, 0x14a2: 0x02cf, 0x14a3: 0x02d2, + 0x14a4: 0x02d5, 0x14a5: 0x02d8, 0x14a6: 0x02db, 0x14a7: 0x02f3, 0x14a8: 0x02ea, 0x14a9: 0x02e7, + 0x14aa: 0x02f0, 0x14ab: 0x02f6, 0x14ac: 0x1732, 0x14ad: 0x02fc, + // Block 0x53, offset 0x14c0 + 0x14c0: 0x032c, 0x14c1: 0x032f, 0x14c2: 0x033b, 0x14c3: 0x0344, 0x14c5: 0x037d, + 0x14c6: 0x034d, 0x14c7: 0x033e, 0x14c8: 0x035c, 0x14c9: 0x0383, 0x14ca: 0x036e, 0x14cb: 0x0371, + 0x14cc: 0x0374, 0x14cd: 0x0377, 0x14ce: 0x0350, 0x14cf: 0x0362, 0x14d0: 0x0368, 0x14d1: 0x0356, + 0x14d2: 0x036b, 0x14d3: 0x034a, 0x14d4: 0x0353, 0x14d5: 0x0335, 0x14d6: 0x0338, 0x14d7: 0x0341, + 0x14d8: 0x0347, 0x14d9: 0x0359, 0x14da: 0x035f, 0x14db: 0x0365, 0x14dc: 0x0386, 0x14dd: 0x03d7, + 0x14de: 0x03bf, 0x14df: 0x0389, 0x14e1: 0x032f, 0x14e2: 0x033b, + 0x14e4: 0x037a, 0x14e7: 0x033e, 0x14e9: 0x0383, + 0x14ea: 0x036e, 0x14eb: 0x0371, 0x14ec: 0x0374, 0x14ed: 0x0377, 0x14ee: 0x0350, 0x14ef: 0x0362, + 0x14f0: 0x0368, 0x14f1: 0x0356, 0x14f2: 0x036b, 0x14f4: 0x0353, 0x14f5: 0x0335, + 0x14f6: 0x0338, 0x14f7: 0x0341, 0x14f9: 0x0359, 0x14fb: 0x0365, + // Block 0x54, offset 0x1500 + 0x1502: 0x033b, + 0x1507: 0x033e, 0x1509: 0x0383, 0x150b: 0x0371, + 0x150d: 0x0377, 0x150e: 0x0350, 0x150f: 0x0362, 0x1511: 0x0356, + 0x1512: 0x036b, 0x1514: 0x0353, 0x1517: 0x0341, + 0x1519: 0x0359, 0x151b: 0x0365, 0x151d: 0x03d7, + 0x151f: 0x0389, 0x1521: 0x032f, 0x1522: 0x033b, + 0x1524: 0x037a, 0x1527: 0x033e, 0x1528: 0x035c, 0x1529: 0x0383, + 0x152a: 0x036e, 0x152c: 0x0374, 0x152d: 0x0377, 0x152e: 0x0350, 0x152f: 0x0362, + 0x1530: 0x0368, 0x1531: 0x0356, 0x1532: 0x036b, 0x1534: 0x0353, 0x1535: 0x0335, + 0x1536: 0x0338, 0x1537: 0x0341, 0x1539: 0x0359, 0x153a: 0x035f, 0x153b: 0x0365, + 0x153c: 0x0386, 0x153e: 0x03bf, + // Block 0x55, offset 0x1540 + 0x1540: 0x032c, 0x1541: 0x032f, 0x1542: 0x033b, 0x1543: 0x0344, 0x1544: 0x037a, 0x1545: 0x037d, + 0x1546: 0x034d, 0x1547: 0x033e, 0x1548: 0x035c, 0x1549: 0x0383, 0x154b: 0x0371, + 0x154c: 0x0374, 0x154d: 0x0377, 0x154e: 0x0350, 0x154f: 0x0362, 0x1550: 0x0368, 0x1551: 0x0356, + 0x1552: 0x036b, 0x1553: 0x034a, 0x1554: 0x0353, 0x1555: 0x0335, 0x1556: 0x0338, 0x1557: 0x0341, + 0x1558: 0x0347, 0x1559: 0x0359, 0x155a: 0x035f, 0x155b: 0x0365, + 0x1561: 0x032f, 0x1562: 0x033b, 0x1563: 0x0344, + 0x1565: 0x037d, 0x1566: 0x034d, 0x1567: 0x033e, 0x1568: 0x035c, 0x1569: 0x0383, + 0x156b: 0x0371, 0x156c: 0x0374, 0x156d: 0x0377, 0x156e: 0x0350, 0x156f: 0x0362, + 0x1570: 0x0368, 0x1571: 0x0356, 0x1572: 0x036b, 0x1573: 0x034a, 0x1574: 0x0353, 0x1575: 0x0335, + 0x1576: 0x0338, 0x1577: 0x0341, 0x1578: 0x0347, 0x1579: 0x0359, 0x157a: 0x035f, 0x157b: 0x0365, + // Block 0x56, offset 0x1580 + 0x1580: 0x19a6, 0x1581: 0x19a3, 0x1582: 0x19a9, 0x1583: 0x19cd, 0x1584: 0x19f1, 0x1585: 0x1a15, + 0x1586: 0x1a39, 0x1587: 0x1a42, 0x1588: 0x1a48, 0x1589: 0x1a4e, 0x158a: 0x1a54, + 0x1590: 0x1bbc, 0x1591: 0x1bc0, + 0x1592: 0x1bc4, 0x1593: 0x1bc8, 0x1594: 0x1bcc, 0x1595: 0x1bd0, 0x1596: 0x1bd4, 0x1597: 0x1bd8, + 0x1598: 0x1bdc, 0x1599: 0x1be0, 0x159a: 0x1be4, 0x159b: 0x1be8, 0x159c: 0x1bec, 0x159d: 0x1bf0, + 0x159e: 0x1bf4, 0x159f: 0x1bf8, 0x15a0: 0x1bfc, 0x15a1: 0x1c00, 0x15a2: 0x1c04, 0x15a3: 0x1c08, + 0x15a4: 0x1c0c, 0x15a5: 0x1c10, 0x15a6: 0x1c14, 0x15a7: 0x1c18, 0x15a8: 0x1c1c, 0x15a9: 0x1c20, + 0x15aa: 0x2855, 0x15ab: 0x0047, 0x15ac: 0x0065, 0x15ad: 0x1a69, 0x15ae: 0x1ae1, + 0x15b0: 0x0043, 0x15b1: 0x0045, 0x15b2: 0x0047, 0x15b3: 0x0049, 0x15b4: 0x004b, 0x15b5: 0x004d, + 0x15b6: 0x004f, 0x15b7: 0x0051, 0x15b8: 0x0053, 0x15b9: 0x0055, 0x15ba: 0x0057, 0x15bb: 0x0059, + 0x15bc: 0x005b, 0x15bd: 0x005d, 0x15be: 0x005f, 0x15bf: 0x0061, + // Block 0x57, offset 0x15c0 + 0x15c0: 0x27dd, 0x15c1: 0x27f2, 0x15c2: 0x05fe, + 0x15d0: 0x0d0a, 0x15d1: 0x0b42, + 0x15d2: 0x09ce, 0x15d3: 0x4705, 0x15d4: 0x0816, 0x15d5: 0x0aea, 0x15d6: 0x142a, 0x15d7: 0x0afa, + 0x15d8: 0x0822, 0x15d9: 0x0dd2, 0x15da: 0x0faa, 0x15db: 0x0daa, 0x15dc: 0x0922, 0x15dd: 0x0c66, + 0x15de: 0x08ba, 0x15df: 0x0db2, 0x15e0: 0x090e, 0x15e1: 0x1212, 0x15e2: 0x107e, 0x15e3: 0x1486, + 0x15e4: 0x0ace, 0x15e5: 0x0a06, 0x15e6: 0x0f5e, 0x15e7: 0x0d16, 0x15e8: 0x0d42, 0x15e9: 0x07ba, + 0x15ea: 0x07c6, 0x15eb: 0x1506, 0x15ec: 0x0bd6, 0x15ed: 0x07e2, 0x15ee: 0x09ea, 0x15ef: 0x0d36, + 0x15f0: 0x14ae, 0x15f1: 0x0d0e, 0x15f2: 0x116a, 0x15f3: 0x11a6, 0x15f4: 0x09f2, 0x15f5: 0x0f3e, + 0x15f6: 0x0e06, 0x15f7: 0x0e02, 0x15f8: 0x1092, 0x15f9: 0x0926, 0x15fa: 0x0a52, 0x15fb: 0x153e, + // Block 0x58, offset 0x1600 + 0x1600: 0x07f6, 0x1601: 0x07ee, 0x1602: 0x07fe, 0x1603: 0x1774, 0x1604: 0x0842, 0x1605: 0x0852, + 0x1606: 0x0856, 0x1607: 0x085e, 0x1608: 0x0866, 0x1609: 0x086a, 0x160a: 0x0876, 0x160b: 0x086e, + 0x160c: 0x06ae, 0x160d: 0x1788, 0x160e: 0x088a, 0x160f: 0x088e, 0x1610: 0x0892, 0x1611: 0x08ae, + 0x1612: 0x1779, 0x1613: 0x06b2, 0x1614: 0x089a, 0x1615: 0x08ba, 0x1616: 0x1783, 0x1617: 0x08ca, + 0x1618: 0x08d2, 0x1619: 0x0832, 0x161a: 0x08da, 0x161b: 0x08de, 0x161c: 0x195e, 0x161d: 0x08fa, + 0x161e: 0x0902, 0x161f: 0x06ba, 0x1620: 0x091a, 0x1621: 0x091e, 0x1622: 0x0926, 0x1623: 0x092a, + 0x1624: 0x06be, 0x1625: 0x0942, 0x1626: 0x0946, 0x1627: 0x0952, 0x1628: 0x095e, 0x1629: 0x0962, + 0x162a: 0x0966, 0x162b: 0x096e, 0x162c: 0x098e, 0x162d: 0x0992, 0x162e: 0x099a, 0x162f: 0x09aa, + 0x1630: 0x09b2, 0x1631: 0x09b6, 0x1632: 0x09b6, 0x1633: 0x09b6, 0x1634: 0x1797, 0x1635: 0x0f8e, + 0x1636: 0x09ca, 0x1637: 0x09d2, 0x1638: 0x179c, 0x1639: 0x09de, 0x163a: 0x09e6, 0x163b: 0x09ee, + 0x163c: 0x0a16, 0x163d: 0x0a02, 0x163e: 0x0a0e, 0x163f: 0x0a12, + // Block 0x59, offset 0x1640 + 0x1640: 0x0a1a, 0x1641: 0x0a22, 0x1642: 0x0a26, 0x1643: 0x0a2e, 0x1644: 0x0a36, 0x1645: 0x0a3a, + 0x1646: 0x0a3a, 0x1647: 0x0a42, 0x1648: 0x0a4a, 0x1649: 0x0a4e, 0x164a: 0x0a5a, 0x164b: 0x0a7e, + 0x164c: 0x0a62, 0x164d: 0x0a82, 0x164e: 0x0a66, 0x164f: 0x0a6e, 0x1650: 0x0906, 0x1651: 0x0aca, + 0x1652: 0x0a92, 0x1653: 0x0a96, 0x1654: 0x0a9a, 0x1655: 0x0a8e, 0x1656: 0x0aa2, 0x1657: 0x0a9e, + 0x1658: 0x0ab6, 0x1659: 0x17a1, 0x165a: 0x0ad2, 0x165b: 0x0ad6, 0x165c: 0x0ade, 0x165d: 0x0aea, + 0x165e: 0x0af2, 0x165f: 0x0b0e, 0x1660: 0x17a6, 0x1661: 0x17ab, 0x1662: 0x0b1a, 0x1663: 0x0b1e, + 0x1664: 0x0b22, 0x1665: 0x0b16, 0x1666: 0x0b2a, 0x1667: 0x06c2, 0x1668: 0x06c6, 0x1669: 0x0b32, + 0x166a: 0x0b3a, 0x166b: 0x0b3a, 0x166c: 0x17b0, 0x166d: 0x0b56, 0x166e: 0x0b5a, 0x166f: 0x0b5e, + 0x1670: 0x0b66, 0x1671: 0x17b5, 0x1672: 0x0b6e, 0x1673: 0x0b72, 0x1674: 0x0c4a, 0x1675: 0x0b7a, + 0x1676: 0x06ca, 0x1677: 0x0b86, 0x1678: 0x0b96, 0x1679: 0x0ba2, 0x167a: 0x0b9e, 0x167b: 0x17bf, + 0x167c: 0x0baa, 0x167d: 0x17c4, 0x167e: 0x0bb6, 0x167f: 0x0bb2, + // Block 0x5a, offset 0x1680 + 0x1680: 0x0bba, 0x1681: 0x0bca, 0x1682: 0x0bce, 0x1683: 0x06ce, 0x1684: 0x0bde, 0x1685: 0x0be6, + 0x1686: 0x0bea, 0x1687: 0x0bee, 0x1688: 0x06d2, 0x1689: 0x17c9, 0x168a: 0x06d6, 0x168b: 0x0c0a, + 0x168c: 0x0c0e, 0x168d: 0x0c12, 0x168e: 0x0c1a, 0x168f: 0x1990, 0x1690: 0x0c32, 0x1691: 0x17d3, + 0x1692: 0x17d3, 0x1693: 0x12d2, 0x1694: 0x0c42, 0x1695: 0x0c42, 0x1696: 0x06da, 0x1697: 0x17f6, + 0x1698: 0x18c8, 0x1699: 0x0c52, 0x169a: 0x0c5a, 0x169b: 0x06de, 0x169c: 0x0c6e, 0x169d: 0x0c7e, + 0x169e: 0x0c82, 0x169f: 0x0c8a, 0x16a0: 0x0c9a, 0x16a1: 0x06e6, 0x16a2: 0x06e2, 0x16a3: 0x0c9e, + 0x16a4: 0x17d8, 0x16a5: 0x0ca2, 0x16a6: 0x0cb6, 0x16a7: 0x0cba, 0x16a8: 0x0cbe, 0x16a9: 0x0cba, + 0x16aa: 0x0cca, 0x16ab: 0x0cce, 0x16ac: 0x0cde, 0x16ad: 0x0cd6, 0x16ae: 0x0cda, 0x16af: 0x0ce2, + 0x16b0: 0x0ce6, 0x16b1: 0x0cea, 0x16b2: 0x0cf6, 0x16b3: 0x0cfa, 0x16b4: 0x0d12, 0x16b5: 0x0d1a, + 0x16b6: 0x0d2a, 0x16b7: 0x0d3e, 0x16b8: 0x17e7, 0x16b9: 0x0d3a, 0x16ba: 0x0d2e, 0x16bb: 0x0d46, + 0x16bc: 0x0d4e, 0x16bd: 0x0d62, 0x16be: 0x17ec, 0x16bf: 0x0d6a, + // Block 0x5b, offset 0x16c0 + 0x16c0: 0x0d5e, 0x16c1: 0x0d56, 0x16c2: 0x06ea, 0x16c3: 0x0d72, 0x16c4: 0x0d7a, 0x16c5: 0x0d82, + 0x16c6: 0x0d76, 0x16c7: 0x06ee, 0x16c8: 0x0d92, 0x16c9: 0x0d9a, 0x16ca: 0x17f1, 0x16cb: 0x0dc6, + 0x16cc: 0x0dfa, 0x16cd: 0x0dd6, 0x16ce: 0x06fa, 0x16cf: 0x0de2, 0x16d0: 0x06f6, 0x16d1: 0x06f2, + 0x16d2: 0x08be, 0x16d3: 0x08c2, 0x16d4: 0x0dfe, 0x16d5: 0x0de6, 0x16d6: 0x12a6, 0x16d7: 0x075e, + 0x16d8: 0x0e0a, 0x16d9: 0x0e0e, 0x16da: 0x0e12, 0x16db: 0x0e26, 0x16dc: 0x0e1e, 0x16dd: 0x180a, + 0x16de: 0x06fe, 0x16df: 0x0e3a, 0x16e0: 0x0e2e, 0x16e1: 0x0e4a, 0x16e2: 0x0e52, 0x16e3: 0x1814, + 0x16e4: 0x0e56, 0x16e5: 0x0e42, 0x16e6: 0x0e5e, 0x16e7: 0x0702, 0x16e8: 0x0e62, 0x16e9: 0x0e66, + 0x16ea: 0x0e6a, 0x16eb: 0x0e76, 0x16ec: 0x1819, 0x16ed: 0x0e7e, 0x16ee: 0x0706, 0x16ef: 0x0e8a, + 0x16f0: 0x181e, 0x16f1: 0x0e8e, 0x16f2: 0x070a, 0x16f3: 0x0e9a, 0x16f4: 0x0ea6, 0x16f5: 0x0eb2, + 0x16f6: 0x0eb6, 0x16f7: 0x1823, 0x16f8: 0x17ba, 0x16f9: 0x1828, 0x16fa: 0x0ed6, 0x16fb: 0x182d, + 0x16fc: 0x0ee2, 0x16fd: 0x0eea, 0x16fe: 0x0eda, 0x16ff: 0x0ef6, + // Block 0x5c, offset 0x1700 + 0x1700: 0x0f06, 0x1701: 0x0f16, 0x1702: 0x0f0a, 0x1703: 0x0f0e, 0x1704: 0x0f1a, 0x1705: 0x0f1e, + 0x1706: 0x1832, 0x1707: 0x0f02, 0x1708: 0x0f36, 0x1709: 0x0f3a, 0x170a: 0x070e, 0x170b: 0x0f4e, + 0x170c: 0x0f4a, 0x170d: 0x1837, 0x170e: 0x0f2e, 0x170f: 0x0f6a, 0x1710: 0x183c, 0x1711: 0x1841, + 0x1712: 0x0f6e, 0x1713: 0x0f82, 0x1714: 0x0f7e, 0x1715: 0x0f7a, 0x1716: 0x0712, 0x1717: 0x0f86, + 0x1718: 0x0f96, 0x1719: 0x0f92, 0x171a: 0x0f9e, 0x171b: 0x177e, 0x171c: 0x0fae, 0x171d: 0x1846, + 0x171e: 0x0fba, 0x171f: 0x1850, 0x1720: 0x0fce, 0x1721: 0x0fda, 0x1722: 0x0fee, 0x1723: 0x1855, + 0x1724: 0x1002, 0x1725: 0x1006, 0x1726: 0x185a, 0x1727: 0x185f, 0x1728: 0x1022, 0x1729: 0x1032, + 0x172a: 0x0716, 0x172b: 0x1036, 0x172c: 0x071a, 0x172d: 0x071a, 0x172e: 0x104e, 0x172f: 0x1052, + 0x1730: 0x105a, 0x1731: 0x105e, 0x1732: 0x106a, 0x1733: 0x071e, 0x1734: 0x1082, 0x1735: 0x1864, + 0x1736: 0x109e, 0x1737: 0x1869, 0x1738: 0x10aa, 0x1739: 0x17ce, 0x173a: 0x10ba, 0x173b: 0x186e, + 0x173c: 0x1873, 0x173d: 0x1878, 0x173e: 0x0722, 0x173f: 0x0726, + // Block 0x5d, offset 0x1740 + 0x1740: 0x10f2, 0x1741: 0x1882, 0x1742: 0x187d, 0x1743: 0x1887, 0x1744: 0x188c, 0x1745: 0x10fa, + 0x1746: 0x10fe, 0x1747: 0x10fe, 0x1748: 0x1106, 0x1749: 0x072e, 0x174a: 0x110a, 0x174b: 0x0732, + 0x174c: 0x0736, 0x174d: 0x1896, 0x174e: 0x111e, 0x174f: 0x1126, 0x1750: 0x1132, 0x1751: 0x073a, + 0x1752: 0x189b, 0x1753: 0x1156, 0x1754: 0x18a0, 0x1755: 0x18a5, 0x1756: 0x1176, 0x1757: 0x118e, + 0x1758: 0x073e, 0x1759: 0x1196, 0x175a: 0x119a, 0x175b: 0x119e, 0x175c: 0x18aa, 0x175d: 0x18af, + 0x175e: 0x18af, 0x175f: 0x11b6, 0x1760: 0x0742, 0x1761: 0x18b4, 0x1762: 0x11ca, 0x1763: 0x11ce, + 0x1764: 0x0746, 0x1765: 0x18b9, 0x1766: 0x11ea, 0x1767: 0x074a, 0x1768: 0x11fa, 0x1769: 0x11f2, + 0x176a: 0x1202, 0x176b: 0x18c3, 0x176c: 0x121a, 0x176d: 0x074e, 0x176e: 0x1226, 0x176f: 0x122e, + 0x1770: 0x123e, 0x1771: 0x0752, 0x1772: 0x18cd, 0x1773: 0x18d2, 0x1774: 0x0756, 0x1775: 0x18d7, + 0x1776: 0x1256, 0x1777: 0x18dc, 0x1778: 0x1262, 0x1779: 0x126e, 0x177a: 0x1276, 0x177b: 0x18e1, + 0x177c: 0x18e6, 0x177d: 0x128a, 0x177e: 0x18eb, 0x177f: 0x1292, + // Block 0x5e, offset 0x1780 + 0x1780: 0x17fb, 0x1781: 0x075a, 0x1782: 0x12aa, 0x1783: 0x12ae, 0x1784: 0x0762, 0x1785: 0x12b2, + 0x1786: 0x0b2e, 0x1787: 0x18f0, 0x1788: 0x18f5, 0x1789: 0x1800, 0x178a: 0x1805, 0x178b: 0x12d2, + 0x178c: 0x12d6, 0x178d: 0x14ee, 0x178e: 0x0766, 0x178f: 0x1302, 0x1790: 0x12fe, 0x1791: 0x1306, + 0x1792: 0x093a, 0x1793: 0x130a, 0x1794: 0x130e, 0x1795: 0x1312, 0x1796: 0x131a, 0x1797: 0x18fa, + 0x1798: 0x1316, 0x1799: 0x131e, 0x179a: 0x1332, 0x179b: 0x1336, 0x179c: 0x1322, 0x179d: 0x133a, + 0x179e: 0x134e, 0x179f: 0x1362, 0x17a0: 0x132e, 0x17a1: 0x1342, 0x17a2: 0x1346, 0x17a3: 0x134a, + 0x17a4: 0x18ff, 0x17a5: 0x1909, 0x17a6: 0x1904, 0x17a7: 0x076a, 0x17a8: 0x136a, 0x17a9: 0x136e, + 0x17aa: 0x1376, 0x17ab: 0x191d, 0x17ac: 0x137a, 0x17ad: 0x190e, 0x17ae: 0x076e, 0x17af: 0x0772, + 0x17b0: 0x1913, 0x17b1: 0x1918, 0x17b2: 0x0776, 0x17b3: 0x139a, 0x17b4: 0x139e, 0x17b5: 0x13a2, + 0x17b6: 0x13a6, 0x17b7: 0x13b2, 0x17b8: 0x13ae, 0x17b9: 0x13ba, 0x17ba: 0x13b6, 0x17bb: 0x13c6, + 0x17bc: 0x13be, 0x17bd: 0x13c2, 0x17be: 0x13ca, 0x17bf: 0x077a, + // Block 0x5f, offset 0x17c0 + 0x17c0: 0x13d2, 0x17c1: 0x13d6, 0x17c2: 0x077e, 0x17c3: 0x13e6, 0x17c4: 0x13ea, 0x17c5: 0x1922, + 0x17c6: 0x13f6, 0x17c7: 0x13fa, 0x17c8: 0x0782, 0x17c9: 0x1406, 0x17ca: 0x06b6, 0x17cb: 0x1927, + 0x17cc: 0x192c, 0x17cd: 0x0786, 0x17ce: 0x078a, 0x17cf: 0x1432, 0x17d0: 0x144a, 0x17d1: 0x1466, + 0x17d2: 0x1476, 0x17d3: 0x1931, 0x17d4: 0x148a, 0x17d5: 0x148e, 0x17d6: 0x14a6, 0x17d7: 0x14b2, + 0x17d8: 0x193b, 0x17d9: 0x178d, 0x17da: 0x14be, 0x17db: 0x14ba, 0x17dc: 0x14c6, 0x17dd: 0x1792, + 0x17de: 0x14d2, 0x17df: 0x14de, 0x17e0: 0x1940, 0x17e1: 0x1945, 0x17e2: 0x151e, 0x17e3: 0x152a, + 0x17e4: 0x1532, 0x17e5: 0x194a, 0x17e6: 0x1536, 0x17e7: 0x1562, 0x17e8: 0x156e, 0x17e9: 0x1572, + 0x17ea: 0x156a, 0x17eb: 0x157e, 0x17ec: 0x1582, 0x17ed: 0x194f, 0x17ee: 0x158e, 0x17ef: 0x078e, + 0x17f0: 0x1596, 0x17f1: 0x1954, 0x17f2: 0x0792, 0x17f3: 0x15ce, 0x17f4: 0x0bbe, 0x17f5: 0x15e6, + 0x17f6: 0x1959, 0x17f7: 0x1963, 0x17f8: 0x0796, 0x17f9: 0x079a, 0x17fa: 0x160e, 0x17fb: 0x1968, + 0x17fc: 0x079e, 0x17fd: 0x196d, 0x17fe: 0x1626, 0x17ff: 0x1626, + // Block 0x60, offset 0x1800 + 0x1800: 0x162e, 0x1801: 0x1972, 0x1802: 0x1646, 0x1803: 0x07a2, 0x1804: 0x1656, 0x1805: 0x1662, + 0x1806: 0x166a, 0x1807: 0x1672, 0x1808: 0x07a6, 0x1809: 0x1977, 0x180a: 0x1686, 0x180b: 0x16a2, + 0x180c: 0x16ae, 0x180d: 0x07aa, 0x180e: 0x07ae, 0x180f: 0x16b2, 0x1810: 0x197c, 0x1811: 0x07b2, + 0x1812: 0x1981, 0x1813: 0x1986, 0x1814: 0x198b, 0x1815: 0x16d6, 0x1816: 0x07b6, 0x1817: 0x16ea, + 0x1818: 0x16f2, 0x1819: 0x16f6, 0x181a: 0x16fe, 0x181b: 0x1706, 0x181c: 0x170e, 0x181d: 0x1995, +} + +// nfkcIndex: 22 blocks, 1408 entries, 2816 bytes +// Block 0 is the zero block. +var nfkcIndex = [1408]uint16{ + // Block 0x0, offset 0x0 + // Block 0x1, offset 0x40 + // Block 0x2, offset 0x80 + // Block 0x3, offset 0xc0 + 0xc2: 0x5f, 0xc3: 0x01, 0xc4: 0x02, 0xc5: 0x03, 0xc6: 0x60, 0xc7: 0x04, + 0xc8: 0x05, 0xca: 0x61, 0xcb: 0x62, 0xcc: 0x06, 0xcd: 0x07, 0xce: 0x08, 0xcf: 0x09, + 0xd0: 0x0a, 0xd1: 0x63, 0xd2: 0x64, 0xd3: 0x0b, 0xd6: 0x0c, 0xd7: 0x65, + 0xd8: 0x66, 0xd9: 0x0d, 0xdb: 0x67, 0xdc: 0x68, 0xdd: 0x69, 0xdf: 0x6a, + 0xe0: 0x02, 0xe1: 0x03, 0xe2: 0x04, 0xe3: 0x05, + 0xea: 0x06, 0xeb: 0x07, 0xec: 0x08, 0xed: 0x09, 0xef: 0x0a, + 0xf0: 0x13, + // Block 0x4, offset 0x100 + 0x120: 0x6b, 0x121: 0x6c, 0x122: 0x6d, 0x123: 0x0e, 0x124: 0x6e, 0x125: 0x6f, 0x126: 0x70, 0x127: 0x71, + 0x128: 0x72, 0x129: 0x73, 0x12a: 0x74, 0x12b: 0x75, 0x12c: 0x70, 0x12d: 0x76, 0x12e: 0x77, 0x12f: 0x78, + 0x130: 0x74, 0x131: 0x79, 0x132: 0x7a, 0x133: 0x7b, 0x134: 0x7c, 0x135: 0x7d, 0x137: 0x7e, + 0x138: 0x7f, 0x139: 0x80, 0x13a: 0x81, 0x13b: 0x82, 0x13c: 0x83, 0x13d: 0x84, 0x13e: 0x85, 0x13f: 0x86, + // Block 0x5, offset 0x140 + 0x140: 0x87, 0x142: 0x88, 0x143: 0x89, 0x144: 0x8a, 0x145: 0x8b, 0x146: 0x8c, 0x147: 0x8d, + 0x14d: 0x8e, + 0x15c: 0x8f, 0x15f: 0x90, + 0x162: 0x91, 0x164: 0x92, + 0x168: 0x93, 0x169: 0x94, 0x16a: 0x95, 0x16b: 0x96, 0x16c: 0x0f, 0x16d: 0x97, 0x16e: 0x98, 0x16f: 0x99, + 0x170: 0x9a, 0x173: 0x9b, 0x174: 0x9c, 0x175: 0x10, 0x176: 0x11, 0x177: 0x12, + 0x178: 0x13, 0x179: 0x14, 0x17a: 0x15, 0x17b: 0x16, 0x17c: 0x17, 0x17d: 0x18, 0x17e: 0x19, 0x17f: 0x1a, + // Block 0x6, offset 0x180 + 0x180: 0x9d, 0x181: 0x9e, 0x182: 0x9f, 0x183: 0xa0, 0x184: 0x1b, 0x185: 0x1c, 0x186: 0xa1, 0x187: 0xa2, + 0x188: 0xa3, 0x189: 0x1d, 0x18a: 0x1e, 0x18b: 0xa4, 0x18c: 0xa5, + 0x191: 0x1f, 0x192: 0x20, 0x193: 0xa6, + 0x1a8: 0xa7, 0x1a9: 0xa8, 0x1ab: 0xa9, + 0x1b1: 0xaa, 0x1b3: 0xab, 0x1b5: 0xac, 0x1b7: 0xad, + 0x1ba: 0xae, 0x1bb: 0xaf, 0x1bc: 0x21, 0x1bd: 0x22, 0x1be: 0x23, 0x1bf: 0xb0, + // Block 0x7, offset 0x1c0 + 0x1c0: 0xb1, 0x1c1: 0x24, 0x1c2: 0x25, 0x1c3: 0x26, 0x1c4: 0xb2, 0x1c5: 0x27, 0x1c6: 0x28, + 0x1c8: 0x29, 0x1c9: 0x2a, 0x1ca: 0x2b, 0x1cb: 0x2c, 0x1cc: 0x2d, 0x1cd: 0x2e, 0x1ce: 0x2f, 0x1cf: 0x30, + // Block 0x8, offset 0x200 + 0x219: 0xb3, 0x21a: 0xb4, 0x21b: 0xb5, 0x21d: 0xb6, 0x21f: 0xb7, + 0x220: 0xb8, 0x223: 0xb9, 0x224: 0xba, 0x225: 0xbb, 0x226: 0xbc, 0x227: 0xbd, + 0x22a: 0xbe, 0x22b: 0xbf, 0x22d: 0xc0, 0x22f: 0xc1, + 0x230: 0xc2, 0x231: 0xc3, 0x232: 0xc4, 0x233: 0xc5, 0x234: 0xc6, 0x235: 0xc7, 0x236: 0xc8, 0x237: 0xc2, + 0x238: 0xc3, 0x239: 0xc4, 0x23a: 0xc5, 0x23b: 0xc6, 0x23c: 0xc7, 0x23d: 0xc8, 0x23e: 0xc2, 0x23f: 0xc3, + // Block 0x9, offset 0x240 + 0x240: 0xc4, 0x241: 0xc5, 0x242: 0xc6, 0x243: 0xc7, 0x244: 0xc8, 0x245: 0xc2, 0x246: 0xc3, 0x247: 0xc4, + 0x248: 0xc5, 0x249: 0xc6, 0x24a: 0xc7, 0x24b: 0xc8, 0x24c: 0xc2, 0x24d: 0xc3, 0x24e: 0xc4, 0x24f: 0xc5, + 0x250: 0xc6, 0x251: 0xc7, 0x252: 0xc8, 0x253: 0xc2, 0x254: 0xc3, 0x255: 0xc4, 0x256: 0xc5, 0x257: 0xc6, + 0x258: 0xc7, 0x259: 0xc8, 0x25a: 0xc2, 0x25b: 0xc3, 0x25c: 0xc4, 0x25d: 0xc5, 0x25e: 0xc6, 0x25f: 0xc7, + 0x260: 0xc8, 0x261: 0xc2, 0x262: 0xc3, 0x263: 0xc4, 0x264: 0xc5, 0x265: 0xc6, 0x266: 0xc7, 0x267: 0xc8, + 0x268: 0xc2, 0x269: 0xc3, 0x26a: 0xc4, 0x26b: 0xc5, 0x26c: 0xc6, 0x26d: 0xc7, 0x26e: 0xc8, 0x26f: 0xc2, + 0x270: 0xc3, 0x271: 0xc4, 0x272: 0xc5, 0x273: 0xc6, 0x274: 0xc7, 0x275: 0xc8, 0x276: 0xc2, 0x277: 0xc3, + 0x278: 0xc4, 0x279: 0xc5, 0x27a: 0xc6, 0x27b: 0xc7, 0x27c: 0xc8, 0x27d: 0xc2, 0x27e: 0xc3, 0x27f: 0xc4, + // Block 0xa, offset 0x280 + 0x280: 0xc5, 0x281: 0xc6, 0x282: 0xc7, 0x283: 0xc8, 0x284: 0xc2, 0x285: 0xc3, 0x286: 0xc4, 0x287: 0xc5, + 0x288: 0xc6, 0x289: 0xc7, 0x28a: 0xc8, 0x28b: 0xc2, 0x28c: 0xc3, 0x28d: 0xc4, 0x28e: 0xc5, 0x28f: 0xc6, + 0x290: 0xc7, 0x291: 0xc8, 0x292: 0xc2, 0x293: 0xc3, 0x294: 0xc4, 0x295: 0xc5, 0x296: 0xc6, 0x297: 0xc7, + 0x298: 0xc8, 0x299: 0xc2, 0x29a: 0xc3, 0x29b: 0xc4, 0x29c: 0xc5, 0x29d: 0xc6, 0x29e: 0xc7, 0x29f: 0xc8, + 0x2a0: 0xc2, 0x2a1: 0xc3, 0x2a2: 0xc4, 0x2a3: 0xc5, 0x2a4: 0xc6, 0x2a5: 0xc7, 0x2a6: 0xc8, 0x2a7: 0xc2, + 0x2a8: 0xc3, 0x2a9: 0xc4, 0x2aa: 0xc5, 0x2ab: 0xc6, 0x2ac: 0xc7, 0x2ad: 0xc8, 0x2ae: 0xc2, 0x2af: 0xc3, + 0x2b0: 0xc4, 0x2b1: 0xc5, 0x2b2: 0xc6, 0x2b3: 0xc7, 0x2b4: 0xc8, 0x2b5: 0xc2, 0x2b6: 0xc3, 0x2b7: 0xc4, + 0x2b8: 0xc5, 0x2b9: 0xc6, 0x2ba: 0xc7, 0x2bb: 0xc8, 0x2bc: 0xc2, 0x2bd: 0xc3, 0x2be: 0xc4, 0x2bf: 0xc5, + // Block 0xb, offset 0x2c0 + 0x2c0: 0xc6, 0x2c1: 0xc7, 0x2c2: 0xc8, 0x2c3: 0xc2, 0x2c4: 0xc3, 0x2c5: 0xc4, 0x2c6: 0xc5, 0x2c7: 0xc6, + 0x2c8: 0xc7, 0x2c9: 0xc8, 0x2ca: 0xc2, 0x2cb: 0xc3, 0x2cc: 0xc4, 0x2cd: 0xc5, 0x2ce: 0xc6, 0x2cf: 0xc7, + 0x2d0: 0xc8, 0x2d1: 0xc2, 0x2d2: 0xc3, 0x2d3: 0xc4, 0x2d4: 0xc5, 0x2d5: 0xc6, 0x2d6: 0xc7, 0x2d7: 0xc8, + 0x2d8: 0xc2, 0x2d9: 0xc3, 0x2da: 0xc4, 0x2db: 0xc5, 0x2dc: 0xc6, 0x2dd: 0xc7, 0x2de: 0xc9, + // Block 0xc, offset 0x300 + 0x324: 0x31, 0x325: 0x32, 0x326: 0x33, 0x327: 0x34, + 0x328: 0x35, 0x329: 0x36, 0x32a: 0x37, 0x32b: 0x38, 0x32c: 0x39, 0x32d: 0x3a, 0x32e: 0x3b, 0x32f: 0x3c, + 0x330: 0x3d, 0x331: 0x3e, 0x332: 0x3f, 0x333: 0x40, 0x334: 0x41, 0x335: 0x42, 0x336: 0x43, 0x337: 0x44, + 0x338: 0x45, 0x339: 0x46, 0x33a: 0x47, 0x33b: 0x48, 0x33c: 0xca, 0x33d: 0x49, 0x33e: 0x4a, 0x33f: 0x4b, + // Block 0xd, offset 0x340 + 0x347: 0xcb, + 0x34b: 0xcc, 0x34d: 0xcd, + 0x35e: 0x4c, + 0x368: 0xce, 0x36b: 0xcf, + 0x374: 0xd0, + 0x37a: 0xd1, 0x37b: 0xd2, 0x37d: 0xd3, 0x37e: 0xd4, + // Block 0xe, offset 0x380 + 0x381: 0xd5, 0x382: 0xd6, 0x384: 0xd7, 0x385: 0xbc, 0x387: 0xd8, + 0x388: 0xd9, 0x38b: 0xda, 0x38c: 0xdb, 0x38d: 0xdc, + 0x391: 0xdd, 0x392: 0xde, 0x393: 0xdf, 0x396: 0xe0, 0x397: 0xe1, + 0x398: 0xe2, 0x39a: 0xe3, 0x39c: 0xe4, + 0x3a0: 0xe5, 0x3a4: 0xe6, 0x3a5: 0xe7, 0x3a7: 0xe8, + 0x3a8: 0xe9, 0x3a9: 0xea, 0x3aa: 0xeb, + 0x3b0: 0xe2, 0x3b5: 0xec, 0x3b6: 0xed, + 0x3bd: 0xee, + // Block 0xf, offset 0x3c0 + 0x3eb: 0xef, 0x3ec: 0xf0, + 0x3ff: 0xf1, + // Block 0x10, offset 0x400 + 0x432: 0xf2, + // Block 0x11, offset 0x440 + 0x445: 0xf3, 0x446: 0xf4, 0x447: 0xf5, + 0x449: 0xf6, + 0x450: 0xf7, 0x451: 0xf8, 0x452: 0xf9, 0x453: 0xfa, 0x454: 0xfb, 0x455: 0xfc, 0x456: 0xfd, 0x457: 0xfe, + 0x458: 0xff, 0x459: 0x100, 0x45a: 0x4d, 0x45b: 0x101, 0x45c: 0x102, 0x45d: 0x103, 0x45e: 0x104, 0x45f: 0x4e, + // Block 0x12, offset 0x480 + 0x480: 0x4f, 0x481: 0x50, 0x482: 0x105, 0x484: 0xf0, + 0x48a: 0x106, 0x48b: 0x107, + 0x493: 0x108, + 0x4a3: 0x109, 0x4a5: 0x10a, + 0x4b8: 0x51, 0x4b9: 0x52, 0x4ba: 0x53, + // Block 0x13, offset 0x4c0 + 0x4c4: 0x54, 0x4c5: 0x10b, 0x4c6: 0x10c, + 0x4c8: 0x55, 0x4c9: 0x10d, + 0x4ef: 0x10e, + // Block 0x14, offset 0x500 + 0x520: 0x56, 0x521: 0x57, 0x522: 0x58, 0x523: 0x59, 0x524: 0x5a, 0x525: 0x5b, 0x526: 0x5c, 0x527: 0x5d, + 0x528: 0x5e, + // Block 0x15, offset 0x540 + 0x550: 0x0b, 0x551: 0x0c, 0x556: 0x0d, + 0x55b: 0x0e, 0x55d: 0x0f, 0x55e: 0x10, 0x55f: 0x11, + 0x56f: 0x12, +} + +// nfkcSparseOffset: 176 entries, 352 bytes +var nfkcSparseOffset = []uint16{0x0, 0xe, 0x12, 0x1c, 0x26, 0x36, 0x38, 0x3d, 0x48, 0x57, 0x64, 0x6c, 0x71, 0x76, 0x78, 0x7c, 0x84, 0x8b, 0x8e, 0x96, 0x9a, 0x9e, 0xa0, 0xa2, 0xab, 0xaf, 0xb6, 0xbb, 0xbe, 0xc8, 0xcb, 0xd2, 0xda, 0xde, 0xe0, 0xe4, 0xe8, 0xee, 0xff, 0x10b, 0x10d, 0x113, 0x115, 0x117, 0x119, 0x11b, 0x11d, 0x11f, 0x121, 0x124, 0x127, 0x129, 0x12c, 0x12f, 0x133, 0x139, 0x140, 0x149, 0x14b, 0x14e, 0x150, 0x15b, 0x166, 0x174, 0x182, 0x192, 0x1a0, 0x1a7, 0x1ad, 0x1bc, 0x1c0, 0x1c2, 0x1c6, 0x1c8, 0x1cb, 0x1cd, 0x1d0, 0x1d2, 0x1d5, 0x1d7, 0x1d9, 0x1db, 0x1e7, 0x1f1, 0x1fb, 0x1fe, 0x202, 0x204, 0x206, 0x20b, 0x20e, 0x211, 0x213, 0x215, 0x217, 0x219, 0x21f, 0x222, 0x227, 0x229, 0x230, 0x236, 0x23c, 0x244, 0x24a, 0x250, 0x256, 0x25a, 0x25c, 0x25e, 0x260, 0x262, 0x268, 0x26b, 0x26d, 0x26f, 0x271, 0x277, 0x27b, 0x27f, 0x287, 0x28e, 0x291, 0x294, 0x296, 0x299, 0x2a1, 0x2a5, 0x2ac, 0x2af, 0x2b5, 0x2b7, 0x2b9, 0x2bc, 0x2be, 0x2c1, 0x2c6, 0x2c8, 0x2ca, 0x2cc, 0x2ce, 0x2d0, 0x2d3, 0x2d5, 0x2d7, 0x2d9, 0x2db, 0x2dd, 0x2df, 0x2ec, 0x2f6, 0x2f8, 0x2fa, 0x2fe, 0x303, 0x30f, 0x314, 0x31d, 0x323, 0x328, 0x32c, 0x331, 0x335, 0x345, 0x353, 0x361, 0x36f, 0x371, 0x373, 0x375, 0x379, 0x37b, 0x37e, 0x389, 0x38b, 0x395} + +// nfkcSparseValues: 919 entries, 3676 bytes +var nfkcSparseValues = [919]valueRange{ + // Block 0x0, offset 0x0 + {value: 0x0002, lo: 0x0d}, + {value: 0x0001, lo: 0xa0, hi: 0xa0}, + {value: 0x43b9, lo: 0xa8, hi: 0xa8}, + {value: 0x0083, lo: 0xaa, hi: 0xaa}, + {value: 0x43a5, lo: 0xaf, hi: 0xaf}, + {value: 0x0025, lo: 0xb2, hi: 0xb3}, + {value: 0x439b, lo: 0xb4, hi: 0xb4}, + {value: 0x0260, lo: 0xb5, hi: 0xb5}, + {value: 0x43d2, lo: 0xb8, hi: 0xb8}, + {value: 0x0023, lo: 0xb9, hi: 0xb9}, + {value: 0x009f, lo: 0xba, hi: 0xba}, + {value: 0x234c, lo: 0xbc, hi: 0xbc}, + {value: 0x2340, lo: 0xbd, hi: 0xbd}, + {value: 0x23e2, lo: 0xbe, hi: 0xbe}, + // Block 0x1, offset 0xe + {value: 0x0091, lo: 0x03}, + {value: 0x4823, lo: 0xa0, hi: 0xa1}, + {value: 0x4855, lo: 0xaf, hi: 0xb0}, + {value: 0xa000, lo: 0xb7, hi: 0xb7}, + // Block 0x2, offset 0x12 + {value: 0x0004, lo: 0x09}, + {value: 0xa000, lo: 0x92, hi: 0x92}, + {value: 0x0091, lo: 0xb0, hi: 0xb0}, + {value: 0x0140, lo: 0xb1, hi: 0xb1}, + {value: 0x0095, lo: 0xb2, hi: 0xb2}, + {value: 0x00a5, lo: 0xb3, hi: 0xb3}, + {value: 0x0179, lo: 0xb4, hi: 0xb4}, + {value: 0x017f, lo: 0xb5, hi: 0xb5}, + {value: 0x018b, lo: 0xb6, hi: 0xb6}, + {value: 0x00af, lo: 0xb7, hi: 0xb8}, + // Block 0x3, offset 0x1c + {value: 0x000a, lo: 0x09}, + {value: 0x43af, lo: 0x98, hi: 0x98}, + {value: 0x43b4, lo: 0x99, hi: 0x9a}, + {value: 0x43d7, lo: 0x9b, hi: 0x9b}, + {value: 0x43a0, lo: 0x9c, hi: 0x9c}, + {value: 0x43c3, lo: 0x9d, hi: 0x9d}, + {value: 0x0137, lo: 0xa0, hi: 0xa0}, + {value: 0x0099, lo: 0xa1, hi: 0xa1}, + {value: 0x00a7, lo: 0xa2, hi: 0xa3}, + {value: 0x01b8, lo: 0xa4, hi: 0xa4}, + // Block 0x4, offset 0x26 + {value: 0x0000, lo: 0x0f}, + {value: 0xa000, lo: 0x83, hi: 0x83}, + {value: 0xa000, lo: 0x87, hi: 0x87}, + {value: 0xa000, lo: 0x8b, hi: 0x8b}, + {value: 0xa000, lo: 0x8d, hi: 0x8d}, + {value: 0x38e6, lo: 0x90, hi: 0x90}, + {value: 0x38f2, lo: 0x91, hi: 0x91}, + {value: 0x38e0, lo: 0x93, hi: 0x93}, + {value: 0xa000, lo: 0x96, hi: 0x96}, + {value: 0x3958, lo: 0x97, hi: 0x97}, + {value: 0x3922, lo: 0x9c, hi: 0x9c}, + {value: 0x390a, lo: 0x9d, hi: 0x9d}, + {value: 0x3934, lo: 0x9e, hi: 0x9e}, + {value: 0xa000, lo: 0xb4, hi: 0xb5}, + {value: 0x395e, lo: 0xb6, hi: 0xb6}, + {value: 0x3964, lo: 0xb7, hi: 0xb7}, + // Block 0x5, offset 0x36 + {value: 0x0000, lo: 0x01}, + {value: 0x8133, lo: 0x83, hi: 0x87}, + // Block 0x6, offset 0x38 + {value: 0x0001, lo: 0x04}, + {value: 0x8114, lo: 0x81, hi: 0x82}, + {value: 0x8133, lo: 0x84, hi: 0x84}, + {value: 0x812e, lo: 0x85, hi: 0x85}, + {value: 0x810e, lo: 0x87, hi: 0x87}, + // Block 0x7, offset 0x3d + {value: 0x0000, lo: 0x0a}, + {value: 0x8133, lo: 0x90, hi: 0x97}, + {value: 0x811a, lo: 0x98, hi: 0x98}, + {value: 0x811b, lo: 0x99, hi: 0x99}, + {value: 0x811c, lo: 0x9a, hi: 0x9a}, + {value: 0x3982, lo: 0xa2, hi: 0xa2}, + {value: 0x3988, lo: 0xa3, hi: 0xa3}, + {value: 0x3994, lo: 0xa4, hi: 0xa4}, + {value: 0x398e, lo: 0xa5, hi: 0xa5}, + {value: 0x399a, lo: 0xa6, hi: 0xa6}, + {value: 0xa000, lo: 0xa7, hi: 0xa7}, + // Block 0x8, offset 0x48 + {value: 0x0000, lo: 0x0e}, + {value: 0x39ac, lo: 0x80, hi: 0x80}, + {value: 0xa000, lo: 0x81, hi: 0x81}, + {value: 0x39a0, lo: 0x82, hi: 0x82}, + {value: 0xa000, lo: 0x92, hi: 0x92}, + {value: 0x39a6, lo: 0x93, hi: 0x93}, + {value: 0xa000, lo: 0x95, hi: 0x95}, + {value: 0x8133, lo: 0x96, hi: 0x9c}, + {value: 0x8133, lo: 0x9f, hi: 0xa2}, + {value: 0x812e, lo: 0xa3, hi: 0xa3}, + {value: 0x8133, lo: 0xa4, hi: 0xa4}, + {value: 0x8133, lo: 0xa7, hi: 0xa8}, + {value: 0x812e, lo: 0xaa, hi: 0xaa}, + {value: 0x8133, lo: 0xab, hi: 0xac}, + {value: 0x812e, lo: 0xad, hi: 0xad}, + // Block 0x9, offset 0x57 + {value: 0x0000, lo: 0x0c}, + {value: 0x8120, lo: 0x91, hi: 0x91}, + {value: 0x8133, lo: 0xb0, hi: 0xb0}, + {value: 0x812e, lo: 0xb1, hi: 0xb1}, + {value: 0x8133, lo: 0xb2, hi: 0xb3}, + {value: 0x812e, lo: 0xb4, hi: 0xb4}, + {value: 0x8133, lo: 0xb5, hi: 0xb6}, + {value: 0x812e, lo: 0xb7, hi: 0xb9}, + {value: 0x8133, lo: 0xba, hi: 0xba}, + {value: 0x812e, lo: 0xbb, hi: 0xbc}, + {value: 0x8133, lo: 0xbd, hi: 0xbd}, + {value: 0x812e, lo: 0xbe, hi: 0xbe}, + {value: 0x8133, lo: 0xbf, hi: 0xbf}, + // Block 0xa, offset 0x64 + {value: 0x0005, lo: 0x07}, + {value: 0x8133, lo: 0x80, hi: 0x80}, + {value: 0x8133, lo: 0x81, hi: 0x81}, + {value: 0x812e, lo: 0x82, hi: 0x83}, + {value: 0x812e, lo: 0x84, hi: 0x85}, + {value: 0x812e, lo: 0x86, hi: 0x87}, + {value: 0x812e, lo: 0x88, hi: 0x89}, + {value: 0x8133, lo: 0x8a, hi: 0x8a}, + // Block 0xb, offset 0x6c + {value: 0x0000, lo: 0x04}, + {value: 0x8133, lo: 0xab, hi: 0xb1}, + {value: 0x812e, lo: 0xb2, hi: 0xb2}, + {value: 0x8133, lo: 0xb3, hi: 0xb3}, + {value: 0x812e, lo: 0xbd, hi: 0xbd}, + // Block 0xc, offset 0x71 + {value: 0x0000, lo: 0x04}, + {value: 0x8133, lo: 0x96, hi: 0x99}, + {value: 0x8133, lo: 0x9b, hi: 0xa3}, + {value: 0x8133, lo: 0xa5, hi: 0xa7}, + {value: 0x8133, lo: 0xa9, hi: 0xad}, + // Block 0xd, offset 0x76 + {value: 0x0000, lo: 0x01}, + {value: 0x812e, lo: 0x99, hi: 0x9b}, + // Block 0xe, offset 0x78 + {value: 0x0000, lo: 0x03}, + {value: 0x8133, lo: 0x98, hi: 0x98}, + {value: 0x812e, lo: 0x99, hi: 0x9b}, + {value: 0x8133, lo: 0x9c, hi: 0x9f}, + // Block 0xf, offset 0x7c + {value: 0x0000, lo: 0x07}, + {value: 0xa000, lo: 0xa8, hi: 0xa8}, + {value: 0x4019, lo: 0xa9, hi: 0xa9}, + {value: 0xa000, lo: 0xb0, hi: 0xb0}, + {value: 0x4021, lo: 0xb1, hi: 0xb1}, + {value: 0xa000, lo: 0xb3, hi: 0xb3}, + {value: 0x4029, lo: 0xb4, hi: 0xb4}, + {value: 0x9903, lo: 0xbc, hi: 0xbc}, + // Block 0x10, offset 0x84 + {value: 0x0008, lo: 0x06}, + {value: 0x8105, lo: 0x8d, hi: 0x8d}, + {value: 0x8133, lo: 0x91, hi: 0x91}, + {value: 0x812e, lo: 0x92, hi: 0x92}, + {value: 0x8133, lo: 0x93, hi: 0x93}, + {value: 0x8133, lo: 0x94, hi: 0x94}, + {value: 0x465d, lo: 0x98, hi: 0x9f}, + // Block 0x11, offset 0x8b + {value: 0x0000, lo: 0x02}, + {value: 0x8103, lo: 0xbc, hi: 0xbc}, + {value: 0x9900, lo: 0xbe, hi: 0xbe}, + // Block 0x12, offset 0x8e + {value: 0x0008, lo: 0x07}, + {value: 0xa000, lo: 0x87, hi: 0x87}, + {value: 0x2dd5, lo: 0x8b, hi: 0x8c}, + {value: 0x8105, lo: 0x8d, hi: 0x8d}, + {value: 0x9900, lo: 0x97, hi: 0x97}, + {value: 0x469d, lo: 0x9c, hi: 0x9d}, + {value: 0x46ad, lo: 0x9f, hi: 0x9f}, + {value: 0x8133, lo: 0xbe, hi: 0xbe}, + // Block 0x13, offset 0x96 + {value: 0x0000, lo: 0x03}, + {value: 0x46d5, lo: 0xb3, hi: 0xb3}, + {value: 0x46dd, lo: 0xb6, hi: 0xb6}, + {value: 0x8103, lo: 0xbc, hi: 0xbc}, + // Block 0x14, offset 0x9a + {value: 0x0008, lo: 0x03}, + {value: 0x8105, lo: 0x8d, hi: 0x8d}, + {value: 0x46b5, lo: 0x99, hi: 0x9b}, + {value: 0x46cd, lo: 0x9e, hi: 0x9e}, + // Block 0x15, offset 0x9e + {value: 0x0000, lo: 0x01}, + {value: 0x8103, lo: 0xbc, hi: 0xbc}, + // Block 0x16, offset 0xa0 + {value: 0x0000, lo: 0x01}, + {value: 0x8105, lo: 0x8d, hi: 0x8d}, + // Block 0x17, offset 0xa2 + {value: 0x0000, lo: 0x08}, + {value: 0xa000, lo: 0x87, hi: 0x87}, + {value: 0x2ded, lo: 0x88, hi: 0x88}, + {value: 0x2de5, lo: 0x8b, hi: 0x8b}, + {value: 0x2df5, lo: 0x8c, hi: 0x8c}, + {value: 0x8105, lo: 0x8d, hi: 0x8d}, + {value: 0x9900, lo: 0x96, hi: 0x97}, + {value: 0x46e5, lo: 0x9c, hi: 0x9c}, + {value: 0x46ed, lo: 0x9d, hi: 0x9d}, + // Block 0x18, offset 0xab + {value: 0x0000, lo: 0x03}, + {value: 0xa000, lo: 0x92, hi: 0x92}, + {value: 0x2dfd, lo: 0x94, hi: 0x94}, + {value: 0x9900, lo: 0xbe, hi: 0xbe}, + // Block 0x19, offset 0xaf + {value: 0x0000, lo: 0x06}, + {value: 0xa000, lo: 0x86, hi: 0x87}, + {value: 0x2e05, lo: 0x8a, hi: 0x8a}, + {value: 0x2e15, lo: 0x8b, hi: 0x8b}, + {value: 0x2e0d, lo: 0x8c, hi: 0x8c}, + {value: 0x8105, lo: 0x8d, hi: 0x8d}, + {value: 0x9900, lo: 0x97, hi: 0x97}, + // Block 0x1a, offset 0xb6 + {value: 0x1801, lo: 0x04}, + {value: 0xa000, lo: 0x86, hi: 0x86}, + {value: 0x4031, lo: 0x88, hi: 0x88}, + {value: 0x8105, lo: 0x8d, hi: 0x8d}, + {value: 0x8121, lo: 0x95, hi: 0x96}, + // Block 0x1b, offset 0xbb + {value: 0x0000, lo: 0x02}, + {value: 0x8103, lo: 0xbc, hi: 0xbc}, + {value: 0xa000, lo: 0xbf, hi: 0xbf}, + // Block 0x1c, offset 0xbe + {value: 0x0000, lo: 0x09}, + {value: 0x2e1d, lo: 0x80, hi: 0x80}, + {value: 0x9900, lo: 0x82, hi: 0x82}, + {value: 0xa000, lo: 0x86, hi: 0x86}, + {value: 0x2e25, lo: 0x87, hi: 0x87}, + {value: 0x2e2d, lo: 0x88, hi: 0x88}, + {value: 0x3091, lo: 0x8a, hi: 0x8a}, + {value: 0x2f19, lo: 0x8b, hi: 0x8b}, + {value: 0x8105, lo: 0x8d, hi: 0x8d}, + {value: 0x9900, lo: 0x95, hi: 0x96}, + // Block 0x1d, offset 0xc8 + {value: 0x0000, lo: 0x02}, + {value: 0x8105, lo: 0xbb, hi: 0xbc}, + {value: 0x9900, lo: 0xbe, hi: 0xbe}, + // Block 0x1e, offset 0xcb + {value: 0x0000, lo: 0x06}, + {value: 0xa000, lo: 0x86, hi: 0x87}, + {value: 0x2e35, lo: 0x8a, hi: 0x8a}, + {value: 0x2e45, lo: 0x8b, hi: 0x8b}, + {value: 0x2e3d, lo: 0x8c, hi: 0x8c}, + {value: 0x8105, lo: 0x8d, hi: 0x8d}, + {value: 0x9900, lo: 0x97, hi: 0x97}, + // Block 0x1f, offset 0xd2 + {value: 0x6ab3, lo: 0x07}, + {value: 0x9905, lo: 0x8a, hi: 0x8a}, + {value: 0x9900, lo: 0x8f, hi: 0x8f}, + {value: 0xa000, lo: 0x99, hi: 0x99}, + {value: 0x4039, lo: 0x9a, hi: 0x9a}, + {value: 0x3099, lo: 0x9c, hi: 0x9c}, + {value: 0x2f24, lo: 0x9d, hi: 0x9d}, + {value: 0x2e4d, lo: 0x9e, hi: 0x9f}, + // Block 0x20, offset 0xda + {value: 0x0000, lo: 0x03}, + {value: 0x2751, lo: 0xb3, hi: 0xb3}, + {value: 0x8123, lo: 0xb8, hi: 0xb9}, + {value: 0x8105, lo: 0xba, hi: 0xba}, + // Block 0x21, offset 0xde + {value: 0x0000, lo: 0x01}, + {value: 0x8124, lo: 0x88, hi: 0x8b}, + // Block 0x22, offset 0xe0 + {value: 0x0000, lo: 0x03}, + {value: 0x2766, lo: 0xb3, hi: 0xb3}, + {value: 0x8125, lo: 0xb8, hi: 0xb9}, + {value: 0x8105, lo: 0xba, hi: 0xba}, + // Block 0x23, offset 0xe4 + {value: 0x0000, lo: 0x03}, + {value: 0x8126, lo: 0x88, hi: 0x8b}, + {value: 0x2758, lo: 0x9c, hi: 0x9c}, + {value: 0x275f, lo: 0x9d, hi: 0x9d}, + // Block 0x24, offset 0xe8 + {value: 0x0000, lo: 0x05}, + {value: 0x03fe, lo: 0x8c, hi: 0x8c}, + {value: 0x812e, lo: 0x98, hi: 0x99}, + {value: 0x812e, lo: 0xb5, hi: 0xb5}, + {value: 0x812e, lo: 0xb7, hi: 0xb7}, + {value: 0x812c, lo: 0xb9, hi: 0xb9}, + // Block 0x25, offset 0xee + {value: 0x0000, lo: 0x10}, + {value: 0x2774, lo: 0x83, hi: 0x83}, + {value: 0x277b, lo: 0x8d, hi: 0x8d}, + {value: 0x2782, lo: 0x92, hi: 0x92}, + {value: 0x2789, lo: 0x97, hi: 0x97}, + {value: 0x2790, lo: 0x9c, hi: 0x9c}, + {value: 0x276d, lo: 0xa9, hi: 0xa9}, + {value: 0x8127, lo: 0xb1, hi: 0xb1}, + {value: 0x8128, lo: 0xb2, hi: 0xb2}, + {value: 0x4bc5, lo: 0xb3, hi: 0xb3}, + {value: 0x8129, lo: 0xb4, hi: 0xb4}, + {value: 0x4bce, lo: 0xb5, hi: 0xb5}, + {value: 0x46f5, lo: 0xb6, hi: 0xb6}, + {value: 0x4735, lo: 0xb7, hi: 0xb7}, + {value: 0x46fd, lo: 0xb8, hi: 0xb8}, + {value: 0x4740, lo: 0xb9, hi: 0xb9}, + {value: 0x8128, lo: 0xba, hi: 0xbd}, + // Block 0x26, offset 0xff + {value: 0x0000, lo: 0x0b}, + {value: 0x8128, lo: 0x80, hi: 0x80}, + {value: 0x4bd7, lo: 0x81, hi: 0x81}, + {value: 0x8133, lo: 0x82, hi: 0x83}, + {value: 0x8105, lo: 0x84, hi: 0x84}, + {value: 0x8133, lo: 0x86, hi: 0x87}, + {value: 0x279e, lo: 0x93, hi: 0x93}, + {value: 0x27a5, lo: 0x9d, hi: 0x9d}, + {value: 0x27ac, lo: 0xa2, hi: 0xa2}, + {value: 0x27b3, lo: 0xa7, hi: 0xa7}, + {value: 0x27ba, lo: 0xac, hi: 0xac}, + {value: 0x2797, lo: 0xb9, hi: 0xb9}, + // Block 0x27, offset 0x10b + {value: 0x0000, lo: 0x01}, + {value: 0x812e, lo: 0x86, hi: 0x86}, + // Block 0x28, offset 0x10d + {value: 0x0000, lo: 0x05}, + {value: 0xa000, lo: 0xa5, hi: 0xa5}, + {value: 0x2e55, lo: 0xa6, hi: 0xa6}, + {value: 0x9900, lo: 0xae, hi: 0xae}, + {value: 0x8103, lo: 0xb7, hi: 0xb7}, + {value: 0x8105, lo: 0xb9, hi: 0xba}, + // Block 0x29, offset 0x113 + {value: 0x0000, lo: 0x01}, + {value: 0x812e, lo: 0x8d, hi: 0x8d}, + // Block 0x2a, offset 0x115 + {value: 0x0000, lo: 0x01}, + {value: 0x0402, lo: 0xbc, hi: 0xbc}, + // Block 0x2b, offset 0x117 + {value: 0x0000, lo: 0x01}, + {value: 0xa000, lo: 0x80, hi: 0x92}, + // Block 0x2c, offset 0x119 + {value: 0x0000, lo: 0x01}, + {value: 0xb900, lo: 0xa1, hi: 0xb5}, + // Block 0x2d, offset 0x11b + {value: 0x0000, lo: 0x01}, + {value: 0x9900, lo: 0xa8, hi: 0xbf}, + // Block 0x2e, offset 0x11d + {value: 0x0000, lo: 0x01}, + {value: 0x9900, lo: 0x80, hi: 0x82}, + // Block 0x2f, offset 0x11f + {value: 0x0000, lo: 0x01}, + {value: 0x8133, lo: 0x9d, hi: 0x9f}, + // Block 0x30, offset 0x121 + {value: 0x0000, lo: 0x02}, + {value: 0x8105, lo: 0x94, hi: 0x95}, + {value: 0x8105, lo: 0xb4, hi: 0xb4}, + // Block 0x31, offset 0x124 + {value: 0x0000, lo: 0x02}, + {value: 0x8105, lo: 0x92, hi: 0x92}, + {value: 0x8133, lo: 0x9d, hi: 0x9d}, + // Block 0x32, offset 0x127 + {value: 0x0000, lo: 0x01}, + {value: 0x8132, lo: 0xa9, hi: 0xa9}, + // Block 0x33, offset 0x129 + {value: 0x0004, lo: 0x02}, + {value: 0x812f, lo: 0xb9, hi: 0xba}, + {value: 0x812e, lo: 0xbb, hi: 0xbb}, + // Block 0x34, offset 0x12c + {value: 0x0000, lo: 0x02}, + {value: 0x8133, lo: 0x97, hi: 0x97}, + {value: 0x812e, lo: 0x98, hi: 0x98}, + // Block 0x35, offset 0x12f + {value: 0x0000, lo: 0x03}, + {value: 0x8105, lo: 0xa0, hi: 0xa0}, + {value: 0x8133, lo: 0xb5, hi: 0xbc}, + {value: 0x812e, lo: 0xbf, hi: 0xbf}, + // Block 0x36, offset 0x133 + {value: 0x0000, lo: 0x05}, + {value: 0x8133, lo: 0xb0, hi: 0xb4}, + {value: 0x812e, lo: 0xb5, hi: 0xba}, + {value: 0x8133, lo: 0xbb, hi: 0xbc}, + {value: 0x812e, lo: 0xbd, hi: 0xbd}, + {value: 0x812e, lo: 0xbf, hi: 0xbf}, + // Block 0x37, offset 0x139 + {value: 0x0000, lo: 0x06}, + {value: 0x812e, lo: 0x80, hi: 0x80}, + {value: 0x8133, lo: 0x81, hi: 0x82}, + {value: 0x812e, lo: 0x83, hi: 0x84}, + {value: 0x8133, lo: 0x85, hi: 0x89}, + {value: 0x812e, lo: 0x8a, hi: 0x8a}, + {value: 0x8133, lo: 0x8b, hi: 0x8e}, + // Block 0x38, offset 0x140 + {value: 0x0000, lo: 0x08}, + {value: 0x2e9d, lo: 0x80, hi: 0x80}, + {value: 0x2ea5, lo: 0x81, hi: 0x81}, + {value: 0xa000, lo: 0x82, hi: 0x82}, + {value: 0x2ead, lo: 0x83, hi: 0x83}, + {value: 0x8105, lo: 0x84, hi: 0x84}, + {value: 0x8133, lo: 0xab, hi: 0xab}, + {value: 0x812e, lo: 0xac, hi: 0xac}, + {value: 0x8133, lo: 0xad, hi: 0xb3}, + // Block 0x39, offset 0x149 + {value: 0x0000, lo: 0x01}, + {value: 0x8105, lo: 0xaa, hi: 0xab}, + // Block 0x3a, offset 0x14b + {value: 0x0000, lo: 0x02}, + {value: 0x8103, lo: 0xa6, hi: 0xa6}, + {value: 0x8105, lo: 0xb2, hi: 0xb3}, + // Block 0x3b, offset 0x14e + {value: 0x0000, lo: 0x01}, + {value: 0x8103, lo: 0xb7, hi: 0xb7}, + // Block 0x3c, offset 0x150 + {value: 0x0000, lo: 0x0a}, + {value: 0x8133, lo: 0x90, hi: 0x92}, + {value: 0x8101, lo: 0x94, hi: 0x94}, + {value: 0x812e, lo: 0x95, hi: 0x99}, + {value: 0x8133, lo: 0x9a, hi: 0x9b}, + {value: 0x812e, lo: 0x9c, hi: 0x9f}, + {value: 0x8133, lo: 0xa0, hi: 0xa0}, + {value: 0x8101, lo: 0xa2, hi: 0xa8}, + {value: 0x812e, lo: 0xad, hi: 0xad}, + {value: 0x8133, lo: 0xb4, hi: 0xb4}, + {value: 0x8133, lo: 0xb8, hi: 0xb9}, + // Block 0x3d, offset 0x15b + {value: 0x0002, lo: 0x0a}, + {value: 0x0043, lo: 0xac, hi: 0xac}, + {value: 0x00d1, lo: 0xad, hi: 0xad}, + {value: 0x0045, lo: 0xae, hi: 0xae}, + {value: 0x0049, lo: 0xb0, hi: 0xb1}, + {value: 0x00ec, lo: 0xb2, hi: 0xb2}, + {value: 0x004f, lo: 0xb3, hi: 0xba}, + {value: 0x005f, lo: 0xbc, hi: 0xbc}, + {value: 0x00fe, lo: 0xbd, hi: 0xbd}, + {value: 0x0061, lo: 0xbe, hi: 0xbe}, + {value: 0x0065, lo: 0xbf, hi: 0xbf}, + // Block 0x3e, offset 0x166 + {value: 0x0000, lo: 0x0d}, + {value: 0x0001, lo: 0x80, hi: 0x8a}, + {value: 0x0532, lo: 0x91, hi: 0x91}, + {value: 0x43dc, lo: 0x97, hi: 0x97}, + {value: 0x001d, lo: 0xa4, hi: 0xa4}, + {value: 0x19a0, lo: 0xa5, hi: 0xa5}, + {value: 0x1c8c, lo: 0xa6, hi: 0xa6}, + {value: 0x0001, lo: 0xaf, hi: 0xaf}, + {value: 0x27c1, lo: 0xb3, hi: 0xb3}, + {value: 0x2935, lo: 0xb4, hi: 0xb4}, + {value: 0x27c8, lo: 0xb6, hi: 0xb6}, + {value: 0x293f, lo: 0xb7, hi: 0xb7}, + {value: 0x199a, lo: 0xbc, hi: 0xbc}, + {value: 0x43aa, lo: 0xbe, hi: 0xbe}, + // Block 0x3f, offset 0x174 + {value: 0x0002, lo: 0x0d}, + {value: 0x1a60, lo: 0x87, hi: 0x87}, + {value: 0x1a5d, lo: 0x88, hi: 0x88}, + {value: 0x199d, lo: 0x89, hi: 0x89}, + {value: 0x2ac5, lo: 0x97, hi: 0x97}, + {value: 0x0001, lo: 0x9f, hi: 0x9f}, + {value: 0x0021, lo: 0xb0, hi: 0xb0}, + {value: 0x0093, lo: 0xb1, hi: 0xb1}, + {value: 0x0029, lo: 0xb4, hi: 0xb9}, + {value: 0x0017, lo: 0xba, hi: 0xba}, + {value: 0x055e, lo: 0xbb, hi: 0xbb}, + {value: 0x003b, lo: 0xbc, hi: 0xbc}, + {value: 0x0011, lo: 0xbd, hi: 0xbe}, + {value: 0x009d, lo: 0xbf, hi: 0xbf}, + // Block 0x40, offset 0x182 + {value: 0x0002, lo: 0x0f}, + {value: 0x0021, lo: 0x80, hi: 0x89}, + {value: 0x0017, lo: 0x8a, hi: 0x8a}, + {value: 0x055e, lo: 0x8b, hi: 0x8b}, + {value: 0x003b, lo: 0x8c, hi: 0x8c}, + {value: 0x0011, lo: 0x8d, hi: 0x8e}, + {value: 0x0083, lo: 0x90, hi: 0x90}, + {value: 0x008b, lo: 0x91, hi: 0x91}, + {value: 0x009f, lo: 0x92, hi: 0x92}, + {value: 0x00b1, lo: 0x93, hi: 0x93}, + {value: 0x011f, lo: 0x94, hi: 0x94}, + {value: 0x0091, lo: 0x95, hi: 0x95}, + {value: 0x0097, lo: 0x96, hi: 0x99}, + {value: 0x00a1, lo: 0x9a, hi: 0x9a}, + {value: 0x00a7, lo: 0x9b, hi: 0x9c}, + {value: 0x1ac9, lo: 0xa8, hi: 0xa8}, + // Block 0x41, offset 0x192 + {value: 0x0000, lo: 0x0d}, + {value: 0x8133, lo: 0x90, hi: 0x91}, + {value: 0x8101, lo: 0x92, hi: 0x93}, + {value: 0x8133, lo: 0x94, hi: 0x97}, + {value: 0x8101, lo: 0x98, hi: 0x9a}, + {value: 0x8133, lo: 0x9b, hi: 0x9c}, + {value: 0x8133, lo: 0xa1, hi: 0xa1}, + {value: 0x8101, lo: 0xa5, hi: 0xa6}, + {value: 0x8133, lo: 0xa7, hi: 0xa7}, + {value: 0x812e, lo: 0xa8, hi: 0xa8}, + {value: 0x8133, lo: 0xa9, hi: 0xa9}, + {value: 0x8101, lo: 0xaa, hi: 0xab}, + {value: 0x812e, lo: 0xac, hi: 0xaf}, + {value: 0x8133, lo: 0xb0, hi: 0xb0}, + // Block 0x42, offset 0x1a0 + {value: 0x0007, lo: 0x06}, + {value: 0x22b0, lo: 0x89, hi: 0x89}, + {value: 0xa000, lo: 0x90, hi: 0x90}, + {value: 0xa000, lo: 0x92, hi: 0x92}, + {value: 0xa000, lo: 0x94, hi: 0x94}, + {value: 0x3cfa, lo: 0x9a, hi: 0x9b}, + {value: 0x3d08, lo: 0xae, hi: 0xae}, + // Block 0x43, offset 0x1a7 + {value: 0x000e, lo: 0x05}, + {value: 0x3d0f, lo: 0x8d, hi: 0x8e}, + {value: 0x3d16, lo: 0x8f, hi: 0x8f}, + {value: 0xa000, lo: 0x90, hi: 0x90}, + {value: 0xa000, lo: 0x92, hi: 0x92}, + {value: 0xa000, lo: 0x94, hi: 0x94}, + // Block 0x44, offset 0x1ad + {value: 0x017a, lo: 0x0e}, + {value: 0xa000, lo: 0x83, hi: 0x83}, + {value: 0x3d24, lo: 0x84, hi: 0x84}, + {value: 0xa000, lo: 0x88, hi: 0x88}, + {value: 0x3d2b, lo: 0x89, hi: 0x89}, + {value: 0xa000, lo: 0x8b, hi: 0x8b}, + {value: 0x3d32, lo: 0x8c, hi: 0x8c}, + {value: 0xa000, lo: 0xa3, hi: 0xa3}, + {value: 0x3d39, lo: 0xa4, hi: 0xa4}, + {value: 0xa000, lo: 0xa5, hi: 0xa5}, + {value: 0x3d40, lo: 0xa6, hi: 0xa6}, + {value: 0x27cf, lo: 0xac, hi: 0xad}, + {value: 0x27d6, lo: 0xaf, hi: 0xaf}, + {value: 0x2953, lo: 0xb0, hi: 0xb0}, + {value: 0xa000, lo: 0xbc, hi: 0xbc}, + // Block 0x45, offset 0x1bc + {value: 0x0007, lo: 0x03}, + {value: 0x3da9, lo: 0xa0, hi: 0xa1}, + {value: 0x3dd3, lo: 0xa2, hi: 0xa3}, + {value: 0x3dfd, lo: 0xaa, hi: 0xad}, + // Block 0x46, offset 0x1c0 + {value: 0x0004, lo: 0x01}, + {value: 0x0586, lo: 0xa9, hi: 0xaa}, + // Block 0x47, offset 0x1c2 + {value: 0x0002, lo: 0x03}, + {value: 0x0057, lo: 0x80, hi: 0x8f}, + {value: 0x0083, lo: 0x90, hi: 0xa9}, + {value: 0x0021, lo: 0xaa, hi: 0xaa}, + // Block 0x48, offset 0x1c6 + {value: 0x0000, lo: 0x01}, + {value: 0x2ad2, lo: 0x8c, hi: 0x8c}, + // Block 0x49, offset 0x1c8 + {value: 0x0266, lo: 0x02}, + {value: 0x1cbc, lo: 0xb4, hi: 0xb4}, + {value: 0x1a5a, lo: 0xb5, hi: 0xb6}, + // Block 0x4a, offset 0x1cb + {value: 0x0000, lo: 0x01}, + {value: 0x461e, lo: 0x9c, hi: 0x9c}, + // Block 0x4b, offset 0x1cd + {value: 0x0000, lo: 0x02}, + {value: 0x0095, lo: 0xbc, hi: 0xbc}, + {value: 0x006d, lo: 0xbd, hi: 0xbd}, + // Block 0x4c, offset 0x1d0 + {value: 0x0000, lo: 0x01}, + {value: 0x8133, lo: 0xaf, hi: 0xb1}, + // Block 0x4d, offset 0x1d2 + {value: 0x0000, lo: 0x02}, + {value: 0x057a, lo: 0xaf, hi: 0xaf}, + {value: 0x8105, lo: 0xbf, hi: 0xbf}, + // Block 0x4e, offset 0x1d5 + {value: 0x0000, lo: 0x01}, + {value: 0x8133, lo: 0xa0, hi: 0xbf}, + // Block 0x4f, offset 0x1d7 + {value: 0x0000, lo: 0x01}, + {value: 0x0ebe, lo: 0x9f, hi: 0x9f}, + // Block 0x50, offset 0x1d9 + {value: 0x0000, lo: 0x01}, + {value: 0x172a, lo: 0xb3, hi: 0xb3}, + // Block 0x51, offset 0x1db + {value: 0x0004, lo: 0x0b}, + {value: 0x1692, lo: 0x80, hi: 0x82}, + {value: 0x16aa, lo: 0x83, hi: 0x83}, + {value: 0x16c2, lo: 0x84, hi: 0x85}, + {value: 0x16d2, lo: 0x86, hi: 0x89}, + {value: 0x16e6, lo: 0x8a, hi: 0x8c}, + {value: 0x16fa, lo: 0x8d, hi: 0x8d}, + {value: 0x1702, lo: 0x8e, hi: 0x8e}, + {value: 0x170a, lo: 0x8f, hi: 0x90}, + {value: 0x1716, lo: 0x91, hi: 0x93}, + {value: 0x1726, lo: 0x94, hi: 0x94}, + {value: 0x172e, lo: 0x95, hi: 0x95}, + // Block 0x52, offset 0x1e7 + {value: 0x0004, lo: 0x09}, + {value: 0x0001, lo: 0x80, hi: 0x80}, + {value: 0x812d, lo: 0xaa, hi: 0xaa}, + {value: 0x8132, lo: 0xab, hi: 0xab}, + {value: 0x8134, lo: 0xac, hi: 0xac}, + {value: 0x812f, lo: 0xad, hi: 0xad}, + {value: 0x8130, lo: 0xae, hi: 0xae}, + {value: 0x8130, lo: 0xaf, hi: 0xaf}, + {value: 0x05ae, lo: 0xb6, hi: 0xb6}, + {value: 0x0982, lo: 0xb8, hi: 0xba}, + // Block 0x53, offset 0x1f1 + {value: 0x0006, lo: 0x09}, + {value: 0x0406, lo: 0xb1, hi: 0xb1}, + {value: 0x040a, lo: 0xb2, hi: 0xb2}, + {value: 0x4b7c, lo: 0xb3, hi: 0xb3}, + {value: 0x040e, lo: 0xb4, hi: 0xb4}, + {value: 0x4b82, lo: 0xb5, hi: 0xb6}, + {value: 0x0412, lo: 0xb7, hi: 0xb7}, + {value: 0x0416, lo: 0xb8, hi: 0xb8}, + {value: 0x041a, lo: 0xb9, hi: 0xb9}, + {value: 0x4b8e, lo: 0xba, hi: 0xbf}, + // Block 0x54, offset 0x1fb + {value: 0x0000, lo: 0x02}, + {value: 0x8133, lo: 0xaf, hi: 0xaf}, + {value: 0x8133, lo: 0xb4, hi: 0xbd}, + // Block 0x55, offset 0x1fe + {value: 0x0000, lo: 0x03}, + {value: 0x02d8, lo: 0x9c, hi: 0x9c}, + {value: 0x02de, lo: 0x9d, hi: 0x9d}, + {value: 0x8133, lo: 0x9e, hi: 0x9f}, + // Block 0x56, offset 0x202 + {value: 0x0000, lo: 0x01}, + {value: 0x8133, lo: 0xb0, hi: 0xb1}, + // Block 0x57, offset 0x204 + {value: 0x0000, lo: 0x01}, + {value: 0x173e, lo: 0xb0, hi: 0xb0}, + // Block 0x58, offset 0x206 + {value: 0x0006, lo: 0x04}, + {value: 0x0047, lo: 0xb2, hi: 0xb3}, + {value: 0x0063, lo: 0xb4, hi: 0xb4}, + {value: 0x00dd, lo: 0xb8, hi: 0xb8}, + {value: 0x00e9, lo: 0xb9, hi: 0xb9}, + // Block 0x59, offset 0x20b + {value: 0x0000, lo: 0x02}, + {value: 0x8105, lo: 0x86, hi: 0x86}, + {value: 0x8105, lo: 0xac, hi: 0xac}, + // Block 0x5a, offset 0x20e + {value: 0x0000, lo: 0x02}, + {value: 0x8105, lo: 0x84, hi: 0x84}, + {value: 0x8133, lo: 0xa0, hi: 0xb1}, + // Block 0x5b, offset 0x211 + {value: 0x0000, lo: 0x01}, + {value: 0x812e, lo: 0xab, hi: 0xad}, + // Block 0x5c, offset 0x213 + {value: 0x0000, lo: 0x01}, + {value: 0x8105, lo: 0x93, hi: 0x93}, + // Block 0x5d, offset 0x215 + {value: 0x0000, lo: 0x01}, + {value: 0x8103, lo: 0xb3, hi: 0xb3}, + // Block 0x5e, offset 0x217 + {value: 0x0000, lo: 0x01}, + {value: 0x8105, lo: 0x80, hi: 0x80}, + // Block 0x5f, offset 0x219 + {value: 0x0000, lo: 0x05}, + {value: 0x8133, lo: 0xb0, hi: 0xb0}, + {value: 0x8133, lo: 0xb2, hi: 0xb3}, + {value: 0x812e, lo: 0xb4, hi: 0xb4}, + {value: 0x8133, lo: 0xb7, hi: 0xb8}, + {value: 0x8133, lo: 0xbe, hi: 0xbf}, + // Block 0x60, offset 0x21f + {value: 0x0000, lo: 0x02}, + {value: 0x8133, lo: 0x81, hi: 0x81}, + {value: 0x8105, lo: 0xb6, hi: 0xb6}, + // Block 0x61, offset 0x222 + {value: 0x000c, lo: 0x04}, + {value: 0x173a, lo: 0x9c, hi: 0x9d}, + {value: 0x014f, lo: 0x9e, hi: 0x9e}, + {value: 0x174a, lo: 0x9f, hi: 0x9f}, + {value: 0x01a6, lo: 0xa9, hi: 0xa9}, + // Block 0x62, offset 0x227 + {value: 0x0000, lo: 0x01}, + {value: 0x8105, lo: 0xad, hi: 0xad}, + // Block 0x63, offset 0x229 + {value: 0x0000, lo: 0x06}, + {value: 0xe500, lo: 0x80, hi: 0x80}, + {value: 0xc600, lo: 0x81, hi: 0x9b}, + {value: 0xe500, lo: 0x9c, hi: 0x9c}, + {value: 0xc600, lo: 0x9d, hi: 0xb7}, + {value: 0xe500, lo: 0xb8, hi: 0xb8}, + {value: 0xc600, lo: 0xb9, hi: 0xbf}, + // Block 0x64, offset 0x230 + {value: 0x0000, lo: 0x05}, + {value: 0xc600, lo: 0x80, hi: 0x93}, + {value: 0xe500, lo: 0x94, hi: 0x94}, + {value: 0xc600, lo: 0x95, hi: 0xaf}, + {value: 0xe500, lo: 0xb0, hi: 0xb0}, + {value: 0xc600, lo: 0xb1, hi: 0xbf}, + // Block 0x65, offset 0x236 + {value: 0x0000, lo: 0x05}, + {value: 0xc600, lo: 0x80, hi: 0x8b}, + {value: 0xe500, lo: 0x8c, hi: 0x8c}, + {value: 0xc600, lo: 0x8d, hi: 0xa7}, + {value: 0xe500, lo: 0xa8, hi: 0xa8}, + {value: 0xc600, lo: 0xa9, hi: 0xbf}, + // Block 0x66, offset 0x23c + {value: 0x0000, lo: 0x07}, + {value: 0xc600, lo: 0x80, hi: 0x83}, + {value: 0xe500, lo: 0x84, hi: 0x84}, + {value: 0xc600, lo: 0x85, hi: 0x9f}, + {value: 0xe500, lo: 0xa0, hi: 0xa0}, + {value: 0xc600, lo: 0xa1, hi: 0xbb}, + {value: 0xe500, lo: 0xbc, hi: 0xbc}, + {value: 0xc600, lo: 0xbd, hi: 0xbf}, + // Block 0x67, offset 0x244 + {value: 0x0000, lo: 0x05}, + {value: 0xc600, lo: 0x80, hi: 0x97}, + {value: 0xe500, lo: 0x98, hi: 0x98}, + {value: 0xc600, lo: 0x99, hi: 0xb3}, + {value: 0xe500, lo: 0xb4, hi: 0xb4}, + {value: 0xc600, lo: 0xb5, hi: 0xbf}, + // Block 0x68, offset 0x24a + {value: 0x0000, lo: 0x05}, + {value: 0xc600, lo: 0x80, hi: 0x8f}, + {value: 0xe500, lo: 0x90, hi: 0x90}, + {value: 0xc600, lo: 0x91, hi: 0xab}, + {value: 0xe500, lo: 0xac, hi: 0xac}, + {value: 0xc600, lo: 0xad, hi: 0xbf}, + // Block 0x69, offset 0x250 + {value: 0x0000, lo: 0x05}, + {value: 0xc600, lo: 0x80, hi: 0x87}, + {value: 0xe500, lo: 0x88, hi: 0x88}, + {value: 0xc600, lo: 0x89, hi: 0xa3}, + {value: 0xe500, lo: 0xa4, hi: 0xa4}, + {value: 0xc600, lo: 0xa5, hi: 0xbf}, + // Block 0x6a, offset 0x256 + {value: 0x0000, lo: 0x03}, + {value: 0xc600, lo: 0x80, hi: 0x87}, + {value: 0xe500, lo: 0x88, hi: 0x88}, + {value: 0xc600, lo: 0x89, hi: 0xa3}, + // Block 0x6b, offset 0x25a + {value: 0x0002, lo: 0x01}, + {value: 0x0003, lo: 0x81, hi: 0xbf}, + // Block 0x6c, offset 0x25c + {value: 0x0000, lo: 0x01}, + {value: 0x812e, lo: 0xbd, hi: 0xbd}, + // Block 0x6d, offset 0x25e + {value: 0x0000, lo: 0x01}, + {value: 0x812e, lo: 0xa0, hi: 0xa0}, + // Block 0x6e, offset 0x260 + {value: 0x0000, lo: 0x01}, + {value: 0x8133, lo: 0xb6, hi: 0xba}, + // Block 0x6f, offset 0x262 + {value: 0x002d, lo: 0x05}, + {value: 0x812e, lo: 0x8d, hi: 0x8d}, + {value: 0x8133, lo: 0x8f, hi: 0x8f}, + {value: 0x8133, lo: 0xb8, hi: 0xb8}, + {value: 0x8101, lo: 0xb9, hi: 0xba}, + {value: 0x8105, lo: 0xbf, hi: 0xbf}, + // Block 0x70, offset 0x268 + {value: 0x0000, lo: 0x02}, + {value: 0x8133, lo: 0xa5, hi: 0xa5}, + {value: 0x812e, lo: 0xa6, hi: 0xa6}, + // Block 0x71, offset 0x26b + {value: 0x0000, lo: 0x01}, + {value: 0x8133, lo: 0xa4, hi: 0xa7}, + // Block 0x72, offset 0x26d + {value: 0x0000, lo: 0x01}, + {value: 0x8133, lo: 0xab, hi: 0xac}, + // Block 0x73, offset 0x26f + {value: 0x0000, lo: 0x01}, + {value: 0x812e, lo: 0xbd, hi: 0xbf}, + // Block 0x74, offset 0x271 + {value: 0x0000, lo: 0x05}, + {value: 0x812e, lo: 0x86, hi: 0x87}, + {value: 0x8133, lo: 0x88, hi: 0x8a}, + {value: 0x812e, lo: 0x8b, hi: 0x8b}, + {value: 0x8133, lo: 0x8c, hi: 0x8c}, + {value: 0x812e, lo: 0x8d, hi: 0x90}, + // Block 0x75, offset 0x277 + {value: 0x0005, lo: 0x03}, + {value: 0x8133, lo: 0x82, hi: 0x82}, + {value: 0x812e, lo: 0x83, hi: 0x84}, + {value: 0x812e, lo: 0x85, hi: 0x85}, + // Block 0x76, offset 0x27b + {value: 0x0000, lo: 0x03}, + {value: 0x8105, lo: 0x86, hi: 0x86}, + {value: 0x8105, lo: 0xb0, hi: 0xb0}, + {value: 0x8105, lo: 0xbf, hi: 0xbf}, + // Block 0x77, offset 0x27f + {value: 0x17fe, lo: 0x07}, + {value: 0xa000, lo: 0x99, hi: 0x99}, + {value: 0x4379, lo: 0x9a, hi: 0x9a}, + {value: 0xa000, lo: 0x9b, hi: 0x9b}, + {value: 0x4383, lo: 0x9c, hi: 0x9c}, + {value: 0xa000, lo: 0xa5, hi: 0xa5}, + {value: 0x438d, lo: 0xab, hi: 0xab}, + {value: 0x8105, lo: 0xb9, hi: 0xba}, + // Block 0x78, offset 0x287 + {value: 0x0000, lo: 0x06}, + {value: 0x8133, lo: 0x80, hi: 0x82}, + {value: 0x9900, lo: 0xa7, hi: 0xa7}, + {value: 0x2eb5, lo: 0xae, hi: 0xae}, + {value: 0x2ebf, lo: 0xaf, hi: 0xaf}, + {value: 0xa000, lo: 0xb1, hi: 0xb2}, + {value: 0x8105, lo: 0xb3, hi: 0xb4}, + // Block 0x79, offset 0x28e + {value: 0x0000, lo: 0x02}, + {value: 0x8105, lo: 0x80, hi: 0x80}, + {value: 0x8103, lo: 0x8a, hi: 0x8a}, + // Block 0x7a, offset 0x291 + {value: 0x0000, lo: 0x02}, + {value: 0x8105, lo: 0xb5, hi: 0xb5}, + {value: 0x8103, lo: 0xb6, hi: 0xb6}, + // Block 0x7b, offset 0x294 + {value: 0x0002, lo: 0x01}, + {value: 0x8103, lo: 0xa9, hi: 0xaa}, + // Block 0x7c, offset 0x296 + {value: 0x0000, lo: 0x02}, + {value: 0x8103, lo: 0xbb, hi: 0xbc}, + {value: 0x9900, lo: 0xbe, hi: 0xbe}, + // Block 0x7d, offset 0x299 + {value: 0x0000, lo: 0x07}, + {value: 0xa000, lo: 0x87, hi: 0x87}, + {value: 0x2ec9, lo: 0x8b, hi: 0x8b}, + {value: 0x2ed3, lo: 0x8c, hi: 0x8c}, + {value: 0x8105, lo: 0x8d, hi: 0x8d}, + {value: 0x9900, lo: 0x97, hi: 0x97}, + {value: 0x8133, lo: 0xa6, hi: 0xac}, + {value: 0x8133, lo: 0xb0, hi: 0xb4}, + // Block 0x7e, offset 0x2a1 + {value: 0x0000, lo: 0x03}, + {value: 0x8105, lo: 0x82, hi: 0x82}, + {value: 0x8103, lo: 0x86, hi: 0x86}, + {value: 0x8133, lo: 0x9e, hi: 0x9e}, + // Block 0x7f, offset 0x2a5 + {value: 0x6a23, lo: 0x06}, + {value: 0x9900, lo: 0xb0, hi: 0xb0}, + {value: 0xa000, lo: 0xb9, hi: 0xb9}, + {value: 0x9900, lo: 0xba, hi: 0xba}, + {value: 0x2ee7, lo: 0xbb, hi: 0xbb}, + {value: 0x2edd, lo: 0xbc, hi: 0xbd}, + {value: 0x2ef1, lo: 0xbe, hi: 0xbe}, + // Block 0x80, offset 0x2ac + {value: 0x0000, lo: 0x02}, + {value: 0x8105, lo: 0x82, hi: 0x82}, + {value: 0x8103, lo: 0x83, hi: 0x83}, + // Block 0x81, offset 0x2af + {value: 0x0000, lo: 0x05}, + {value: 0x9900, lo: 0xaf, hi: 0xaf}, + {value: 0xa000, lo: 0xb8, hi: 0xb9}, + {value: 0x2efb, lo: 0xba, hi: 0xba}, + {value: 0x2f05, lo: 0xbb, hi: 0xbb}, + {value: 0x8105, lo: 0xbf, hi: 0xbf}, + // Block 0x82, offset 0x2b5 + {value: 0x0000, lo: 0x01}, + {value: 0x8103, lo: 0x80, hi: 0x80}, + // Block 0x83, offset 0x2b7 + {value: 0x0000, lo: 0x01}, + {value: 0x8105, lo: 0xbf, hi: 0xbf}, + // Block 0x84, offset 0x2b9 + {value: 0x0000, lo: 0x02}, + {value: 0x8105, lo: 0xb6, hi: 0xb6}, + {value: 0x8103, lo: 0xb7, hi: 0xb7}, + // Block 0x85, offset 0x2bc + {value: 0x0000, lo: 0x01}, + {value: 0x8105, lo: 0xab, hi: 0xab}, + // Block 0x86, offset 0x2be + {value: 0x0000, lo: 0x02}, + {value: 0x8105, lo: 0xb9, hi: 0xb9}, + {value: 0x8103, lo: 0xba, hi: 0xba}, + // Block 0x87, offset 0x2c1 + {value: 0x0000, lo: 0x04}, + {value: 0x9900, lo: 0xb0, hi: 0xb0}, + {value: 0xa000, lo: 0xb5, hi: 0xb5}, + {value: 0x2f0f, lo: 0xb8, hi: 0xb8}, + {value: 0x8105, lo: 0xbd, hi: 0xbe}, + // Block 0x88, offset 0x2c6 + {value: 0x0000, lo: 0x01}, + {value: 0x8103, lo: 0x83, hi: 0x83}, + // Block 0x89, offset 0x2c8 + {value: 0x0000, lo: 0x01}, + {value: 0x8105, lo: 0xa0, hi: 0xa0}, + // Block 0x8a, offset 0x2ca + {value: 0x0000, lo: 0x01}, + {value: 0x8105, lo: 0xb4, hi: 0xb4}, + // Block 0x8b, offset 0x2cc + {value: 0x0000, lo: 0x01}, + {value: 0x8105, lo: 0x87, hi: 0x87}, + // Block 0x8c, offset 0x2ce + {value: 0x0000, lo: 0x01}, + {value: 0x8105, lo: 0x99, hi: 0x99}, + // Block 0x8d, offset 0x2d0 + {value: 0x0000, lo: 0x02}, + {value: 0x8103, lo: 0x82, hi: 0x82}, + {value: 0x8105, lo: 0x84, hi: 0x85}, + // Block 0x8e, offset 0x2d3 + {value: 0x0000, lo: 0x01}, + {value: 0x8105, lo: 0x97, hi: 0x97}, + // Block 0x8f, offset 0x2d5 + {value: 0x0000, lo: 0x01}, + {value: 0x8105, lo: 0x81, hi: 0x82}, + // Block 0x90, offset 0x2d7 + {value: 0x0000, lo: 0x01}, + {value: 0x8101, lo: 0xb0, hi: 0xb4}, + // Block 0x91, offset 0x2d9 + {value: 0x0000, lo: 0x01}, + {value: 0x8133, lo: 0xb0, hi: 0xb6}, + // Block 0x92, offset 0x2db + {value: 0x0000, lo: 0x01}, + {value: 0x8102, lo: 0xb0, hi: 0xb1}, + // Block 0x93, offset 0x2dd + {value: 0x0000, lo: 0x01}, + {value: 0x8101, lo: 0x9e, hi: 0x9e}, + // Block 0x94, offset 0x2df + {value: 0x0000, lo: 0x0c}, + {value: 0x470d, lo: 0x9e, hi: 0x9e}, + {value: 0x4717, lo: 0x9f, hi: 0x9f}, + {value: 0x474b, lo: 0xa0, hi: 0xa0}, + {value: 0x4759, lo: 0xa1, hi: 0xa1}, + {value: 0x4767, lo: 0xa2, hi: 0xa2}, + {value: 0x4775, lo: 0xa3, hi: 0xa3}, + {value: 0x4783, lo: 0xa4, hi: 0xa4}, + {value: 0x812c, lo: 0xa5, hi: 0xa6}, + {value: 0x8101, lo: 0xa7, hi: 0xa9}, + {value: 0x8131, lo: 0xad, hi: 0xad}, + {value: 0x812c, lo: 0xae, hi: 0xb2}, + {value: 0x812e, lo: 0xbb, hi: 0xbf}, + // Block 0x95, offset 0x2ec + {value: 0x0000, lo: 0x09}, + {value: 0x812e, lo: 0x80, hi: 0x82}, + {value: 0x8133, lo: 0x85, hi: 0x89}, + {value: 0x812e, lo: 0x8a, hi: 0x8b}, + {value: 0x8133, lo: 0xaa, hi: 0xad}, + {value: 0x4721, lo: 0xbb, hi: 0xbb}, + {value: 0x472b, lo: 0xbc, hi: 0xbc}, + {value: 0x4791, lo: 0xbd, hi: 0xbd}, + {value: 0x47ad, lo: 0xbe, hi: 0xbe}, + {value: 0x479f, lo: 0xbf, hi: 0xbf}, + // Block 0x96, offset 0x2f6 + {value: 0x0000, lo: 0x01}, + {value: 0x47bb, lo: 0x80, hi: 0x80}, + // Block 0x97, offset 0x2f8 + {value: 0x0000, lo: 0x01}, + {value: 0x8133, lo: 0x82, hi: 0x84}, + // Block 0x98, offset 0x2fa + {value: 0x0002, lo: 0x03}, + {value: 0x0043, lo: 0x80, hi: 0x99}, + {value: 0x0083, lo: 0x9a, hi: 0xb3}, + {value: 0x0043, lo: 0xb4, hi: 0xbf}, + // Block 0x99, offset 0x2fe + {value: 0x0002, lo: 0x04}, + {value: 0x005b, lo: 0x80, hi: 0x8d}, + {value: 0x0083, lo: 0x8e, hi: 0x94}, + {value: 0x0093, lo: 0x96, hi: 0xa7}, + {value: 0x0043, lo: 0xa8, hi: 0xbf}, + // Block 0x9a, offset 0x303 + {value: 0x0002, lo: 0x0b}, + {value: 0x0073, lo: 0x80, hi: 0x81}, + {value: 0x0083, lo: 0x82, hi: 0x9b}, + {value: 0x0043, lo: 0x9c, hi: 0x9c}, + {value: 0x0047, lo: 0x9e, hi: 0x9f}, + {value: 0x004f, lo: 0xa2, hi: 0xa2}, + {value: 0x0055, lo: 0xa5, hi: 0xa6}, + {value: 0x005d, lo: 0xa9, hi: 0xac}, + {value: 0x0067, lo: 0xae, hi: 0xb5}, + {value: 0x0083, lo: 0xb6, hi: 0xb9}, + {value: 0x008d, lo: 0xbb, hi: 0xbb}, + {value: 0x0091, lo: 0xbd, hi: 0xbf}, + // Block 0x9b, offset 0x30f + {value: 0x0002, lo: 0x04}, + {value: 0x0097, lo: 0x80, hi: 0x83}, + {value: 0x00a1, lo: 0x85, hi: 0x8f}, + {value: 0x0043, lo: 0x90, hi: 0xa9}, + {value: 0x0083, lo: 0xaa, hi: 0xbf}, + // Block 0x9c, offset 0x314 + {value: 0x0002, lo: 0x08}, + {value: 0x00af, lo: 0x80, hi: 0x83}, + {value: 0x0043, lo: 0x84, hi: 0x85}, + {value: 0x0049, lo: 0x87, hi: 0x8a}, + {value: 0x0055, lo: 0x8d, hi: 0x94}, + {value: 0x0067, lo: 0x96, hi: 0x9c}, + {value: 0x0083, lo: 0x9e, hi: 0xb7}, + {value: 0x0043, lo: 0xb8, hi: 0xb9}, + {value: 0x0049, lo: 0xbb, hi: 0xbe}, + // Block 0x9d, offset 0x31d + {value: 0x0002, lo: 0x05}, + {value: 0x0053, lo: 0x80, hi: 0x84}, + {value: 0x005f, lo: 0x86, hi: 0x86}, + {value: 0x0067, lo: 0x8a, hi: 0x90}, + {value: 0x0083, lo: 0x92, hi: 0xab}, + {value: 0x0043, lo: 0xac, hi: 0xbf}, + // Block 0x9e, offset 0x323 + {value: 0x0002, lo: 0x04}, + {value: 0x006b, lo: 0x80, hi: 0x85}, + {value: 0x0083, lo: 0x86, hi: 0x9f}, + {value: 0x0043, lo: 0xa0, hi: 0xb9}, + {value: 0x0083, lo: 0xba, hi: 0xbf}, + // Block 0x9f, offset 0x328 + {value: 0x0002, lo: 0x03}, + {value: 0x008f, lo: 0x80, hi: 0x93}, + {value: 0x0043, lo: 0x94, hi: 0xad}, + {value: 0x0083, lo: 0xae, hi: 0xbf}, + // Block 0xa0, offset 0x32c + {value: 0x0002, lo: 0x04}, + {value: 0x00a7, lo: 0x80, hi: 0x87}, + {value: 0x0043, lo: 0x88, hi: 0xa1}, + {value: 0x0083, lo: 0xa2, hi: 0xbb}, + {value: 0x0043, lo: 0xbc, hi: 0xbf}, + // Block 0xa1, offset 0x331 + {value: 0x0002, lo: 0x03}, + {value: 0x004b, lo: 0x80, hi: 0x95}, + {value: 0x0083, lo: 0x96, hi: 0xaf}, + {value: 0x0043, lo: 0xb0, hi: 0xbf}, + // Block 0xa2, offset 0x335 + {value: 0x0003, lo: 0x0f}, + {value: 0x023c, lo: 0x80, hi: 0x80}, + {value: 0x0556, lo: 0x81, hi: 0x81}, + {value: 0x023f, lo: 0x82, hi: 0x9a}, + {value: 0x0552, lo: 0x9b, hi: 0x9b}, + {value: 0x024b, lo: 0x9c, hi: 0x9c}, + {value: 0x0254, lo: 0x9d, hi: 0x9d}, + {value: 0x025a, lo: 0x9e, hi: 0x9e}, + {value: 0x027e, lo: 0x9f, hi: 0x9f}, + {value: 0x026f, lo: 0xa0, hi: 0xa0}, + {value: 0x026c, lo: 0xa1, hi: 0xa1}, + {value: 0x01f7, lo: 0xa2, hi: 0xb2}, + {value: 0x020c, lo: 0xb3, hi: 0xb3}, + {value: 0x022a, lo: 0xb4, hi: 0xba}, + {value: 0x0556, lo: 0xbb, hi: 0xbb}, + {value: 0x023f, lo: 0xbc, hi: 0xbf}, + // Block 0xa3, offset 0x345 + {value: 0x0003, lo: 0x0d}, + {value: 0x024b, lo: 0x80, hi: 0x94}, + {value: 0x0552, lo: 0x95, hi: 0x95}, + {value: 0x024b, lo: 0x96, hi: 0x96}, + {value: 0x0254, lo: 0x97, hi: 0x97}, + {value: 0x025a, lo: 0x98, hi: 0x98}, + {value: 0x027e, lo: 0x99, hi: 0x99}, + {value: 0x026f, lo: 0x9a, hi: 0x9a}, + {value: 0x026c, lo: 0x9b, hi: 0x9b}, + {value: 0x01f7, lo: 0x9c, hi: 0xac}, + {value: 0x020c, lo: 0xad, hi: 0xad}, + {value: 0x022a, lo: 0xae, hi: 0xb4}, + {value: 0x0556, lo: 0xb5, hi: 0xb5}, + {value: 0x023f, lo: 0xb6, hi: 0xbf}, + // Block 0xa4, offset 0x353 + {value: 0x0003, lo: 0x0d}, + {value: 0x025d, lo: 0x80, hi: 0x8e}, + {value: 0x0552, lo: 0x8f, hi: 0x8f}, + {value: 0x024b, lo: 0x90, hi: 0x90}, + {value: 0x0254, lo: 0x91, hi: 0x91}, + {value: 0x025a, lo: 0x92, hi: 0x92}, + {value: 0x027e, lo: 0x93, hi: 0x93}, + {value: 0x026f, lo: 0x94, hi: 0x94}, + {value: 0x026c, lo: 0x95, hi: 0x95}, + {value: 0x01f7, lo: 0x96, hi: 0xa6}, + {value: 0x020c, lo: 0xa7, hi: 0xa7}, + {value: 0x022a, lo: 0xa8, hi: 0xae}, + {value: 0x0556, lo: 0xaf, hi: 0xaf}, + {value: 0x023f, lo: 0xb0, hi: 0xbf}, + // Block 0xa5, offset 0x361 + {value: 0x0003, lo: 0x0d}, + {value: 0x026f, lo: 0x80, hi: 0x88}, + {value: 0x0552, lo: 0x89, hi: 0x89}, + {value: 0x024b, lo: 0x8a, hi: 0x8a}, + {value: 0x0254, lo: 0x8b, hi: 0x8b}, + {value: 0x025a, lo: 0x8c, hi: 0x8c}, + {value: 0x027e, lo: 0x8d, hi: 0x8d}, + {value: 0x026f, lo: 0x8e, hi: 0x8e}, + {value: 0x026c, lo: 0x8f, hi: 0x8f}, + {value: 0x01f7, lo: 0x90, hi: 0xa0}, + {value: 0x020c, lo: 0xa1, hi: 0xa1}, + {value: 0x022a, lo: 0xa2, hi: 0xa8}, + {value: 0x0556, lo: 0xa9, hi: 0xa9}, + {value: 0x023f, lo: 0xaa, hi: 0xbf}, + // Block 0xa6, offset 0x36f + {value: 0x0000, lo: 0x01}, + {value: 0x8133, lo: 0x8f, hi: 0x8f}, + // Block 0xa7, offset 0x371 + {value: 0x0000, lo: 0x01}, + {value: 0x8133, lo: 0xae, hi: 0xae}, + // Block 0xa8, offset 0x373 + {value: 0x0000, lo: 0x01}, + {value: 0x8133, lo: 0xac, hi: 0xaf}, + // Block 0xa9, offset 0x375 + {value: 0x0000, lo: 0x03}, + {value: 0x8134, lo: 0xac, hi: 0xad}, + {value: 0x812e, lo: 0xae, hi: 0xae}, + {value: 0x8133, lo: 0xaf, hi: 0xaf}, + // Block 0xaa, offset 0x379 + {value: 0x0000, lo: 0x01}, + {value: 0x812e, lo: 0x90, hi: 0x96}, + // Block 0xab, offset 0x37b + {value: 0x0000, lo: 0x02}, + {value: 0x8133, lo: 0x84, hi: 0x89}, + {value: 0x8103, lo: 0x8a, hi: 0x8a}, + // Block 0xac, offset 0x37e + {value: 0x0002, lo: 0x0a}, + {value: 0x0063, lo: 0x80, hi: 0x89}, + {value: 0x1a7e, lo: 0x8a, hi: 0x8a}, + {value: 0x1ab1, lo: 0x8b, hi: 0x8b}, + {value: 0x1acc, lo: 0x8c, hi: 0x8c}, + {value: 0x1ad2, lo: 0x8d, hi: 0x8d}, + {value: 0x1cf0, lo: 0x8e, hi: 0x8e}, + {value: 0x1ade, lo: 0x8f, hi: 0x8f}, + {value: 0x1aa8, lo: 0xaa, hi: 0xaa}, + {value: 0x1aab, lo: 0xab, hi: 0xab}, + {value: 0x1aae, lo: 0xac, hi: 0xac}, + // Block 0xad, offset 0x389 + {value: 0x0000, lo: 0x01}, + {value: 0x1a6c, lo: 0x90, hi: 0x90}, + // Block 0xae, offset 0x38b + {value: 0x0028, lo: 0x09}, + {value: 0x2999, lo: 0x80, hi: 0x80}, + {value: 0x295d, lo: 0x81, hi: 0x81}, + {value: 0x2967, lo: 0x82, hi: 0x82}, + {value: 0x297b, lo: 0x83, hi: 0x84}, + {value: 0x2985, lo: 0x85, hi: 0x86}, + {value: 0x2971, lo: 0x87, hi: 0x87}, + {value: 0x298f, lo: 0x88, hi: 0x88}, + {value: 0x0c6a, lo: 0x90, hi: 0x90}, + {value: 0x09e2, lo: 0x91, hi: 0x91}, + // Block 0xaf, offset 0x395 + {value: 0x0002, lo: 0x01}, + {value: 0x0021, lo: 0xb0, hi: 0xb9}, +} + +// recompMap: 7528 bytes (entries only) +var recompMap map[uint32]rune +var recompMapOnce sync.Once + +const recompMapPacked = "" + + "\x00A\x03\x00\x00\x00\x00\xc0" + // 0x00410300: 0x000000C0 + "\x00A\x03\x01\x00\x00\x00\xc1" + // 0x00410301: 0x000000C1 + "\x00A\x03\x02\x00\x00\x00\xc2" + // 0x00410302: 0x000000C2 + "\x00A\x03\x03\x00\x00\x00\xc3" + // 0x00410303: 0x000000C3 + "\x00A\x03\b\x00\x00\x00\xc4" + // 0x00410308: 0x000000C4 + "\x00A\x03\n\x00\x00\x00\xc5" + // 0x0041030A: 0x000000C5 + "\x00C\x03'\x00\x00\x00\xc7" + // 0x00430327: 0x000000C7 + "\x00E\x03\x00\x00\x00\x00\xc8" + // 0x00450300: 0x000000C8 + "\x00E\x03\x01\x00\x00\x00\xc9" + // 0x00450301: 0x000000C9 + "\x00E\x03\x02\x00\x00\x00\xca" + // 0x00450302: 0x000000CA + "\x00E\x03\b\x00\x00\x00\xcb" + // 0x00450308: 0x000000CB + "\x00I\x03\x00\x00\x00\x00\xcc" + // 0x00490300: 0x000000CC + "\x00I\x03\x01\x00\x00\x00\xcd" + // 0x00490301: 0x000000CD + "\x00I\x03\x02\x00\x00\x00\xce" + // 0x00490302: 0x000000CE + "\x00I\x03\b\x00\x00\x00\xcf" + // 0x00490308: 0x000000CF + "\x00N\x03\x03\x00\x00\x00\xd1" + // 0x004E0303: 0x000000D1 + "\x00O\x03\x00\x00\x00\x00\xd2" + // 0x004F0300: 0x000000D2 + "\x00O\x03\x01\x00\x00\x00\xd3" + // 0x004F0301: 0x000000D3 + "\x00O\x03\x02\x00\x00\x00\xd4" + // 0x004F0302: 0x000000D4 + "\x00O\x03\x03\x00\x00\x00\xd5" + // 0x004F0303: 0x000000D5 + "\x00O\x03\b\x00\x00\x00\xd6" + // 0x004F0308: 0x000000D6 + "\x00U\x03\x00\x00\x00\x00\xd9" + // 0x00550300: 0x000000D9 + "\x00U\x03\x01\x00\x00\x00\xda" + // 0x00550301: 0x000000DA + "\x00U\x03\x02\x00\x00\x00\xdb" + // 0x00550302: 0x000000DB + "\x00U\x03\b\x00\x00\x00\xdc" + // 0x00550308: 0x000000DC + "\x00Y\x03\x01\x00\x00\x00\xdd" + // 0x00590301: 0x000000DD + "\x00a\x03\x00\x00\x00\x00\xe0" + // 0x00610300: 0x000000E0 + "\x00a\x03\x01\x00\x00\x00\xe1" + // 0x00610301: 0x000000E1 + "\x00a\x03\x02\x00\x00\x00\xe2" + // 0x00610302: 0x000000E2 + "\x00a\x03\x03\x00\x00\x00\xe3" + // 0x00610303: 0x000000E3 + "\x00a\x03\b\x00\x00\x00\xe4" + // 0x00610308: 0x000000E4 + "\x00a\x03\n\x00\x00\x00\xe5" + // 0x0061030A: 0x000000E5 + "\x00c\x03'\x00\x00\x00\xe7" + // 0x00630327: 0x000000E7 + "\x00e\x03\x00\x00\x00\x00\xe8" + // 0x00650300: 0x000000E8 + "\x00e\x03\x01\x00\x00\x00\xe9" + // 0x00650301: 0x000000E9 + "\x00e\x03\x02\x00\x00\x00\xea" + // 0x00650302: 0x000000EA + "\x00e\x03\b\x00\x00\x00\xeb" + // 0x00650308: 0x000000EB + "\x00i\x03\x00\x00\x00\x00\xec" + // 0x00690300: 0x000000EC + "\x00i\x03\x01\x00\x00\x00\xed" + // 0x00690301: 0x000000ED + "\x00i\x03\x02\x00\x00\x00\xee" + // 0x00690302: 0x000000EE + "\x00i\x03\b\x00\x00\x00\xef" + // 0x00690308: 0x000000EF + "\x00n\x03\x03\x00\x00\x00\xf1" + // 0x006E0303: 0x000000F1 + "\x00o\x03\x00\x00\x00\x00\xf2" + // 0x006F0300: 0x000000F2 + "\x00o\x03\x01\x00\x00\x00\xf3" + // 0x006F0301: 0x000000F3 + "\x00o\x03\x02\x00\x00\x00\xf4" + // 0x006F0302: 0x000000F4 + "\x00o\x03\x03\x00\x00\x00\xf5" + // 0x006F0303: 0x000000F5 + "\x00o\x03\b\x00\x00\x00\xf6" + // 0x006F0308: 0x000000F6 + "\x00u\x03\x00\x00\x00\x00\xf9" + // 0x00750300: 0x000000F9 + "\x00u\x03\x01\x00\x00\x00\xfa" + // 0x00750301: 0x000000FA + "\x00u\x03\x02\x00\x00\x00\xfb" + // 0x00750302: 0x000000FB + "\x00u\x03\b\x00\x00\x00\xfc" + // 0x00750308: 0x000000FC + "\x00y\x03\x01\x00\x00\x00\xfd" + // 0x00790301: 0x000000FD + "\x00y\x03\b\x00\x00\x00\xff" + // 0x00790308: 0x000000FF + "\x00A\x03\x04\x00\x00\x01\x00" + // 0x00410304: 0x00000100 + "\x00a\x03\x04\x00\x00\x01\x01" + // 0x00610304: 0x00000101 + "\x00A\x03\x06\x00\x00\x01\x02" + // 0x00410306: 0x00000102 + "\x00a\x03\x06\x00\x00\x01\x03" + // 0x00610306: 0x00000103 + "\x00A\x03(\x00\x00\x01\x04" + // 0x00410328: 0x00000104 + "\x00a\x03(\x00\x00\x01\x05" + // 0x00610328: 0x00000105 + "\x00C\x03\x01\x00\x00\x01\x06" + // 0x00430301: 0x00000106 + "\x00c\x03\x01\x00\x00\x01\a" + // 0x00630301: 0x00000107 + "\x00C\x03\x02\x00\x00\x01\b" + // 0x00430302: 0x00000108 + "\x00c\x03\x02\x00\x00\x01\t" + // 0x00630302: 0x00000109 + "\x00C\x03\a\x00\x00\x01\n" + // 0x00430307: 0x0000010A + "\x00c\x03\a\x00\x00\x01\v" + // 0x00630307: 0x0000010B + "\x00C\x03\f\x00\x00\x01\f" + // 0x0043030C: 0x0000010C + "\x00c\x03\f\x00\x00\x01\r" + // 0x0063030C: 0x0000010D + "\x00D\x03\f\x00\x00\x01\x0e" + // 0x0044030C: 0x0000010E + "\x00d\x03\f\x00\x00\x01\x0f" + // 0x0064030C: 0x0000010F + "\x00E\x03\x04\x00\x00\x01\x12" + // 0x00450304: 0x00000112 + "\x00e\x03\x04\x00\x00\x01\x13" + // 0x00650304: 0x00000113 + "\x00E\x03\x06\x00\x00\x01\x14" + // 0x00450306: 0x00000114 + "\x00e\x03\x06\x00\x00\x01\x15" + // 0x00650306: 0x00000115 + "\x00E\x03\a\x00\x00\x01\x16" + // 0x00450307: 0x00000116 + "\x00e\x03\a\x00\x00\x01\x17" + // 0x00650307: 0x00000117 + "\x00E\x03(\x00\x00\x01\x18" + // 0x00450328: 0x00000118 + "\x00e\x03(\x00\x00\x01\x19" + // 0x00650328: 0x00000119 + "\x00E\x03\f\x00\x00\x01\x1a" + // 0x0045030C: 0x0000011A + "\x00e\x03\f\x00\x00\x01\x1b" + // 0x0065030C: 0x0000011B + "\x00G\x03\x02\x00\x00\x01\x1c" + // 0x00470302: 0x0000011C + "\x00g\x03\x02\x00\x00\x01\x1d" + // 0x00670302: 0x0000011D + "\x00G\x03\x06\x00\x00\x01\x1e" + // 0x00470306: 0x0000011E + "\x00g\x03\x06\x00\x00\x01\x1f" + // 0x00670306: 0x0000011F + "\x00G\x03\a\x00\x00\x01 " + // 0x00470307: 0x00000120 + "\x00g\x03\a\x00\x00\x01!" + // 0x00670307: 0x00000121 + "\x00G\x03'\x00\x00\x01\"" + // 0x00470327: 0x00000122 + "\x00g\x03'\x00\x00\x01#" + // 0x00670327: 0x00000123 + "\x00H\x03\x02\x00\x00\x01$" + // 0x00480302: 0x00000124 + "\x00h\x03\x02\x00\x00\x01%" + // 0x00680302: 0x00000125 + "\x00I\x03\x03\x00\x00\x01(" + // 0x00490303: 0x00000128 + "\x00i\x03\x03\x00\x00\x01)" + // 0x00690303: 0x00000129 + "\x00I\x03\x04\x00\x00\x01*" + // 0x00490304: 0x0000012A + "\x00i\x03\x04\x00\x00\x01+" + // 0x00690304: 0x0000012B + "\x00I\x03\x06\x00\x00\x01," + // 0x00490306: 0x0000012C + "\x00i\x03\x06\x00\x00\x01-" + // 0x00690306: 0x0000012D + "\x00I\x03(\x00\x00\x01." + // 0x00490328: 0x0000012E + "\x00i\x03(\x00\x00\x01/" + // 0x00690328: 0x0000012F + "\x00I\x03\a\x00\x00\x010" + // 0x00490307: 0x00000130 + "\x00J\x03\x02\x00\x00\x014" + // 0x004A0302: 0x00000134 + "\x00j\x03\x02\x00\x00\x015" + // 0x006A0302: 0x00000135 + "\x00K\x03'\x00\x00\x016" + // 0x004B0327: 0x00000136 + "\x00k\x03'\x00\x00\x017" + // 0x006B0327: 0x00000137 + "\x00L\x03\x01\x00\x00\x019" + // 0x004C0301: 0x00000139 + "\x00l\x03\x01\x00\x00\x01:" + // 0x006C0301: 0x0000013A + "\x00L\x03'\x00\x00\x01;" + // 0x004C0327: 0x0000013B + "\x00l\x03'\x00\x00\x01<" + // 0x006C0327: 0x0000013C + "\x00L\x03\f\x00\x00\x01=" + // 0x004C030C: 0x0000013D + "\x00l\x03\f\x00\x00\x01>" + // 0x006C030C: 0x0000013E + "\x00N\x03\x01\x00\x00\x01C" + // 0x004E0301: 0x00000143 + "\x00n\x03\x01\x00\x00\x01D" + // 0x006E0301: 0x00000144 + "\x00N\x03'\x00\x00\x01E" + // 0x004E0327: 0x00000145 + "\x00n\x03'\x00\x00\x01F" + // 0x006E0327: 0x00000146 + "\x00N\x03\f\x00\x00\x01G" + // 0x004E030C: 0x00000147 + "\x00n\x03\f\x00\x00\x01H" + // 0x006E030C: 0x00000148 + "\x00O\x03\x04\x00\x00\x01L" + // 0x004F0304: 0x0000014C + "\x00o\x03\x04\x00\x00\x01M" + // 0x006F0304: 0x0000014D + "\x00O\x03\x06\x00\x00\x01N" + // 0x004F0306: 0x0000014E + "\x00o\x03\x06\x00\x00\x01O" + // 0x006F0306: 0x0000014F + "\x00O\x03\v\x00\x00\x01P" + // 0x004F030B: 0x00000150 + "\x00o\x03\v\x00\x00\x01Q" + // 0x006F030B: 0x00000151 + "\x00R\x03\x01\x00\x00\x01T" + // 0x00520301: 0x00000154 + "\x00r\x03\x01\x00\x00\x01U" + // 0x00720301: 0x00000155 + "\x00R\x03'\x00\x00\x01V" + // 0x00520327: 0x00000156 + "\x00r\x03'\x00\x00\x01W" + // 0x00720327: 0x00000157 + "\x00R\x03\f\x00\x00\x01X" + // 0x0052030C: 0x00000158 + "\x00r\x03\f\x00\x00\x01Y" + // 0x0072030C: 0x00000159 + "\x00S\x03\x01\x00\x00\x01Z" + // 0x00530301: 0x0000015A + "\x00s\x03\x01\x00\x00\x01[" + // 0x00730301: 0x0000015B + "\x00S\x03\x02\x00\x00\x01\\" + // 0x00530302: 0x0000015C + "\x00s\x03\x02\x00\x00\x01]" + // 0x00730302: 0x0000015D + "\x00S\x03'\x00\x00\x01^" + // 0x00530327: 0x0000015E + "\x00s\x03'\x00\x00\x01_" + // 0x00730327: 0x0000015F + "\x00S\x03\f\x00\x00\x01`" + // 0x0053030C: 0x00000160 + "\x00s\x03\f\x00\x00\x01a" + // 0x0073030C: 0x00000161 + "\x00T\x03'\x00\x00\x01b" + // 0x00540327: 0x00000162 + "\x00t\x03'\x00\x00\x01c" + // 0x00740327: 0x00000163 + "\x00T\x03\f\x00\x00\x01d" + // 0x0054030C: 0x00000164 + "\x00t\x03\f\x00\x00\x01e" + // 0x0074030C: 0x00000165 + "\x00U\x03\x03\x00\x00\x01h" + // 0x00550303: 0x00000168 + "\x00u\x03\x03\x00\x00\x01i" + // 0x00750303: 0x00000169 + "\x00U\x03\x04\x00\x00\x01j" + // 0x00550304: 0x0000016A + "\x00u\x03\x04\x00\x00\x01k" + // 0x00750304: 0x0000016B + "\x00U\x03\x06\x00\x00\x01l" + // 0x00550306: 0x0000016C + "\x00u\x03\x06\x00\x00\x01m" + // 0x00750306: 0x0000016D + "\x00U\x03\n\x00\x00\x01n" + // 0x0055030A: 0x0000016E + "\x00u\x03\n\x00\x00\x01o" + // 0x0075030A: 0x0000016F + "\x00U\x03\v\x00\x00\x01p" + // 0x0055030B: 0x00000170 + "\x00u\x03\v\x00\x00\x01q" + // 0x0075030B: 0x00000171 + "\x00U\x03(\x00\x00\x01r" + // 0x00550328: 0x00000172 + "\x00u\x03(\x00\x00\x01s" + // 0x00750328: 0x00000173 + "\x00W\x03\x02\x00\x00\x01t" + // 0x00570302: 0x00000174 + "\x00w\x03\x02\x00\x00\x01u" + // 0x00770302: 0x00000175 + "\x00Y\x03\x02\x00\x00\x01v" + // 0x00590302: 0x00000176 + "\x00y\x03\x02\x00\x00\x01w" + // 0x00790302: 0x00000177 + "\x00Y\x03\b\x00\x00\x01x" + // 0x00590308: 0x00000178 + "\x00Z\x03\x01\x00\x00\x01y" + // 0x005A0301: 0x00000179 + "\x00z\x03\x01\x00\x00\x01z" + // 0x007A0301: 0x0000017A + "\x00Z\x03\a\x00\x00\x01{" + // 0x005A0307: 0x0000017B + "\x00z\x03\a\x00\x00\x01|" + // 0x007A0307: 0x0000017C + "\x00Z\x03\f\x00\x00\x01}" + // 0x005A030C: 0x0000017D + "\x00z\x03\f\x00\x00\x01~" + // 0x007A030C: 0x0000017E + "\x00O\x03\x1b\x00\x00\x01\xa0" + // 0x004F031B: 0x000001A0 + "\x00o\x03\x1b\x00\x00\x01\xa1" + // 0x006F031B: 0x000001A1 + "\x00U\x03\x1b\x00\x00\x01\xaf" + // 0x0055031B: 0x000001AF + "\x00u\x03\x1b\x00\x00\x01\xb0" + // 0x0075031B: 0x000001B0 + "\x00A\x03\f\x00\x00\x01\xcd" + // 0x0041030C: 0x000001CD + "\x00a\x03\f\x00\x00\x01\xce" + // 0x0061030C: 0x000001CE + "\x00I\x03\f\x00\x00\x01\xcf" + // 0x0049030C: 0x000001CF + "\x00i\x03\f\x00\x00\x01\xd0" + // 0x0069030C: 0x000001D0 + "\x00O\x03\f\x00\x00\x01\xd1" + // 0x004F030C: 0x000001D1 + "\x00o\x03\f\x00\x00\x01\xd2" + // 0x006F030C: 0x000001D2 + "\x00U\x03\f\x00\x00\x01\xd3" + // 0x0055030C: 0x000001D3 + "\x00u\x03\f\x00\x00\x01\xd4" + // 0x0075030C: 0x000001D4 + "\x00\xdc\x03\x04\x00\x00\x01\xd5" + // 0x00DC0304: 0x000001D5 + "\x00\xfc\x03\x04\x00\x00\x01\xd6" + // 0x00FC0304: 0x000001D6 + "\x00\xdc\x03\x01\x00\x00\x01\xd7" + // 0x00DC0301: 0x000001D7 + "\x00\xfc\x03\x01\x00\x00\x01\xd8" + // 0x00FC0301: 0x000001D8 + "\x00\xdc\x03\f\x00\x00\x01\xd9" + // 0x00DC030C: 0x000001D9 + "\x00\xfc\x03\f\x00\x00\x01\xda" + // 0x00FC030C: 0x000001DA + "\x00\xdc\x03\x00\x00\x00\x01\xdb" + // 0x00DC0300: 0x000001DB + "\x00\xfc\x03\x00\x00\x00\x01\xdc" + // 0x00FC0300: 0x000001DC + "\x00\xc4\x03\x04\x00\x00\x01\xde" + // 0x00C40304: 0x000001DE + "\x00\xe4\x03\x04\x00\x00\x01\xdf" + // 0x00E40304: 0x000001DF + "\x02&\x03\x04\x00\x00\x01\xe0" + // 0x02260304: 0x000001E0 + "\x02'\x03\x04\x00\x00\x01\xe1" + // 0x02270304: 0x000001E1 + "\x00\xc6\x03\x04\x00\x00\x01\xe2" + // 0x00C60304: 0x000001E2 + "\x00\xe6\x03\x04\x00\x00\x01\xe3" + // 0x00E60304: 0x000001E3 + "\x00G\x03\f\x00\x00\x01\xe6" + // 0x0047030C: 0x000001E6 + "\x00g\x03\f\x00\x00\x01\xe7" + // 0x0067030C: 0x000001E7 + "\x00K\x03\f\x00\x00\x01\xe8" + // 0x004B030C: 0x000001E8 + "\x00k\x03\f\x00\x00\x01\xe9" + // 0x006B030C: 0x000001E9 + "\x00O\x03(\x00\x00\x01\xea" + // 0x004F0328: 0x000001EA + "\x00o\x03(\x00\x00\x01\xeb" + // 0x006F0328: 0x000001EB + "\x01\xea\x03\x04\x00\x00\x01\xec" + // 0x01EA0304: 0x000001EC + "\x01\xeb\x03\x04\x00\x00\x01\xed" + // 0x01EB0304: 0x000001ED + "\x01\xb7\x03\f\x00\x00\x01\xee" + // 0x01B7030C: 0x000001EE + "\x02\x92\x03\f\x00\x00\x01\xef" + // 0x0292030C: 0x000001EF + "\x00j\x03\f\x00\x00\x01\xf0" + // 0x006A030C: 0x000001F0 + "\x00G\x03\x01\x00\x00\x01\xf4" + // 0x00470301: 0x000001F4 + "\x00g\x03\x01\x00\x00\x01\xf5" + // 0x00670301: 0x000001F5 + "\x00N\x03\x00\x00\x00\x01\xf8" + // 0x004E0300: 0x000001F8 + "\x00n\x03\x00\x00\x00\x01\xf9" + // 0x006E0300: 0x000001F9 + "\x00\xc5\x03\x01\x00\x00\x01\xfa" + // 0x00C50301: 0x000001FA + "\x00\xe5\x03\x01\x00\x00\x01\xfb" + // 0x00E50301: 0x000001FB + "\x00\xc6\x03\x01\x00\x00\x01\xfc" + // 0x00C60301: 0x000001FC + "\x00\xe6\x03\x01\x00\x00\x01\xfd" + // 0x00E60301: 0x000001FD + "\x00\xd8\x03\x01\x00\x00\x01\xfe" + // 0x00D80301: 0x000001FE + "\x00\xf8\x03\x01\x00\x00\x01\xff" + // 0x00F80301: 0x000001FF + "\x00A\x03\x0f\x00\x00\x02\x00" + // 0x0041030F: 0x00000200 + "\x00a\x03\x0f\x00\x00\x02\x01" + // 0x0061030F: 0x00000201 + "\x00A\x03\x11\x00\x00\x02\x02" + // 0x00410311: 0x00000202 + "\x00a\x03\x11\x00\x00\x02\x03" + // 0x00610311: 0x00000203 + "\x00E\x03\x0f\x00\x00\x02\x04" + // 0x0045030F: 0x00000204 + "\x00e\x03\x0f\x00\x00\x02\x05" + // 0x0065030F: 0x00000205 + "\x00E\x03\x11\x00\x00\x02\x06" + // 0x00450311: 0x00000206 + "\x00e\x03\x11\x00\x00\x02\a" + // 0x00650311: 0x00000207 + "\x00I\x03\x0f\x00\x00\x02\b" + // 0x0049030F: 0x00000208 + "\x00i\x03\x0f\x00\x00\x02\t" + // 0x0069030F: 0x00000209 + "\x00I\x03\x11\x00\x00\x02\n" + // 0x00490311: 0x0000020A + "\x00i\x03\x11\x00\x00\x02\v" + // 0x00690311: 0x0000020B + "\x00O\x03\x0f\x00\x00\x02\f" + // 0x004F030F: 0x0000020C + "\x00o\x03\x0f\x00\x00\x02\r" + // 0x006F030F: 0x0000020D + "\x00O\x03\x11\x00\x00\x02\x0e" + // 0x004F0311: 0x0000020E + "\x00o\x03\x11\x00\x00\x02\x0f" + // 0x006F0311: 0x0000020F + "\x00R\x03\x0f\x00\x00\x02\x10" + // 0x0052030F: 0x00000210 + "\x00r\x03\x0f\x00\x00\x02\x11" + // 0x0072030F: 0x00000211 + "\x00R\x03\x11\x00\x00\x02\x12" + // 0x00520311: 0x00000212 + "\x00r\x03\x11\x00\x00\x02\x13" + // 0x00720311: 0x00000213 + "\x00U\x03\x0f\x00\x00\x02\x14" + // 0x0055030F: 0x00000214 + "\x00u\x03\x0f\x00\x00\x02\x15" + // 0x0075030F: 0x00000215 + "\x00U\x03\x11\x00\x00\x02\x16" + // 0x00550311: 0x00000216 + "\x00u\x03\x11\x00\x00\x02\x17" + // 0x00750311: 0x00000217 + "\x00S\x03&\x00\x00\x02\x18" + // 0x00530326: 0x00000218 + "\x00s\x03&\x00\x00\x02\x19" + // 0x00730326: 0x00000219 + "\x00T\x03&\x00\x00\x02\x1a" + // 0x00540326: 0x0000021A + "\x00t\x03&\x00\x00\x02\x1b" + // 0x00740326: 0x0000021B + "\x00H\x03\f\x00\x00\x02\x1e" + // 0x0048030C: 0x0000021E + "\x00h\x03\f\x00\x00\x02\x1f" + // 0x0068030C: 0x0000021F + "\x00A\x03\a\x00\x00\x02&" + // 0x00410307: 0x00000226 + "\x00a\x03\a\x00\x00\x02'" + // 0x00610307: 0x00000227 + "\x00E\x03'\x00\x00\x02(" + // 0x00450327: 0x00000228 + "\x00e\x03'\x00\x00\x02)" + // 0x00650327: 0x00000229 + "\x00\xd6\x03\x04\x00\x00\x02*" + // 0x00D60304: 0x0000022A + "\x00\xf6\x03\x04\x00\x00\x02+" + // 0x00F60304: 0x0000022B + "\x00\xd5\x03\x04\x00\x00\x02," + // 0x00D50304: 0x0000022C + "\x00\xf5\x03\x04\x00\x00\x02-" + // 0x00F50304: 0x0000022D + "\x00O\x03\a\x00\x00\x02." + // 0x004F0307: 0x0000022E + "\x00o\x03\a\x00\x00\x02/" + // 0x006F0307: 0x0000022F + "\x02.\x03\x04\x00\x00\x020" + // 0x022E0304: 0x00000230 + "\x02/\x03\x04\x00\x00\x021" + // 0x022F0304: 0x00000231 + "\x00Y\x03\x04\x00\x00\x022" + // 0x00590304: 0x00000232 + "\x00y\x03\x04\x00\x00\x023" + // 0x00790304: 0x00000233 + "\x00\xa8\x03\x01\x00\x00\x03\x85" + // 0x00A80301: 0x00000385 + "\x03\x91\x03\x01\x00\x00\x03\x86" + // 0x03910301: 0x00000386 + "\x03\x95\x03\x01\x00\x00\x03\x88" + // 0x03950301: 0x00000388 + "\x03\x97\x03\x01\x00\x00\x03\x89" + // 0x03970301: 0x00000389 + "\x03\x99\x03\x01\x00\x00\x03\x8a" + // 0x03990301: 0x0000038A + "\x03\x9f\x03\x01\x00\x00\x03\x8c" + // 0x039F0301: 0x0000038C + "\x03\xa5\x03\x01\x00\x00\x03\x8e" + // 0x03A50301: 0x0000038E + "\x03\xa9\x03\x01\x00\x00\x03\x8f" + // 0x03A90301: 0x0000038F + "\x03\xca\x03\x01\x00\x00\x03\x90" + // 0x03CA0301: 0x00000390 + "\x03\x99\x03\b\x00\x00\x03\xaa" + // 0x03990308: 0x000003AA + "\x03\xa5\x03\b\x00\x00\x03\xab" + // 0x03A50308: 0x000003AB + "\x03\xb1\x03\x01\x00\x00\x03\xac" + // 0x03B10301: 0x000003AC + "\x03\xb5\x03\x01\x00\x00\x03\xad" + // 0x03B50301: 0x000003AD + "\x03\xb7\x03\x01\x00\x00\x03\xae" + // 0x03B70301: 0x000003AE + "\x03\xb9\x03\x01\x00\x00\x03\xaf" + // 0x03B90301: 0x000003AF + "\x03\xcb\x03\x01\x00\x00\x03\xb0" + // 0x03CB0301: 0x000003B0 + "\x03\xb9\x03\b\x00\x00\x03\xca" + // 0x03B90308: 0x000003CA + "\x03\xc5\x03\b\x00\x00\x03\xcb" + // 0x03C50308: 0x000003CB + "\x03\xbf\x03\x01\x00\x00\x03\xcc" + // 0x03BF0301: 0x000003CC + "\x03\xc5\x03\x01\x00\x00\x03\xcd" + // 0x03C50301: 0x000003CD + "\x03\xc9\x03\x01\x00\x00\x03\xce" + // 0x03C90301: 0x000003CE + "\x03\xd2\x03\x01\x00\x00\x03\xd3" + // 0x03D20301: 0x000003D3 + "\x03\xd2\x03\b\x00\x00\x03\xd4" + // 0x03D20308: 0x000003D4 + "\x04\x15\x03\x00\x00\x00\x04\x00" + // 0x04150300: 0x00000400 + "\x04\x15\x03\b\x00\x00\x04\x01" + // 0x04150308: 0x00000401 + "\x04\x13\x03\x01\x00\x00\x04\x03" + // 0x04130301: 0x00000403 + "\x04\x06\x03\b\x00\x00\x04\a" + // 0x04060308: 0x00000407 + "\x04\x1a\x03\x01\x00\x00\x04\f" + // 0x041A0301: 0x0000040C + "\x04\x18\x03\x00\x00\x00\x04\r" + // 0x04180300: 0x0000040D + "\x04#\x03\x06\x00\x00\x04\x0e" + // 0x04230306: 0x0000040E + "\x04\x18\x03\x06\x00\x00\x04\x19" + // 0x04180306: 0x00000419 + "\x048\x03\x06\x00\x00\x049" + // 0x04380306: 0x00000439 + "\x045\x03\x00\x00\x00\x04P" + // 0x04350300: 0x00000450 + "\x045\x03\b\x00\x00\x04Q" + // 0x04350308: 0x00000451 + "\x043\x03\x01\x00\x00\x04S" + // 0x04330301: 0x00000453 + "\x04V\x03\b\x00\x00\x04W" + // 0x04560308: 0x00000457 + "\x04:\x03\x01\x00\x00\x04\\" + // 0x043A0301: 0x0000045C + "\x048\x03\x00\x00\x00\x04]" + // 0x04380300: 0x0000045D + "\x04C\x03\x06\x00\x00\x04^" + // 0x04430306: 0x0000045E + "\x04t\x03\x0f\x00\x00\x04v" + // 0x0474030F: 0x00000476 + "\x04u\x03\x0f\x00\x00\x04w" + // 0x0475030F: 0x00000477 + "\x04\x16\x03\x06\x00\x00\x04\xc1" + // 0x04160306: 0x000004C1 + "\x046\x03\x06\x00\x00\x04\xc2" + // 0x04360306: 0x000004C2 + "\x04\x10\x03\x06\x00\x00\x04\xd0" + // 0x04100306: 0x000004D0 + "\x040\x03\x06\x00\x00\x04\xd1" + // 0x04300306: 0x000004D1 + "\x04\x10\x03\b\x00\x00\x04\xd2" + // 0x04100308: 0x000004D2 + "\x040\x03\b\x00\x00\x04\xd3" + // 0x04300308: 0x000004D3 + "\x04\x15\x03\x06\x00\x00\x04\xd6" + // 0x04150306: 0x000004D6 + "\x045\x03\x06\x00\x00\x04\xd7" + // 0x04350306: 0x000004D7 + "\x04\xd8\x03\b\x00\x00\x04\xda" + // 0x04D80308: 0x000004DA + "\x04\xd9\x03\b\x00\x00\x04\xdb" + // 0x04D90308: 0x000004DB + "\x04\x16\x03\b\x00\x00\x04\xdc" + // 0x04160308: 0x000004DC + "\x046\x03\b\x00\x00\x04\xdd" + // 0x04360308: 0x000004DD + "\x04\x17\x03\b\x00\x00\x04\xde" + // 0x04170308: 0x000004DE + "\x047\x03\b\x00\x00\x04\xdf" + // 0x04370308: 0x000004DF + "\x04\x18\x03\x04\x00\x00\x04\xe2" + // 0x04180304: 0x000004E2 + "\x048\x03\x04\x00\x00\x04\xe3" + // 0x04380304: 0x000004E3 + "\x04\x18\x03\b\x00\x00\x04\xe4" + // 0x04180308: 0x000004E4 + "\x048\x03\b\x00\x00\x04\xe5" + // 0x04380308: 0x000004E5 + "\x04\x1e\x03\b\x00\x00\x04\xe6" + // 0x041E0308: 0x000004E6 + "\x04>\x03\b\x00\x00\x04\xe7" + // 0x043E0308: 0x000004E7 + "\x04\xe8\x03\b\x00\x00\x04\xea" + // 0x04E80308: 0x000004EA + "\x04\xe9\x03\b\x00\x00\x04\xeb" + // 0x04E90308: 0x000004EB + "\x04-\x03\b\x00\x00\x04\xec" + // 0x042D0308: 0x000004EC + "\x04M\x03\b\x00\x00\x04\xed" + // 0x044D0308: 0x000004ED + "\x04#\x03\x04\x00\x00\x04\xee" + // 0x04230304: 0x000004EE + "\x04C\x03\x04\x00\x00\x04\xef" + // 0x04430304: 0x000004EF + "\x04#\x03\b\x00\x00\x04\xf0" + // 0x04230308: 0x000004F0 + "\x04C\x03\b\x00\x00\x04\xf1" + // 0x04430308: 0x000004F1 + "\x04#\x03\v\x00\x00\x04\xf2" + // 0x0423030B: 0x000004F2 + "\x04C\x03\v\x00\x00\x04\xf3" + // 0x0443030B: 0x000004F3 + "\x04'\x03\b\x00\x00\x04\xf4" + // 0x04270308: 0x000004F4 + "\x04G\x03\b\x00\x00\x04\xf5" + // 0x04470308: 0x000004F5 + "\x04+\x03\b\x00\x00\x04\xf8" + // 0x042B0308: 0x000004F8 + "\x04K\x03\b\x00\x00\x04\xf9" + // 0x044B0308: 0x000004F9 + "\x06'\x06S\x00\x00\x06\"" + // 0x06270653: 0x00000622 + "\x06'\x06T\x00\x00\x06#" + // 0x06270654: 0x00000623 + "\x06H\x06T\x00\x00\x06$" + // 0x06480654: 0x00000624 + "\x06'\x06U\x00\x00\x06%" + // 0x06270655: 0x00000625 + "\x06J\x06T\x00\x00\x06&" + // 0x064A0654: 0x00000626 + "\x06\xd5\x06T\x00\x00\x06\xc0" + // 0x06D50654: 0x000006C0 + "\x06\xc1\x06T\x00\x00\x06\xc2" + // 0x06C10654: 0x000006C2 + "\x06\xd2\x06T\x00\x00\x06\xd3" + // 0x06D20654: 0x000006D3 + "\t(\t<\x00\x00\t)" + // 0x0928093C: 0x00000929 + "\t0\t<\x00\x00\t1" + // 0x0930093C: 0x00000931 + "\t3\t<\x00\x00\t4" + // 0x0933093C: 0x00000934 + "\t\xc7\t\xbe\x00\x00\t\xcb" + // 0x09C709BE: 0x000009CB + "\t\xc7\t\xd7\x00\x00\t\xcc" + // 0x09C709D7: 0x000009CC + "\vG\vV\x00\x00\vH" + // 0x0B470B56: 0x00000B48 + "\vG\v>\x00\x00\vK" + // 0x0B470B3E: 0x00000B4B + "\vG\vW\x00\x00\vL" + // 0x0B470B57: 0x00000B4C + "\v\x92\v\xd7\x00\x00\v\x94" + // 0x0B920BD7: 0x00000B94 + "\v\xc6\v\xbe\x00\x00\v\xca" + // 0x0BC60BBE: 0x00000BCA + "\v\xc7\v\xbe\x00\x00\v\xcb" + // 0x0BC70BBE: 0x00000BCB + "\v\xc6\v\xd7\x00\x00\v\xcc" + // 0x0BC60BD7: 0x00000BCC + "\fF\fV\x00\x00\fH" + // 0x0C460C56: 0x00000C48 + "\f\xbf\f\xd5\x00\x00\f\xc0" + // 0x0CBF0CD5: 0x00000CC0 + "\f\xc6\f\xd5\x00\x00\f\xc7" + // 0x0CC60CD5: 0x00000CC7 + "\f\xc6\f\xd6\x00\x00\f\xc8" + // 0x0CC60CD6: 0x00000CC8 + "\f\xc6\f\xc2\x00\x00\f\xca" + // 0x0CC60CC2: 0x00000CCA + "\f\xca\f\xd5\x00\x00\f\xcb" + // 0x0CCA0CD5: 0x00000CCB + "\rF\r>\x00\x00\rJ" + // 0x0D460D3E: 0x00000D4A + "\rG\r>\x00\x00\rK" + // 0x0D470D3E: 0x00000D4B + "\rF\rW\x00\x00\rL" + // 0x0D460D57: 0x00000D4C + "\r\xd9\r\xca\x00\x00\r\xda" + // 0x0DD90DCA: 0x00000DDA + "\r\xd9\r\xcf\x00\x00\r\xdc" + // 0x0DD90DCF: 0x00000DDC + "\r\xdc\r\xca\x00\x00\r\xdd" + // 0x0DDC0DCA: 0x00000DDD + "\r\xd9\r\xdf\x00\x00\r\xde" + // 0x0DD90DDF: 0x00000DDE + "\x10%\x10.\x00\x00\x10&" + // 0x1025102E: 0x00001026 + "\x1b\x05\x1b5\x00\x00\x1b\x06" + // 0x1B051B35: 0x00001B06 + "\x1b\a\x1b5\x00\x00\x1b\b" + // 0x1B071B35: 0x00001B08 + "\x1b\t\x1b5\x00\x00\x1b\n" + // 0x1B091B35: 0x00001B0A + "\x1b\v\x1b5\x00\x00\x1b\f" + // 0x1B0B1B35: 0x00001B0C + "\x1b\r\x1b5\x00\x00\x1b\x0e" + // 0x1B0D1B35: 0x00001B0E + "\x1b\x11\x1b5\x00\x00\x1b\x12" + // 0x1B111B35: 0x00001B12 + "\x1b:\x1b5\x00\x00\x1b;" + // 0x1B3A1B35: 0x00001B3B + "\x1b<\x1b5\x00\x00\x1b=" + // 0x1B3C1B35: 0x00001B3D + "\x1b>\x1b5\x00\x00\x1b@" + // 0x1B3E1B35: 0x00001B40 + "\x1b?\x1b5\x00\x00\x1bA" + // 0x1B3F1B35: 0x00001B41 + "\x1bB\x1b5\x00\x00\x1bC" + // 0x1B421B35: 0x00001B43 + "\x00A\x03%\x00\x00\x1e\x00" + // 0x00410325: 0x00001E00 + "\x00a\x03%\x00\x00\x1e\x01" + // 0x00610325: 0x00001E01 + "\x00B\x03\a\x00\x00\x1e\x02" + // 0x00420307: 0x00001E02 + "\x00b\x03\a\x00\x00\x1e\x03" + // 0x00620307: 0x00001E03 + "\x00B\x03#\x00\x00\x1e\x04" + // 0x00420323: 0x00001E04 + "\x00b\x03#\x00\x00\x1e\x05" + // 0x00620323: 0x00001E05 + "\x00B\x031\x00\x00\x1e\x06" + // 0x00420331: 0x00001E06 + "\x00b\x031\x00\x00\x1e\a" + // 0x00620331: 0x00001E07 + "\x00\xc7\x03\x01\x00\x00\x1e\b" + // 0x00C70301: 0x00001E08 + "\x00\xe7\x03\x01\x00\x00\x1e\t" + // 0x00E70301: 0x00001E09 + "\x00D\x03\a\x00\x00\x1e\n" + // 0x00440307: 0x00001E0A + "\x00d\x03\a\x00\x00\x1e\v" + // 0x00640307: 0x00001E0B + "\x00D\x03#\x00\x00\x1e\f" + // 0x00440323: 0x00001E0C + "\x00d\x03#\x00\x00\x1e\r" + // 0x00640323: 0x00001E0D + "\x00D\x031\x00\x00\x1e\x0e" + // 0x00440331: 0x00001E0E + "\x00d\x031\x00\x00\x1e\x0f" + // 0x00640331: 0x00001E0F + "\x00D\x03'\x00\x00\x1e\x10" + // 0x00440327: 0x00001E10 + "\x00d\x03'\x00\x00\x1e\x11" + // 0x00640327: 0x00001E11 + "\x00D\x03-\x00\x00\x1e\x12" + // 0x0044032D: 0x00001E12 + "\x00d\x03-\x00\x00\x1e\x13" + // 0x0064032D: 0x00001E13 + "\x01\x12\x03\x00\x00\x00\x1e\x14" + // 0x01120300: 0x00001E14 + "\x01\x13\x03\x00\x00\x00\x1e\x15" + // 0x01130300: 0x00001E15 + "\x01\x12\x03\x01\x00\x00\x1e\x16" + // 0x01120301: 0x00001E16 + "\x01\x13\x03\x01\x00\x00\x1e\x17" + // 0x01130301: 0x00001E17 + "\x00E\x03-\x00\x00\x1e\x18" + // 0x0045032D: 0x00001E18 + "\x00e\x03-\x00\x00\x1e\x19" + // 0x0065032D: 0x00001E19 + "\x00E\x030\x00\x00\x1e\x1a" + // 0x00450330: 0x00001E1A + "\x00e\x030\x00\x00\x1e\x1b" + // 0x00650330: 0x00001E1B + "\x02(\x03\x06\x00\x00\x1e\x1c" + // 0x02280306: 0x00001E1C + "\x02)\x03\x06\x00\x00\x1e\x1d" + // 0x02290306: 0x00001E1D + "\x00F\x03\a\x00\x00\x1e\x1e" + // 0x00460307: 0x00001E1E + "\x00f\x03\a\x00\x00\x1e\x1f" + // 0x00660307: 0x00001E1F + "\x00G\x03\x04\x00\x00\x1e " + // 0x00470304: 0x00001E20 + "\x00g\x03\x04\x00\x00\x1e!" + // 0x00670304: 0x00001E21 + "\x00H\x03\a\x00\x00\x1e\"" + // 0x00480307: 0x00001E22 + "\x00h\x03\a\x00\x00\x1e#" + // 0x00680307: 0x00001E23 + "\x00H\x03#\x00\x00\x1e$" + // 0x00480323: 0x00001E24 + "\x00h\x03#\x00\x00\x1e%" + // 0x00680323: 0x00001E25 + "\x00H\x03\b\x00\x00\x1e&" + // 0x00480308: 0x00001E26 + "\x00h\x03\b\x00\x00\x1e'" + // 0x00680308: 0x00001E27 + "\x00H\x03'\x00\x00\x1e(" + // 0x00480327: 0x00001E28 + "\x00h\x03'\x00\x00\x1e)" + // 0x00680327: 0x00001E29 + "\x00H\x03.\x00\x00\x1e*" + // 0x0048032E: 0x00001E2A + "\x00h\x03.\x00\x00\x1e+" + // 0x0068032E: 0x00001E2B + "\x00I\x030\x00\x00\x1e," + // 0x00490330: 0x00001E2C + "\x00i\x030\x00\x00\x1e-" + // 0x00690330: 0x00001E2D + "\x00\xcf\x03\x01\x00\x00\x1e." + // 0x00CF0301: 0x00001E2E + "\x00\xef\x03\x01\x00\x00\x1e/" + // 0x00EF0301: 0x00001E2F + "\x00K\x03\x01\x00\x00\x1e0" + // 0x004B0301: 0x00001E30 + "\x00k\x03\x01\x00\x00\x1e1" + // 0x006B0301: 0x00001E31 + "\x00K\x03#\x00\x00\x1e2" + // 0x004B0323: 0x00001E32 + "\x00k\x03#\x00\x00\x1e3" + // 0x006B0323: 0x00001E33 + "\x00K\x031\x00\x00\x1e4" + // 0x004B0331: 0x00001E34 + "\x00k\x031\x00\x00\x1e5" + // 0x006B0331: 0x00001E35 + "\x00L\x03#\x00\x00\x1e6" + // 0x004C0323: 0x00001E36 + "\x00l\x03#\x00\x00\x1e7" + // 0x006C0323: 0x00001E37 + "\x1e6\x03\x04\x00\x00\x1e8" + // 0x1E360304: 0x00001E38 + "\x1e7\x03\x04\x00\x00\x1e9" + // 0x1E370304: 0x00001E39 + "\x00L\x031\x00\x00\x1e:" + // 0x004C0331: 0x00001E3A + "\x00l\x031\x00\x00\x1e;" + // 0x006C0331: 0x00001E3B + "\x00L\x03-\x00\x00\x1e<" + // 0x004C032D: 0x00001E3C + "\x00l\x03-\x00\x00\x1e=" + // 0x006C032D: 0x00001E3D + "\x00M\x03\x01\x00\x00\x1e>" + // 0x004D0301: 0x00001E3E + "\x00m\x03\x01\x00\x00\x1e?" + // 0x006D0301: 0x00001E3F + "\x00M\x03\a\x00\x00\x1e@" + // 0x004D0307: 0x00001E40 + "\x00m\x03\a\x00\x00\x1eA" + // 0x006D0307: 0x00001E41 + "\x00M\x03#\x00\x00\x1eB" + // 0x004D0323: 0x00001E42 + "\x00m\x03#\x00\x00\x1eC" + // 0x006D0323: 0x00001E43 + "\x00N\x03\a\x00\x00\x1eD" + // 0x004E0307: 0x00001E44 + "\x00n\x03\a\x00\x00\x1eE" + // 0x006E0307: 0x00001E45 + "\x00N\x03#\x00\x00\x1eF" + // 0x004E0323: 0x00001E46 + "\x00n\x03#\x00\x00\x1eG" + // 0x006E0323: 0x00001E47 + "\x00N\x031\x00\x00\x1eH" + // 0x004E0331: 0x00001E48 + "\x00n\x031\x00\x00\x1eI" + // 0x006E0331: 0x00001E49 + "\x00N\x03-\x00\x00\x1eJ" + // 0x004E032D: 0x00001E4A + "\x00n\x03-\x00\x00\x1eK" + // 0x006E032D: 0x00001E4B + "\x00\xd5\x03\x01\x00\x00\x1eL" + // 0x00D50301: 0x00001E4C + "\x00\xf5\x03\x01\x00\x00\x1eM" + // 0x00F50301: 0x00001E4D + "\x00\xd5\x03\b\x00\x00\x1eN" + // 0x00D50308: 0x00001E4E + "\x00\xf5\x03\b\x00\x00\x1eO" + // 0x00F50308: 0x00001E4F + "\x01L\x03\x00\x00\x00\x1eP" + // 0x014C0300: 0x00001E50 + "\x01M\x03\x00\x00\x00\x1eQ" + // 0x014D0300: 0x00001E51 + "\x01L\x03\x01\x00\x00\x1eR" + // 0x014C0301: 0x00001E52 + "\x01M\x03\x01\x00\x00\x1eS" + // 0x014D0301: 0x00001E53 + "\x00P\x03\x01\x00\x00\x1eT" + // 0x00500301: 0x00001E54 + "\x00p\x03\x01\x00\x00\x1eU" + // 0x00700301: 0x00001E55 + "\x00P\x03\a\x00\x00\x1eV" + // 0x00500307: 0x00001E56 + "\x00p\x03\a\x00\x00\x1eW" + // 0x00700307: 0x00001E57 + "\x00R\x03\a\x00\x00\x1eX" + // 0x00520307: 0x00001E58 + "\x00r\x03\a\x00\x00\x1eY" + // 0x00720307: 0x00001E59 + "\x00R\x03#\x00\x00\x1eZ" + // 0x00520323: 0x00001E5A + "\x00r\x03#\x00\x00\x1e[" + // 0x00720323: 0x00001E5B + "\x1eZ\x03\x04\x00\x00\x1e\\" + // 0x1E5A0304: 0x00001E5C + "\x1e[\x03\x04\x00\x00\x1e]" + // 0x1E5B0304: 0x00001E5D + "\x00R\x031\x00\x00\x1e^" + // 0x00520331: 0x00001E5E + "\x00r\x031\x00\x00\x1e_" + // 0x00720331: 0x00001E5F + "\x00S\x03\a\x00\x00\x1e`" + // 0x00530307: 0x00001E60 + "\x00s\x03\a\x00\x00\x1ea" + // 0x00730307: 0x00001E61 + "\x00S\x03#\x00\x00\x1eb" + // 0x00530323: 0x00001E62 + "\x00s\x03#\x00\x00\x1ec" + // 0x00730323: 0x00001E63 + "\x01Z\x03\a\x00\x00\x1ed" + // 0x015A0307: 0x00001E64 + "\x01[\x03\a\x00\x00\x1ee" + // 0x015B0307: 0x00001E65 + "\x01`\x03\a\x00\x00\x1ef" + // 0x01600307: 0x00001E66 + "\x01a\x03\a\x00\x00\x1eg" + // 0x01610307: 0x00001E67 + "\x1eb\x03\a\x00\x00\x1eh" + // 0x1E620307: 0x00001E68 + "\x1ec\x03\a\x00\x00\x1ei" + // 0x1E630307: 0x00001E69 + "\x00T\x03\a\x00\x00\x1ej" + // 0x00540307: 0x00001E6A + "\x00t\x03\a\x00\x00\x1ek" + // 0x00740307: 0x00001E6B + "\x00T\x03#\x00\x00\x1el" + // 0x00540323: 0x00001E6C + "\x00t\x03#\x00\x00\x1em" + // 0x00740323: 0x00001E6D + "\x00T\x031\x00\x00\x1en" + // 0x00540331: 0x00001E6E + "\x00t\x031\x00\x00\x1eo" + // 0x00740331: 0x00001E6F + "\x00T\x03-\x00\x00\x1ep" + // 0x0054032D: 0x00001E70 + "\x00t\x03-\x00\x00\x1eq" + // 0x0074032D: 0x00001E71 + "\x00U\x03$\x00\x00\x1er" + // 0x00550324: 0x00001E72 + "\x00u\x03$\x00\x00\x1es" + // 0x00750324: 0x00001E73 + "\x00U\x030\x00\x00\x1et" + // 0x00550330: 0x00001E74 + "\x00u\x030\x00\x00\x1eu" + // 0x00750330: 0x00001E75 + "\x00U\x03-\x00\x00\x1ev" + // 0x0055032D: 0x00001E76 + "\x00u\x03-\x00\x00\x1ew" + // 0x0075032D: 0x00001E77 + "\x01h\x03\x01\x00\x00\x1ex" + // 0x01680301: 0x00001E78 + "\x01i\x03\x01\x00\x00\x1ey" + // 0x01690301: 0x00001E79 + "\x01j\x03\b\x00\x00\x1ez" + // 0x016A0308: 0x00001E7A + "\x01k\x03\b\x00\x00\x1e{" + // 0x016B0308: 0x00001E7B + "\x00V\x03\x03\x00\x00\x1e|" + // 0x00560303: 0x00001E7C + "\x00v\x03\x03\x00\x00\x1e}" + // 0x00760303: 0x00001E7D + "\x00V\x03#\x00\x00\x1e~" + // 0x00560323: 0x00001E7E + "\x00v\x03#\x00\x00\x1e\x7f" + // 0x00760323: 0x00001E7F + "\x00W\x03\x00\x00\x00\x1e\x80" + // 0x00570300: 0x00001E80 + "\x00w\x03\x00\x00\x00\x1e\x81" + // 0x00770300: 0x00001E81 + "\x00W\x03\x01\x00\x00\x1e\x82" + // 0x00570301: 0x00001E82 + "\x00w\x03\x01\x00\x00\x1e\x83" + // 0x00770301: 0x00001E83 + "\x00W\x03\b\x00\x00\x1e\x84" + // 0x00570308: 0x00001E84 + "\x00w\x03\b\x00\x00\x1e\x85" + // 0x00770308: 0x00001E85 + "\x00W\x03\a\x00\x00\x1e\x86" + // 0x00570307: 0x00001E86 + "\x00w\x03\a\x00\x00\x1e\x87" + // 0x00770307: 0x00001E87 + "\x00W\x03#\x00\x00\x1e\x88" + // 0x00570323: 0x00001E88 + "\x00w\x03#\x00\x00\x1e\x89" + // 0x00770323: 0x00001E89 + "\x00X\x03\a\x00\x00\x1e\x8a" + // 0x00580307: 0x00001E8A + "\x00x\x03\a\x00\x00\x1e\x8b" + // 0x00780307: 0x00001E8B + "\x00X\x03\b\x00\x00\x1e\x8c" + // 0x00580308: 0x00001E8C + "\x00x\x03\b\x00\x00\x1e\x8d" + // 0x00780308: 0x00001E8D + "\x00Y\x03\a\x00\x00\x1e\x8e" + // 0x00590307: 0x00001E8E + "\x00y\x03\a\x00\x00\x1e\x8f" + // 0x00790307: 0x00001E8F + "\x00Z\x03\x02\x00\x00\x1e\x90" + // 0x005A0302: 0x00001E90 + "\x00z\x03\x02\x00\x00\x1e\x91" + // 0x007A0302: 0x00001E91 + "\x00Z\x03#\x00\x00\x1e\x92" + // 0x005A0323: 0x00001E92 + "\x00z\x03#\x00\x00\x1e\x93" + // 0x007A0323: 0x00001E93 + "\x00Z\x031\x00\x00\x1e\x94" + // 0x005A0331: 0x00001E94 + "\x00z\x031\x00\x00\x1e\x95" + // 0x007A0331: 0x00001E95 + "\x00h\x031\x00\x00\x1e\x96" + // 0x00680331: 0x00001E96 + "\x00t\x03\b\x00\x00\x1e\x97" + // 0x00740308: 0x00001E97 + "\x00w\x03\n\x00\x00\x1e\x98" + // 0x0077030A: 0x00001E98 + "\x00y\x03\n\x00\x00\x1e\x99" + // 0x0079030A: 0x00001E99 + "\x01\x7f\x03\a\x00\x00\x1e\x9b" + // 0x017F0307: 0x00001E9B + "\x00A\x03#\x00\x00\x1e\xa0" + // 0x00410323: 0x00001EA0 + "\x00a\x03#\x00\x00\x1e\xa1" + // 0x00610323: 0x00001EA1 + "\x00A\x03\t\x00\x00\x1e\xa2" + // 0x00410309: 0x00001EA2 + "\x00a\x03\t\x00\x00\x1e\xa3" + // 0x00610309: 0x00001EA3 + "\x00\xc2\x03\x01\x00\x00\x1e\xa4" + // 0x00C20301: 0x00001EA4 + "\x00\xe2\x03\x01\x00\x00\x1e\xa5" + // 0x00E20301: 0x00001EA5 + "\x00\xc2\x03\x00\x00\x00\x1e\xa6" + // 0x00C20300: 0x00001EA6 + "\x00\xe2\x03\x00\x00\x00\x1e\xa7" + // 0x00E20300: 0x00001EA7 + "\x00\xc2\x03\t\x00\x00\x1e\xa8" + // 0x00C20309: 0x00001EA8 + "\x00\xe2\x03\t\x00\x00\x1e\xa9" + // 0x00E20309: 0x00001EA9 + "\x00\xc2\x03\x03\x00\x00\x1e\xaa" + // 0x00C20303: 0x00001EAA + "\x00\xe2\x03\x03\x00\x00\x1e\xab" + // 0x00E20303: 0x00001EAB + "\x1e\xa0\x03\x02\x00\x00\x1e\xac" + // 0x1EA00302: 0x00001EAC + "\x1e\xa1\x03\x02\x00\x00\x1e\xad" + // 0x1EA10302: 0x00001EAD + "\x01\x02\x03\x01\x00\x00\x1e\xae" + // 0x01020301: 0x00001EAE + "\x01\x03\x03\x01\x00\x00\x1e\xaf" + // 0x01030301: 0x00001EAF + "\x01\x02\x03\x00\x00\x00\x1e\xb0" + // 0x01020300: 0x00001EB0 + "\x01\x03\x03\x00\x00\x00\x1e\xb1" + // 0x01030300: 0x00001EB1 + "\x01\x02\x03\t\x00\x00\x1e\xb2" + // 0x01020309: 0x00001EB2 + "\x01\x03\x03\t\x00\x00\x1e\xb3" + // 0x01030309: 0x00001EB3 + "\x01\x02\x03\x03\x00\x00\x1e\xb4" + // 0x01020303: 0x00001EB4 + "\x01\x03\x03\x03\x00\x00\x1e\xb5" + // 0x01030303: 0x00001EB5 + "\x1e\xa0\x03\x06\x00\x00\x1e\xb6" + // 0x1EA00306: 0x00001EB6 + "\x1e\xa1\x03\x06\x00\x00\x1e\xb7" + // 0x1EA10306: 0x00001EB7 + "\x00E\x03#\x00\x00\x1e\xb8" + // 0x00450323: 0x00001EB8 + "\x00e\x03#\x00\x00\x1e\xb9" + // 0x00650323: 0x00001EB9 + "\x00E\x03\t\x00\x00\x1e\xba" + // 0x00450309: 0x00001EBA + "\x00e\x03\t\x00\x00\x1e\xbb" + // 0x00650309: 0x00001EBB + "\x00E\x03\x03\x00\x00\x1e\xbc" + // 0x00450303: 0x00001EBC + "\x00e\x03\x03\x00\x00\x1e\xbd" + // 0x00650303: 0x00001EBD + "\x00\xca\x03\x01\x00\x00\x1e\xbe" + // 0x00CA0301: 0x00001EBE + "\x00\xea\x03\x01\x00\x00\x1e\xbf" + // 0x00EA0301: 0x00001EBF + "\x00\xca\x03\x00\x00\x00\x1e\xc0" + // 0x00CA0300: 0x00001EC0 + "\x00\xea\x03\x00\x00\x00\x1e\xc1" + // 0x00EA0300: 0x00001EC1 + "\x00\xca\x03\t\x00\x00\x1e\xc2" + // 0x00CA0309: 0x00001EC2 + "\x00\xea\x03\t\x00\x00\x1e\xc3" + // 0x00EA0309: 0x00001EC3 + "\x00\xca\x03\x03\x00\x00\x1e\xc4" + // 0x00CA0303: 0x00001EC4 + "\x00\xea\x03\x03\x00\x00\x1e\xc5" + // 0x00EA0303: 0x00001EC5 + "\x1e\xb8\x03\x02\x00\x00\x1e\xc6" + // 0x1EB80302: 0x00001EC6 + "\x1e\xb9\x03\x02\x00\x00\x1e\xc7" + // 0x1EB90302: 0x00001EC7 + "\x00I\x03\t\x00\x00\x1e\xc8" + // 0x00490309: 0x00001EC8 + "\x00i\x03\t\x00\x00\x1e\xc9" + // 0x00690309: 0x00001EC9 + "\x00I\x03#\x00\x00\x1e\xca" + // 0x00490323: 0x00001ECA + "\x00i\x03#\x00\x00\x1e\xcb" + // 0x00690323: 0x00001ECB + "\x00O\x03#\x00\x00\x1e\xcc" + // 0x004F0323: 0x00001ECC + "\x00o\x03#\x00\x00\x1e\xcd" + // 0x006F0323: 0x00001ECD + "\x00O\x03\t\x00\x00\x1e\xce" + // 0x004F0309: 0x00001ECE + "\x00o\x03\t\x00\x00\x1e\xcf" + // 0x006F0309: 0x00001ECF + "\x00\xd4\x03\x01\x00\x00\x1e\xd0" + // 0x00D40301: 0x00001ED0 + "\x00\xf4\x03\x01\x00\x00\x1e\xd1" + // 0x00F40301: 0x00001ED1 + "\x00\xd4\x03\x00\x00\x00\x1e\xd2" + // 0x00D40300: 0x00001ED2 + "\x00\xf4\x03\x00\x00\x00\x1e\xd3" + // 0x00F40300: 0x00001ED3 + "\x00\xd4\x03\t\x00\x00\x1e\xd4" + // 0x00D40309: 0x00001ED4 + "\x00\xf4\x03\t\x00\x00\x1e\xd5" + // 0x00F40309: 0x00001ED5 + "\x00\xd4\x03\x03\x00\x00\x1e\xd6" + // 0x00D40303: 0x00001ED6 + "\x00\xf4\x03\x03\x00\x00\x1e\xd7" + // 0x00F40303: 0x00001ED7 + "\x1e\xcc\x03\x02\x00\x00\x1e\xd8" + // 0x1ECC0302: 0x00001ED8 + "\x1e\xcd\x03\x02\x00\x00\x1e\xd9" + // 0x1ECD0302: 0x00001ED9 + "\x01\xa0\x03\x01\x00\x00\x1e\xda" + // 0x01A00301: 0x00001EDA + "\x01\xa1\x03\x01\x00\x00\x1e\xdb" + // 0x01A10301: 0x00001EDB + "\x01\xa0\x03\x00\x00\x00\x1e\xdc" + // 0x01A00300: 0x00001EDC + "\x01\xa1\x03\x00\x00\x00\x1e\xdd" + // 0x01A10300: 0x00001EDD + "\x01\xa0\x03\t\x00\x00\x1e\xde" + // 0x01A00309: 0x00001EDE + "\x01\xa1\x03\t\x00\x00\x1e\xdf" + // 0x01A10309: 0x00001EDF + "\x01\xa0\x03\x03\x00\x00\x1e\xe0" + // 0x01A00303: 0x00001EE0 + "\x01\xa1\x03\x03\x00\x00\x1e\xe1" + // 0x01A10303: 0x00001EE1 + "\x01\xa0\x03#\x00\x00\x1e\xe2" + // 0x01A00323: 0x00001EE2 + "\x01\xa1\x03#\x00\x00\x1e\xe3" + // 0x01A10323: 0x00001EE3 + "\x00U\x03#\x00\x00\x1e\xe4" + // 0x00550323: 0x00001EE4 + "\x00u\x03#\x00\x00\x1e\xe5" + // 0x00750323: 0x00001EE5 + "\x00U\x03\t\x00\x00\x1e\xe6" + // 0x00550309: 0x00001EE6 + "\x00u\x03\t\x00\x00\x1e\xe7" + // 0x00750309: 0x00001EE7 + "\x01\xaf\x03\x01\x00\x00\x1e\xe8" + // 0x01AF0301: 0x00001EE8 + "\x01\xb0\x03\x01\x00\x00\x1e\xe9" + // 0x01B00301: 0x00001EE9 + "\x01\xaf\x03\x00\x00\x00\x1e\xea" + // 0x01AF0300: 0x00001EEA + "\x01\xb0\x03\x00\x00\x00\x1e\xeb" + // 0x01B00300: 0x00001EEB + "\x01\xaf\x03\t\x00\x00\x1e\xec" + // 0x01AF0309: 0x00001EEC + "\x01\xb0\x03\t\x00\x00\x1e\xed" + // 0x01B00309: 0x00001EED + "\x01\xaf\x03\x03\x00\x00\x1e\xee" + // 0x01AF0303: 0x00001EEE + "\x01\xb0\x03\x03\x00\x00\x1e\xef" + // 0x01B00303: 0x00001EEF + "\x01\xaf\x03#\x00\x00\x1e\xf0" + // 0x01AF0323: 0x00001EF0 + "\x01\xb0\x03#\x00\x00\x1e\xf1" + // 0x01B00323: 0x00001EF1 + "\x00Y\x03\x00\x00\x00\x1e\xf2" + // 0x00590300: 0x00001EF2 + "\x00y\x03\x00\x00\x00\x1e\xf3" + // 0x00790300: 0x00001EF3 + "\x00Y\x03#\x00\x00\x1e\xf4" + // 0x00590323: 0x00001EF4 + "\x00y\x03#\x00\x00\x1e\xf5" + // 0x00790323: 0x00001EF5 + "\x00Y\x03\t\x00\x00\x1e\xf6" + // 0x00590309: 0x00001EF6 + "\x00y\x03\t\x00\x00\x1e\xf7" + // 0x00790309: 0x00001EF7 + "\x00Y\x03\x03\x00\x00\x1e\xf8" + // 0x00590303: 0x00001EF8 + "\x00y\x03\x03\x00\x00\x1e\xf9" + // 0x00790303: 0x00001EF9 + "\x03\xb1\x03\x13\x00\x00\x1f\x00" + // 0x03B10313: 0x00001F00 + "\x03\xb1\x03\x14\x00\x00\x1f\x01" + // 0x03B10314: 0x00001F01 + "\x1f\x00\x03\x00\x00\x00\x1f\x02" + // 0x1F000300: 0x00001F02 + "\x1f\x01\x03\x00\x00\x00\x1f\x03" + // 0x1F010300: 0x00001F03 + "\x1f\x00\x03\x01\x00\x00\x1f\x04" + // 0x1F000301: 0x00001F04 + "\x1f\x01\x03\x01\x00\x00\x1f\x05" + // 0x1F010301: 0x00001F05 + "\x1f\x00\x03B\x00\x00\x1f\x06" + // 0x1F000342: 0x00001F06 + "\x1f\x01\x03B\x00\x00\x1f\a" + // 0x1F010342: 0x00001F07 + "\x03\x91\x03\x13\x00\x00\x1f\b" + // 0x03910313: 0x00001F08 + "\x03\x91\x03\x14\x00\x00\x1f\t" + // 0x03910314: 0x00001F09 + "\x1f\b\x03\x00\x00\x00\x1f\n" + // 0x1F080300: 0x00001F0A + "\x1f\t\x03\x00\x00\x00\x1f\v" + // 0x1F090300: 0x00001F0B + "\x1f\b\x03\x01\x00\x00\x1f\f" + // 0x1F080301: 0x00001F0C + "\x1f\t\x03\x01\x00\x00\x1f\r" + // 0x1F090301: 0x00001F0D + "\x1f\b\x03B\x00\x00\x1f\x0e" + // 0x1F080342: 0x00001F0E + "\x1f\t\x03B\x00\x00\x1f\x0f" + // 0x1F090342: 0x00001F0F + "\x03\xb5\x03\x13\x00\x00\x1f\x10" + // 0x03B50313: 0x00001F10 + "\x03\xb5\x03\x14\x00\x00\x1f\x11" + // 0x03B50314: 0x00001F11 + "\x1f\x10\x03\x00\x00\x00\x1f\x12" + // 0x1F100300: 0x00001F12 + "\x1f\x11\x03\x00\x00\x00\x1f\x13" + // 0x1F110300: 0x00001F13 + "\x1f\x10\x03\x01\x00\x00\x1f\x14" + // 0x1F100301: 0x00001F14 + "\x1f\x11\x03\x01\x00\x00\x1f\x15" + // 0x1F110301: 0x00001F15 + "\x03\x95\x03\x13\x00\x00\x1f\x18" + // 0x03950313: 0x00001F18 + "\x03\x95\x03\x14\x00\x00\x1f\x19" + // 0x03950314: 0x00001F19 + "\x1f\x18\x03\x00\x00\x00\x1f\x1a" + // 0x1F180300: 0x00001F1A + "\x1f\x19\x03\x00\x00\x00\x1f\x1b" + // 0x1F190300: 0x00001F1B + "\x1f\x18\x03\x01\x00\x00\x1f\x1c" + // 0x1F180301: 0x00001F1C + "\x1f\x19\x03\x01\x00\x00\x1f\x1d" + // 0x1F190301: 0x00001F1D + "\x03\xb7\x03\x13\x00\x00\x1f " + // 0x03B70313: 0x00001F20 + "\x03\xb7\x03\x14\x00\x00\x1f!" + // 0x03B70314: 0x00001F21 + "\x1f \x03\x00\x00\x00\x1f\"" + // 0x1F200300: 0x00001F22 + "\x1f!\x03\x00\x00\x00\x1f#" + // 0x1F210300: 0x00001F23 + "\x1f \x03\x01\x00\x00\x1f$" + // 0x1F200301: 0x00001F24 + "\x1f!\x03\x01\x00\x00\x1f%" + // 0x1F210301: 0x00001F25 + "\x1f \x03B\x00\x00\x1f&" + // 0x1F200342: 0x00001F26 + "\x1f!\x03B\x00\x00\x1f'" + // 0x1F210342: 0x00001F27 + "\x03\x97\x03\x13\x00\x00\x1f(" + // 0x03970313: 0x00001F28 + "\x03\x97\x03\x14\x00\x00\x1f)" + // 0x03970314: 0x00001F29 + "\x1f(\x03\x00\x00\x00\x1f*" + // 0x1F280300: 0x00001F2A + "\x1f)\x03\x00\x00\x00\x1f+" + // 0x1F290300: 0x00001F2B + "\x1f(\x03\x01\x00\x00\x1f," + // 0x1F280301: 0x00001F2C + "\x1f)\x03\x01\x00\x00\x1f-" + // 0x1F290301: 0x00001F2D + "\x1f(\x03B\x00\x00\x1f." + // 0x1F280342: 0x00001F2E + "\x1f)\x03B\x00\x00\x1f/" + // 0x1F290342: 0x00001F2F + "\x03\xb9\x03\x13\x00\x00\x1f0" + // 0x03B90313: 0x00001F30 + "\x03\xb9\x03\x14\x00\x00\x1f1" + // 0x03B90314: 0x00001F31 + "\x1f0\x03\x00\x00\x00\x1f2" + // 0x1F300300: 0x00001F32 + "\x1f1\x03\x00\x00\x00\x1f3" + // 0x1F310300: 0x00001F33 + "\x1f0\x03\x01\x00\x00\x1f4" + // 0x1F300301: 0x00001F34 + "\x1f1\x03\x01\x00\x00\x1f5" + // 0x1F310301: 0x00001F35 + "\x1f0\x03B\x00\x00\x1f6" + // 0x1F300342: 0x00001F36 + "\x1f1\x03B\x00\x00\x1f7" + // 0x1F310342: 0x00001F37 + "\x03\x99\x03\x13\x00\x00\x1f8" + // 0x03990313: 0x00001F38 + "\x03\x99\x03\x14\x00\x00\x1f9" + // 0x03990314: 0x00001F39 + "\x1f8\x03\x00\x00\x00\x1f:" + // 0x1F380300: 0x00001F3A + "\x1f9\x03\x00\x00\x00\x1f;" + // 0x1F390300: 0x00001F3B + "\x1f8\x03\x01\x00\x00\x1f<" + // 0x1F380301: 0x00001F3C + "\x1f9\x03\x01\x00\x00\x1f=" + // 0x1F390301: 0x00001F3D + "\x1f8\x03B\x00\x00\x1f>" + // 0x1F380342: 0x00001F3E + "\x1f9\x03B\x00\x00\x1f?" + // 0x1F390342: 0x00001F3F + "\x03\xbf\x03\x13\x00\x00\x1f@" + // 0x03BF0313: 0x00001F40 + "\x03\xbf\x03\x14\x00\x00\x1fA" + // 0x03BF0314: 0x00001F41 + "\x1f@\x03\x00\x00\x00\x1fB" + // 0x1F400300: 0x00001F42 + "\x1fA\x03\x00\x00\x00\x1fC" + // 0x1F410300: 0x00001F43 + "\x1f@\x03\x01\x00\x00\x1fD" + // 0x1F400301: 0x00001F44 + "\x1fA\x03\x01\x00\x00\x1fE" + // 0x1F410301: 0x00001F45 + "\x03\x9f\x03\x13\x00\x00\x1fH" + // 0x039F0313: 0x00001F48 + "\x03\x9f\x03\x14\x00\x00\x1fI" + // 0x039F0314: 0x00001F49 + "\x1fH\x03\x00\x00\x00\x1fJ" + // 0x1F480300: 0x00001F4A + "\x1fI\x03\x00\x00\x00\x1fK" + // 0x1F490300: 0x00001F4B + "\x1fH\x03\x01\x00\x00\x1fL" + // 0x1F480301: 0x00001F4C + "\x1fI\x03\x01\x00\x00\x1fM" + // 0x1F490301: 0x00001F4D + "\x03\xc5\x03\x13\x00\x00\x1fP" + // 0x03C50313: 0x00001F50 + "\x03\xc5\x03\x14\x00\x00\x1fQ" + // 0x03C50314: 0x00001F51 + "\x1fP\x03\x00\x00\x00\x1fR" + // 0x1F500300: 0x00001F52 + "\x1fQ\x03\x00\x00\x00\x1fS" + // 0x1F510300: 0x00001F53 + "\x1fP\x03\x01\x00\x00\x1fT" + // 0x1F500301: 0x00001F54 + "\x1fQ\x03\x01\x00\x00\x1fU" + // 0x1F510301: 0x00001F55 + "\x1fP\x03B\x00\x00\x1fV" + // 0x1F500342: 0x00001F56 + "\x1fQ\x03B\x00\x00\x1fW" + // 0x1F510342: 0x00001F57 + "\x03\xa5\x03\x14\x00\x00\x1fY" + // 0x03A50314: 0x00001F59 + "\x1fY\x03\x00\x00\x00\x1f[" + // 0x1F590300: 0x00001F5B + "\x1fY\x03\x01\x00\x00\x1f]" + // 0x1F590301: 0x00001F5D + "\x1fY\x03B\x00\x00\x1f_" + // 0x1F590342: 0x00001F5F + "\x03\xc9\x03\x13\x00\x00\x1f`" + // 0x03C90313: 0x00001F60 + "\x03\xc9\x03\x14\x00\x00\x1fa" + // 0x03C90314: 0x00001F61 + "\x1f`\x03\x00\x00\x00\x1fb" + // 0x1F600300: 0x00001F62 + "\x1fa\x03\x00\x00\x00\x1fc" + // 0x1F610300: 0x00001F63 + "\x1f`\x03\x01\x00\x00\x1fd" + // 0x1F600301: 0x00001F64 + "\x1fa\x03\x01\x00\x00\x1fe" + // 0x1F610301: 0x00001F65 + "\x1f`\x03B\x00\x00\x1ff" + // 0x1F600342: 0x00001F66 + "\x1fa\x03B\x00\x00\x1fg" + // 0x1F610342: 0x00001F67 + "\x03\xa9\x03\x13\x00\x00\x1fh" + // 0x03A90313: 0x00001F68 + "\x03\xa9\x03\x14\x00\x00\x1fi" + // 0x03A90314: 0x00001F69 + "\x1fh\x03\x00\x00\x00\x1fj" + // 0x1F680300: 0x00001F6A + "\x1fi\x03\x00\x00\x00\x1fk" + // 0x1F690300: 0x00001F6B + "\x1fh\x03\x01\x00\x00\x1fl" + // 0x1F680301: 0x00001F6C + "\x1fi\x03\x01\x00\x00\x1fm" + // 0x1F690301: 0x00001F6D + "\x1fh\x03B\x00\x00\x1fn" + // 0x1F680342: 0x00001F6E + "\x1fi\x03B\x00\x00\x1fo" + // 0x1F690342: 0x00001F6F + "\x03\xb1\x03\x00\x00\x00\x1fp" + // 0x03B10300: 0x00001F70 + "\x03\xb5\x03\x00\x00\x00\x1fr" + // 0x03B50300: 0x00001F72 + "\x03\xb7\x03\x00\x00\x00\x1ft" + // 0x03B70300: 0x00001F74 + "\x03\xb9\x03\x00\x00\x00\x1fv" + // 0x03B90300: 0x00001F76 + "\x03\xbf\x03\x00\x00\x00\x1fx" + // 0x03BF0300: 0x00001F78 + "\x03\xc5\x03\x00\x00\x00\x1fz" + // 0x03C50300: 0x00001F7A + "\x03\xc9\x03\x00\x00\x00\x1f|" + // 0x03C90300: 0x00001F7C + "\x1f\x00\x03E\x00\x00\x1f\x80" + // 0x1F000345: 0x00001F80 + "\x1f\x01\x03E\x00\x00\x1f\x81" + // 0x1F010345: 0x00001F81 + "\x1f\x02\x03E\x00\x00\x1f\x82" + // 0x1F020345: 0x00001F82 + "\x1f\x03\x03E\x00\x00\x1f\x83" + // 0x1F030345: 0x00001F83 + "\x1f\x04\x03E\x00\x00\x1f\x84" + // 0x1F040345: 0x00001F84 + "\x1f\x05\x03E\x00\x00\x1f\x85" + // 0x1F050345: 0x00001F85 + "\x1f\x06\x03E\x00\x00\x1f\x86" + // 0x1F060345: 0x00001F86 + "\x1f\a\x03E\x00\x00\x1f\x87" + // 0x1F070345: 0x00001F87 + "\x1f\b\x03E\x00\x00\x1f\x88" + // 0x1F080345: 0x00001F88 + "\x1f\t\x03E\x00\x00\x1f\x89" + // 0x1F090345: 0x00001F89 + "\x1f\n\x03E\x00\x00\x1f\x8a" + // 0x1F0A0345: 0x00001F8A + "\x1f\v\x03E\x00\x00\x1f\x8b" + // 0x1F0B0345: 0x00001F8B + "\x1f\f\x03E\x00\x00\x1f\x8c" + // 0x1F0C0345: 0x00001F8C + "\x1f\r\x03E\x00\x00\x1f\x8d" + // 0x1F0D0345: 0x00001F8D + "\x1f\x0e\x03E\x00\x00\x1f\x8e" + // 0x1F0E0345: 0x00001F8E + "\x1f\x0f\x03E\x00\x00\x1f\x8f" + // 0x1F0F0345: 0x00001F8F + "\x1f \x03E\x00\x00\x1f\x90" + // 0x1F200345: 0x00001F90 + "\x1f!\x03E\x00\x00\x1f\x91" + // 0x1F210345: 0x00001F91 + "\x1f\"\x03E\x00\x00\x1f\x92" + // 0x1F220345: 0x00001F92 + "\x1f#\x03E\x00\x00\x1f\x93" + // 0x1F230345: 0x00001F93 + "\x1f$\x03E\x00\x00\x1f\x94" + // 0x1F240345: 0x00001F94 + "\x1f%\x03E\x00\x00\x1f\x95" + // 0x1F250345: 0x00001F95 + "\x1f&\x03E\x00\x00\x1f\x96" + // 0x1F260345: 0x00001F96 + "\x1f'\x03E\x00\x00\x1f\x97" + // 0x1F270345: 0x00001F97 + "\x1f(\x03E\x00\x00\x1f\x98" + // 0x1F280345: 0x00001F98 + "\x1f)\x03E\x00\x00\x1f\x99" + // 0x1F290345: 0x00001F99 + "\x1f*\x03E\x00\x00\x1f\x9a" + // 0x1F2A0345: 0x00001F9A + "\x1f+\x03E\x00\x00\x1f\x9b" + // 0x1F2B0345: 0x00001F9B + "\x1f,\x03E\x00\x00\x1f\x9c" + // 0x1F2C0345: 0x00001F9C + "\x1f-\x03E\x00\x00\x1f\x9d" + // 0x1F2D0345: 0x00001F9D + "\x1f.\x03E\x00\x00\x1f\x9e" + // 0x1F2E0345: 0x00001F9E + "\x1f/\x03E\x00\x00\x1f\x9f" + // 0x1F2F0345: 0x00001F9F + "\x1f`\x03E\x00\x00\x1f\xa0" + // 0x1F600345: 0x00001FA0 + "\x1fa\x03E\x00\x00\x1f\xa1" + // 0x1F610345: 0x00001FA1 + "\x1fb\x03E\x00\x00\x1f\xa2" + // 0x1F620345: 0x00001FA2 + "\x1fc\x03E\x00\x00\x1f\xa3" + // 0x1F630345: 0x00001FA3 + "\x1fd\x03E\x00\x00\x1f\xa4" + // 0x1F640345: 0x00001FA4 + "\x1fe\x03E\x00\x00\x1f\xa5" + // 0x1F650345: 0x00001FA5 + "\x1ff\x03E\x00\x00\x1f\xa6" + // 0x1F660345: 0x00001FA6 + "\x1fg\x03E\x00\x00\x1f\xa7" + // 0x1F670345: 0x00001FA7 + "\x1fh\x03E\x00\x00\x1f\xa8" + // 0x1F680345: 0x00001FA8 + "\x1fi\x03E\x00\x00\x1f\xa9" + // 0x1F690345: 0x00001FA9 + "\x1fj\x03E\x00\x00\x1f\xaa" + // 0x1F6A0345: 0x00001FAA + "\x1fk\x03E\x00\x00\x1f\xab" + // 0x1F6B0345: 0x00001FAB + "\x1fl\x03E\x00\x00\x1f\xac" + // 0x1F6C0345: 0x00001FAC + "\x1fm\x03E\x00\x00\x1f\xad" + // 0x1F6D0345: 0x00001FAD + "\x1fn\x03E\x00\x00\x1f\xae" + // 0x1F6E0345: 0x00001FAE + "\x1fo\x03E\x00\x00\x1f\xaf" + // 0x1F6F0345: 0x00001FAF + "\x03\xb1\x03\x06\x00\x00\x1f\xb0" + // 0x03B10306: 0x00001FB0 + "\x03\xb1\x03\x04\x00\x00\x1f\xb1" + // 0x03B10304: 0x00001FB1 + "\x1fp\x03E\x00\x00\x1f\xb2" + // 0x1F700345: 0x00001FB2 + "\x03\xb1\x03E\x00\x00\x1f\xb3" + // 0x03B10345: 0x00001FB3 + "\x03\xac\x03E\x00\x00\x1f\xb4" + // 0x03AC0345: 0x00001FB4 + "\x03\xb1\x03B\x00\x00\x1f\xb6" + // 0x03B10342: 0x00001FB6 + "\x1f\xb6\x03E\x00\x00\x1f\xb7" + // 0x1FB60345: 0x00001FB7 + "\x03\x91\x03\x06\x00\x00\x1f\xb8" + // 0x03910306: 0x00001FB8 + "\x03\x91\x03\x04\x00\x00\x1f\xb9" + // 0x03910304: 0x00001FB9 + "\x03\x91\x03\x00\x00\x00\x1f\xba" + // 0x03910300: 0x00001FBA + "\x03\x91\x03E\x00\x00\x1f\xbc" + // 0x03910345: 0x00001FBC + "\x00\xa8\x03B\x00\x00\x1f\xc1" + // 0x00A80342: 0x00001FC1 + "\x1ft\x03E\x00\x00\x1f\xc2" + // 0x1F740345: 0x00001FC2 + "\x03\xb7\x03E\x00\x00\x1f\xc3" + // 0x03B70345: 0x00001FC3 + "\x03\xae\x03E\x00\x00\x1f\xc4" + // 0x03AE0345: 0x00001FC4 + "\x03\xb7\x03B\x00\x00\x1f\xc6" + // 0x03B70342: 0x00001FC6 + "\x1f\xc6\x03E\x00\x00\x1f\xc7" + // 0x1FC60345: 0x00001FC7 + "\x03\x95\x03\x00\x00\x00\x1f\xc8" + // 0x03950300: 0x00001FC8 + "\x03\x97\x03\x00\x00\x00\x1f\xca" + // 0x03970300: 0x00001FCA + "\x03\x97\x03E\x00\x00\x1f\xcc" + // 0x03970345: 0x00001FCC + "\x1f\xbf\x03\x00\x00\x00\x1f\xcd" + // 0x1FBF0300: 0x00001FCD + "\x1f\xbf\x03\x01\x00\x00\x1f\xce" + // 0x1FBF0301: 0x00001FCE + "\x1f\xbf\x03B\x00\x00\x1f\xcf" + // 0x1FBF0342: 0x00001FCF + "\x03\xb9\x03\x06\x00\x00\x1f\xd0" + // 0x03B90306: 0x00001FD0 + "\x03\xb9\x03\x04\x00\x00\x1f\xd1" + // 0x03B90304: 0x00001FD1 + "\x03\xca\x03\x00\x00\x00\x1f\xd2" + // 0x03CA0300: 0x00001FD2 + "\x03\xb9\x03B\x00\x00\x1f\xd6" + // 0x03B90342: 0x00001FD6 + "\x03\xca\x03B\x00\x00\x1f\xd7" + // 0x03CA0342: 0x00001FD7 + "\x03\x99\x03\x06\x00\x00\x1f\xd8" + // 0x03990306: 0x00001FD8 + "\x03\x99\x03\x04\x00\x00\x1f\xd9" + // 0x03990304: 0x00001FD9 + "\x03\x99\x03\x00\x00\x00\x1f\xda" + // 0x03990300: 0x00001FDA + "\x1f\xfe\x03\x00\x00\x00\x1f\xdd" + // 0x1FFE0300: 0x00001FDD + "\x1f\xfe\x03\x01\x00\x00\x1f\xde" + // 0x1FFE0301: 0x00001FDE + "\x1f\xfe\x03B\x00\x00\x1f\xdf" + // 0x1FFE0342: 0x00001FDF + "\x03\xc5\x03\x06\x00\x00\x1f\xe0" + // 0x03C50306: 0x00001FE0 + "\x03\xc5\x03\x04\x00\x00\x1f\xe1" + // 0x03C50304: 0x00001FE1 + "\x03\xcb\x03\x00\x00\x00\x1f\xe2" + // 0x03CB0300: 0x00001FE2 + "\x03\xc1\x03\x13\x00\x00\x1f\xe4" + // 0x03C10313: 0x00001FE4 + "\x03\xc1\x03\x14\x00\x00\x1f\xe5" + // 0x03C10314: 0x00001FE5 + "\x03\xc5\x03B\x00\x00\x1f\xe6" + // 0x03C50342: 0x00001FE6 + "\x03\xcb\x03B\x00\x00\x1f\xe7" + // 0x03CB0342: 0x00001FE7 + "\x03\xa5\x03\x06\x00\x00\x1f\xe8" + // 0x03A50306: 0x00001FE8 + "\x03\xa5\x03\x04\x00\x00\x1f\xe9" + // 0x03A50304: 0x00001FE9 + "\x03\xa5\x03\x00\x00\x00\x1f\xea" + // 0x03A50300: 0x00001FEA + "\x03\xa1\x03\x14\x00\x00\x1f\xec" + // 0x03A10314: 0x00001FEC + "\x00\xa8\x03\x00\x00\x00\x1f\xed" + // 0x00A80300: 0x00001FED + "\x1f|\x03E\x00\x00\x1f\xf2" + // 0x1F7C0345: 0x00001FF2 + "\x03\xc9\x03E\x00\x00\x1f\xf3" + // 0x03C90345: 0x00001FF3 + "\x03\xce\x03E\x00\x00\x1f\xf4" + // 0x03CE0345: 0x00001FF4 + "\x03\xc9\x03B\x00\x00\x1f\xf6" + // 0x03C90342: 0x00001FF6 + "\x1f\xf6\x03E\x00\x00\x1f\xf7" + // 0x1FF60345: 0x00001FF7 + "\x03\x9f\x03\x00\x00\x00\x1f\xf8" + // 0x039F0300: 0x00001FF8 + "\x03\xa9\x03\x00\x00\x00\x1f\xfa" + // 0x03A90300: 0x00001FFA + "\x03\xa9\x03E\x00\x00\x1f\xfc" + // 0x03A90345: 0x00001FFC + "!\x90\x038\x00\x00!\x9a" + // 0x21900338: 0x0000219A + "!\x92\x038\x00\x00!\x9b" + // 0x21920338: 0x0000219B + "!\x94\x038\x00\x00!\xae" + // 0x21940338: 0x000021AE + "!\xd0\x038\x00\x00!\xcd" + // 0x21D00338: 0x000021CD + "!\xd4\x038\x00\x00!\xce" + // 0x21D40338: 0x000021CE + "!\xd2\x038\x00\x00!\xcf" + // 0x21D20338: 0x000021CF + "\"\x03\x038\x00\x00\"\x04" + // 0x22030338: 0x00002204 + "\"\b\x038\x00\x00\"\t" + // 0x22080338: 0x00002209 + "\"\v\x038\x00\x00\"\f" + // 0x220B0338: 0x0000220C + "\"#\x038\x00\x00\"$" + // 0x22230338: 0x00002224 + "\"%\x038\x00\x00\"&" + // 0x22250338: 0x00002226 + "\"<\x038\x00\x00\"A" + // 0x223C0338: 0x00002241 + "\"C\x038\x00\x00\"D" + // 0x22430338: 0x00002244 + "\"E\x038\x00\x00\"G" + // 0x22450338: 0x00002247 + "\"H\x038\x00\x00\"I" + // 0x22480338: 0x00002249 + "\x00=\x038\x00\x00\"`" + // 0x003D0338: 0x00002260 + "\"a\x038\x00\x00\"b" + // 0x22610338: 0x00002262 + "\"M\x038\x00\x00\"m" + // 0x224D0338: 0x0000226D + "\x00<\x038\x00\x00\"n" + // 0x003C0338: 0x0000226E + "\x00>\x038\x00\x00\"o" + // 0x003E0338: 0x0000226F + "\"d\x038\x00\x00\"p" + // 0x22640338: 0x00002270 + "\"e\x038\x00\x00\"q" + // 0x22650338: 0x00002271 + "\"r\x038\x00\x00\"t" + // 0x22720338: 0x00002274 + "\"s\x038\x00\x00\"u" + // 0x22730338: 0x00002275 + "\"v\x038\x00\x00\"x" + // 0x22760338: 0x00002278 + "\"w\x038\x00\x00\"y" + // 0x22770338: 0x00002279 + "\"z\x038\x00\x00\"\x80" + // 0x227A0338: 0x00002280 + "\"{\x038\x00\x00\"\x81" + // 0x227B0338: 0x00002281 + "\"\x82\x038\x00\x00\"\x84" + // 0x22820338: 0x00002284 + "\"\x83\x038\x00\x00\"\x85" + // 0x22830338: 0x00002285 + "\"\x86\x038\x00\x00\"\x88" + // 0x22860338: 0x00002288 + "\"\x87\x038\x00\x00\"\x89" + // 0x22870338: 0x00002289 + "\"\xa2\x038\x00\x00\"\xac" + // 0x22A20338: 0x000022AC + "\"\xa8\x038\x00\x00\"\xad" + // 0x22A80338: 0x000022AD + "\"\xa9\x038\x00\x00\"\xae" + // 0x22A90338: 0x000022AE + "\"\xab\x038\x00\x00\"\xaf" + // 0x22AB0338: 0x000022AF + "\"|\x038\x00\x00\"\xe0" + // 0x227C0338: 0x000022E0 + "\"}\x038\x00\x00\"\xe1" + // 0x227D0338: 0x000022E1 + "\"\x91\x038\x00\x00\"\xe2" + // 0x22910338: 0x000022E2 + "\"\x92\x038\x00\x00\"\xe3" + // 0x22920338: 0x000022E3 + "\"\xb2\x038\x00\x00\"\xea" + // 0x22B20338: 0x000022EA + "\"\xb3\x038\x00\x00\"\xeb" + // 0x22B30338: 0x000022EB + "\"\xb4\x038\x00\x00\"\xec" + // 0x22B40338: 0x000022EC + "\"\xb5\x038\x00\x00\"\xed" + // 0x22B50338: 0x000022ED + "0K0\x99\x00\x000L" + // 0x304B3099: 0x0000304C + "0M0\x99\x00\x000N" + // 0x304D3099: 0x0000304E + "0O0\x99\x00\x000P" + // 0x304F3099: 0x00003050 + "0Q0\x99\x00\x000R" + // 0x30513099: 0x00003052 + "0S0\x99\x00\x000T" + // 0x30533099: 0x00003054 + "0U0\x99\x00\x000V" + // 0x30553099: 0x00003056 + "0W0\x99\x00\x000X" + // 0x30573099: 0x00003058 + "0Y0\x99\x00\x000Z" + // 0x30593099: 0x0000305A + "0[0\x99\x00\x000\\" + // 0x305B3099: 0x0000305C + "0]0\x99\x00\x000^" + // 0x305D3099: 0x0000305E + "0_0\x99\x00\x000`" + // 0x305F3099: 0x00003060 + "0a0\x99\x00\x000b" + // 0x30613099: 0x00003062 + "0d0\x99\x00\x000e" + // 0x30643099: 0x00003065 + "0f0\x99\x00\x000g" + // 0x30663099: 0x00003067 + "0h0\x99\x00\x000i" + // 0x30683099: 0x00003069 + "0o0\x99\x00\x000p" + // 0x306F3099: 0x00003070 + "0o0\x9a\x00\x000q" + // 0x306F309A: 0x00003071 + "0r0\x99\x00\x000s" + // 0x30723099: 0x00003073 + "0r0\x9a\x00\x000t" + // 0x3072309A: 0x00003074 + "0u0\x99\x00\x000v" + // 0x30753099: 0x00003076 + "0u0\x9a\x00\x000w" + // 0x3075309A: 0x00003077 + "0x0\x99\x00\x000y" + // 0x30783099: 0x00003079 + "0x0\x9a\x00\x000z" + // 0x3078309A: 0x0000307A + "0{0\x99\x00\x000|" + // 0x307B3099: 0x0000307C + "0{0\x9a\x00\x000}" + // 0x307B309A: 0x0000307D + "0F0\x99\x00\x000\x94" + // 0x30463099: 0x00003094 + "0\x9d0\x99\x00\x000\x9e" + // 0x309D3099: 0x0000309E + "0\xab0\x99\x00\x000\xac" + // 0x30AB3099: 0x000030AC + "0\xad0\x99\x00\x000\xae" + // 0x30AD3099: 0x000030AE + "0\xaf0\x99\x00\x000\xb0" + // 0x30AF3099: 0x000030B0 + "0\xb10\x99\x00\x000\xb2" + // 0x30B13099: 0x000030B2 + "0\xb30\x99\x00\x000\xb4" + // 0x30B33099: 0x000030B4 + "0\xb50\x99\x00\x000\xb6" + // 0x30B53099: 0x000030B6 + "0\xb70\x99\x00\x000\xb8" + // 0x30B73099: 0x000030B8 + "0\xb90\x99\x00\x000\xba" + // 0x30B93099: 0x000030BA + "0\xbb0\x99\x00\x000\xbc" + // 0x30BB3099: 0x000030BC + "0\xbd0\x99\x00\x000\xbe" + // 0x30BD3099: 0x000030BE + "0\xbf0\x99\x00\x000\xc0" + // 0x30BF3099: 0x000030C0 + "0\xc10\x99\x00\x000\xc2" + // 0x30C13099: 0x000030C2 + "0\xc40\x99\x00\x000\xc5" + // 0x30C43099: 0x000030C5 + "0\xc60\x99\x00\x000\xc7" + // 0x30C63099: 0x000030C7 + "0\xc80\x99\x00\x000\xc9" + // 0x30C83099: 0x000030C9 + "0\xcf0\x99\x00\x000\xd0" + // 0x30CF3099: 0x000030D0 + "0\xcf0\x9a\x00\x000\xd1" + // 0x30CF309A: 0x000030D1 + "0\xd20\x99\x00\x000\xd3" + // 0x30D23099: 0x000030D3 + "0\xd20\x9a\x00\x000\xd4" + // 0x30D2309A: 0x000030D4 + "0\xd50\x99\x00\x000\xd6" + // 0x30D53099: 0x000030D6 + "0\xd50\x9a\x00\x000\xd7" + // 0x30D5309A: 0x000030D7 + "0\xd80\x99\x00\x000\xd9" + // 0x30D83099: 0x000030D9 + "0\xd80\x9a\x00\x000\xda" + // 0x30D8309A: 0x000030DA + "0\xdb0\x99\x00\x000\xdc" + // 0x30DB3099: 0x000030DC + "0\xdb0\x9a\x00\x000\xdd" + // 0x30DB309A: 0x000030DD + "0\xa60\x99\x00\x000\xf4" + // 0x30A63099: 0x000030F4 + "0\xef0\x99\x00\x000\xf7" + // 0x30EF3099: 0x000030F7 + "0\xf00\x99\x00\x000\xf8" + // 0x30F03099: 0x000030F8 + "0\xf10\x99\x00\x000\xf9" + // 0x30F13099: 0x000030F9 + "0\xf20\x99\x00\x000\xfa" + // 0x30F23099: 0x000030FA + "0\xfd0\x99\x00\x000\xfe" + // 0x30FD3099: 0x000030FE + "\x10\x99\x10\xba\x00\x01\x10\x9a" + // 0x109910BA: 0x0001109A + "\x10\x9b\x10\xba\x00\x01\x10\x9c" + // 0x109B10BA: 0x0001109C + "\x10\xa5\x10\xba\x00\x01\x10\xab" + // 0x10A510BA: 0x000110AB + "\x111\x11'\x00\x01\x11." + // 0x11311127: 0x0001112E + "\x112\x11'\x00\x01\x11/" + // 0x11321127: 0x0001112F + "\x13G\x13>\x00\x01\x13K" + // 0x1347133E: 0x0001134B + "\x13G\x13W\x00\x01\x13L" + // 0x13471357: 0x0001134C + "\x14\xb9\x14\xba\x00\x01\x14\xbb" + // 0x14B914BA: 0x000114BB + "\x14\xb9\x14\xb0\x00\x01\x14\xbc" + // 0x14B914B0: 0x000114BC + "\x14\xb9\x14\xbd\x00\x01\x14\xbe" + // 0x14B914BD: 0x000114BE + "\x15\xb8\x15\xaf\x00\x01\x15\xba" + // 0x15B815AF: 0x000115BA + "\x15\xb9\x15\xaf\x00\x01\x15\xbb" + // 0x15B915AF: 0x000115BB + "\x195\x190\x00\x01\x198" + // 0x19351930: 0x00011938 + "" + // Total size of tables: 56KB (57068 bytes) diff --git a/vendor/golang.org/x/text/unicode/norm/trie.go b/vendor/golang.org/x/text/unicode/norm/trie.go index 423386bf..e4250ae2 100644 --- a/vendor/golang.org/x/text/unicode/norm/trie.go +++ b/vendor/golang.org/x/text/unicode/norm/trie.go @@ -29,7 +29,7 @@ var ( nfkcData = newNfkcTrie(0) ) -// lookupValue determines the type of block n and looks up the value for b. +// lookup determines the type of block n and looks up the value for b. // For n < t.cutoff, the block is a simple lookup table. Otherwise, the block // is a list of ranges with an accompanying value. Given a matching range r, // the value for b is by r.value + (b - r.lo) * stride. diff --git a/vendor/golang.org/x/text/width/tables13.0.0.go b/vendor/golang.org/x/text/width/tables13.0.0.go index ab258e38..b1fcb522 100644 --- a/vendor/golang.org/x/text/width/tables13.0.0.go +++ b/vendor/golang.org/x/text/width/tables13.0.0.go @@ -1,7 +1,7 @@ // Code generated by running "go generate" in golang.org/x/text. DO NOT EDIT. -//go:build go1.16 -// +build go1.16 +//go:build go1.16 && !go1.21 +// +build go1.16,!go1.21 package width diff --git a/vendor/golang.org/x/text/width/tables15.0.0.go b/vendor/golang.org/x/text/width/tables15.0.0.go new file mode 100644 index 00000000..4b91e338 --- /dev/null +++ b/vendor/golang.org/x/text/width/tables15.0.0.go @@ -0,0 +1,1368 @@ +// Code generated by running "go generate" in golang.org/x/text. DO NOT EDIT. + +//go:build go1.21 +// +build go1.21 + +package width + +// UnicodeVersion is the Unicode version from which the tables in this package are derived. +const UnicodeVersion = "15.0.0" + +// lookup returns the trie value for the first UTF-8 encoding in s and +// the width in bytes of this encoding. The size will be 0 if s does not +// hold enough bytes to complete the encoding. len(s) must be greater than 0. +func (t *widthTrie) lookup(s []byte) (v uint16, sz int) { + c0 := s[0] + switch { + case c0 < 0x80: // is ASCII + return widthValues[c0], 1 + case c0 < 0xC2: + return 0, 1 // Illegal UTF-8: not a starter, not ASCII. + case c0 < 0xE0: // 2-byte UTF-8 + if len(s) < 2 { + return 0, 0 + } + i := widthIndex[c0] + c1 := s[1] + if c1 < 0x80 || 0xC0 <= c1 { + return 0, 1 // Illegal UTF-8: not a continuation byte. + } + return t.lookupValue(uint32(i), c1), 2 + case c0 < 0xF0: // 3-byte UTF-8 + if len(s) < 3 { + return 0, 0 + } + i := widthIndex[c0] + c1 := s[1] + if c1 < 0x80 || 0xC0 <= c1 { + return 0, 1 // Illegal UTF-8: not a continuation byte. + } + o := uint32(i)<<6 + uint32(c1) + i = widthIndex[o] + c2 := s[2] + if c2 < 0x80 || 0xC0 <= c2 { + return 0, 2 // Illegal UTF-8: not a continuation byte. + } + return t.lookupValue(uint32(i), c2), 3 + case c0 < 0xF8: // 4-byte UTF-8 + if len(s) < 4 { + return 0, 0 + } + i := widthIndex[c0] + c1 := s[1] + if c1 < 0x80 || 0xC0 <= c1 { + return 0, 1 // Illegal UTF-8: not a continuation byte. + } + o := uint32(i)<<6 + uint32(c1) + i = widthIndex[o] + c2 := s[2] + if c2 < 0x80 || 0xC0 <= c2 { + return 0, 2 // Illegal UTF-8: not a continuation byte. + } + o = uint32(i)<<6 + uint32(c2) + i = widthIndex[o] + c3 := s[3] + if c3 < 0x80 || 0xC0 <= c3 { + return 0, 3 // Illegal UTF-8: not a continuation byte. + } + return t.lookupValue(uint32(i), c3), 4 + } + // Illegal rune + return 0, 1 +} + +// lookupUnsafe returns the trie value for the first UTF-8 encoding in s. +// s must start with a full and valid UTF-8 encoded rune. +func (t *widthTrie) lookupUnsafe(s []byte) uint16 { + c0 := s[0] + if c0 < 0x80 { // is ASCII + return widthValues[c0] + } + i := widthIndex[c0] + if c0 < 0xE0 { // 2-byte UTF-8 + return t.lookupValue(uint32(i), s[1]) + } + i = widthIndex[uint32(i)<<6+uint32(s[1])] + if c0 < 0xF0 { // 3-byte UTF-8 + return t.lookupValue(uint32(i), s[2]) + } + i = widthIndex[uint32(i)<<6+uint32(s[2])] + if c0 < 0xF8 { // 4-byte UTF-8 + return t.lookupValue(uint32(i), s[3]) + } + return 0 +} + +// lookupString returns the trie value for the first UTF-8 encoding in s and +// the width in bytes of this encoding. The size will be 0 if s does not +// hold enough bytes to complete the encoding. len(s) must be greater than 0. +func (t *widthTrie) lookupString(s string) (v uint16, sz int) { + c0 := s[0] + switch { + case c0 < 0x80: // is ASCII + return widthValues[c0], 1 + case c0 < 0xC2: + return 0, 1 // Illegal UTF-8: not a starter, not ASCII. + case c0 < 0xE0: // 2-byte UTF-8 + if len(s) < 2 { + return 0, 0 + } + i := widthIndex[c0] + c1 := s[1] + if c1 < 0x80 || 0xC0 <= c1 { + return 0, 1 // Illegal UTF-8: not a continuation byte. + } + return t.lookupValue(uint32(i), c1), 2 + case c0 < 0xF0: // 3-byte UTF-8 + if len(s) < 3 { + return 0, 0 + } + i := widthIndex[c0] + c1 := s[1] + if c1 < 0x80 || 0xC0 <= c1 { + return 0, 1 // Illegal UTF-8: not a continuation byte. + } + o := uint32(i)<<6 + uint32(c1) + i = widthIndex[o] + c2 := s[2] + if c2 < 0x80 || 0xC0 <= c2 { + return 0, 2 // Illegal UTF-8: not a continuation byte. + } + return t.lookupValue(uint32(i), c2), 3 + case c0 < 0xF8: // 4-byte UTF-8 + if len(s) < 4 { + return 0, 0 + } + i := widthIndex[c0] + c1 := s[1] + if c1 < 0x80 || 0xC0 <= c1 { + return 0, 1 // Illegal UTF-8: not a continuation byte. + } + o := uint32(i)<<6 + uint32(c1) + i = widthIndex[o] + c2 := s[2] + if c2 < 0x80 || 0xC0 <= c2 { + return 0, 2 // Illegal UTF-8: not a continuation byte. + } + o = uint32(i)<<6 + uint32(c2) + i = widthIndex[o] + c3 := s[3] + if c3 < 0x80 || 0xC0 <= c3 { + return 0, 3 // Illegal UTF-8: not a continuation byte. + } + return t.lookupValue(uint32(i), c3), 4 + } + // Illegal rune + return 0, 1 +} + +// lookupStringUnsafe returns the trie value for the first UTF-8 encoding in s. +// s must start with a full and valid UTF-8 encoded rune. +func (t *widthTrie) lookupStringUnsafe(s string) uint16 { + c0 := s[0] + if c0 < 0x80 { // is ASCII + return widthValues[c0] + } + i := widthIndex[c0] + if c0 < 0xE0 { // 2-byte UTF-8 + return t.lookupValue(uint32(i), s[1]) + } + i = widthIndex[uint32(i)<<6+uint32(s[1])] + if c0 < 0xF0 { // 3-byte UTF-8 + return t.lookupValue(uint32(i), s[2]) + } + i = widthIndex[uint32(i)<<6+uint32(s[2])] + if c0 < 0xF8 { // 4-byte UTF-8 + return t.lookupValue(uint32(i), s[3]) + } + return 0 +} + +// widthTrie. Total size: 14912 bytes (14.56 KiB). Checksum: 4468b6cd178303d2. +type widthTrie struct{} + +func newWidthTrie(i int) *widthTrie { + return &widthTrie{} +} + +// lookupValue determines the type of block n and looks up the value for b. +func (t *widthTrie) lookupValue(n uint32, b byte) uint16 { + switch { + default: + return uint16(widthValues[n<<6+uint32(b)]) + } +} + +// widthValues: 105 blocks, 6720 entries, 13440 bytes +// The third block is the zero block. +var widthValues = [6720]uint16{ + // Block 0x0, offset 0x0 + 0x20: 0x6001, 0x21: 0x6002, 0x22: 0x6002, 0x23: 0x6002, + 0x24: 0x6002, 0x25: 0x6002, 0x26: 0x6002, 0x27: 0x6002, 0x28: 0x6002, 0x29: 0x6002, + 0x2a: 0x6002, 0x2b: 0x6002, 0x2c: 0x6002, 0x2d: 0x6002, 0x2e: 0x6002, 0x2f: 0x6002, + 0x30: 0x6002, 0x31: 0x6002, 0x32: 0x6002, 0x33: 0x6002, 0x34: 0x6002, 0x35: 0x6002, + 0x36: 0x6002, 0x37: 0x6002, 0x38: 0x6002, 0x39: 0x6002, 0x3a: 0x6002, 0x3b: 0x6002, + 0x3c: 0x6002, 0x3d: 0x6002, 0x3e: 0x6002, 0x3f: 0x6002, + // Block 0x1, offset 0x40 + 0x40: 0x6003, 0x41: 0x6003, 0x42: 0x6003, 0x43: 0x6003, 0x44: 0x6003, 0x45: 0x6003, + 0x46: 0x6003, 0x47: 0x6003, 0x48: 0x6003, 0x49: 0x6003, 0x4a: 0x6003, 0x4b: 0x6003, + 0x4c: 0x6003, 0x4d: 0x6003, 0x4e: 0x6003, 0x4f: 0x6003, 0x50: 0x6003, 0x51: 0x6003, + 0x52: 0x6003, 0x53: 0x6003, 0x54: 0x6003, 0x55: 0x6003, 0x56: 0x6003, 0x57: 0x6003, + 0x58: 0x6003, 0x59: 0x6003, 0x5a: 0x6003, 0x5b: 0x6003, 0x5c: 0x6003, 0x5d: 0x6003, + 0x5e: 0x6003, 0x5f: 0x6003, 0x60: 0x6004, 0x61: 0x6004, 0x62: 0x6004, 0x63: 0x6004, + 0x64: 0x6004, 0x65: 0x6004, 0x66: 0x6004, 0x67: 0x6004, 0x68: 0x6004, 0x69: 0x6004, + 0x6a: 0x6004, 0x6b: 0x6004, 0x6c: 0x6004, 0x6d: 0x6004, 0x6e: 0x6004, 0x6f: 0x6004, + 0x70: 0x6004, 0x71: 0x6004, 0x72: 0x6004, 0x73: 0x6004, 0x74: 0x6004, 0x75: 0x6004, + 0x76: 0x6004, 0x77: 0x6004, 0x78: 0x6004, 0x79: 0x6004, 0x7a: 0x6004, 0x7b: 0x6004, + 0x7c: 0x6004, 0x7d: 0x6004, 0x7e: 0x6004, + // Block 0x2, offset 0x80 + // Block 0x3, offset 0xc0 + 0xe1: 0x2000, 0xe2: 0x6005, 0xe3: 0x6005, + 0xe4: 0x2000, 0xe5: 0x6006, 0xe6: 0x6005, 0xe7: 0x2000, 0xe8: 0x2000, + 0xea: 0x2000, 0xec: 0x6007, 0xed: 0x2000, 0xee: 0x2000, 0xef: 0x6008, + 0xf0: 0x2000, 0xf1: 0x2000, 0xf2: 0x2000, 0xf3: 0x2000, 0xf4: 0x2000, + 0xf6: 0x2000, 0xf7: 0x2000, 0xf8: 0x2000, 0xf9: 0x2000, 0xfa: 0x2000, + 0xfc: 0x2000, 0xfd: 0x2000, 0xfe: 0x2000, 0xff: 0x2000, + // Block 0x4, offset 0x100 + 0x106: 0x2000, + 0x110: 0x2000, + 0x117: 0x2000, + 0x118: 0x2000, + 0x11e: 0x2000, 0x11f: 0x2000, 0x120: 0x2000, 0x121: 0x2000, + 0x126: 0x2000, 0x128: 0x2000, 0x129: 0x2000, + 0x12a: 0x2000, 0x12c: 0x2000, 0x12d: 0x2000, + 0x130: 0x2000, 0x132: 0x2000, 0x133: 0x2000, + 0x137: 0x2000, 0x138: 0x2000, 0x139: 0x2000, 0x13a: 0x2000, + 0x13c: 0x2000, 0x13e: 0x2000, + // Block 0x5, offset 0x140 + 0x141: 0x2000, + 0x151: 0x2000, + 0x153: 0x2000, + 0x15b: 0x2000, + 0x166: 0x2000, 0x167: 0x2000, + 0x16b: 0x2000, + 0x171: 0x2000, 0x172: 0x2000, 0x173: 0x2000, + 0x178: 0x2000, + 0x17f: 0x2000, + // Block 0x6, offset 0x180 + 0x180: 0x2000, 0x181: 0x2000, 0x182: 0x2000, 0x184: 0x2000, + 0x188: 0x2000, 0x189: 0x2000, 0x18a: 0x2000, 0x18b: 0x2000, + 0x18d: 0x2000, + 0x192: 0x2000, 0x193: 0x2000, + 0x1a6: 0x2000, 0x1a7: 0x2000, + 0x1ab: 0x2000, + // Block 0x7, offset 0x1c0 + 0x1ce: 0x2000, 0x1d0: 0x2000, + 0x1d2: 0x2000, 0x1d4: 0x2000, 0x1d6: 0x2000, + 0x1d8: 0x2000, 0x1da: 0x2000, 0x1dc: 0x2000, + // Block 0x8, offset 0x200 + 0x211: 0x2000, + 0x221: 0x2000, + // Block 0x9, offset 0x240 + 0x244: 0x2000, + 0x247: 0x2000, 0x249: 0x2000, 0x24a: 0x2000, 0x24b: 0x2000, + 0x24d: 0x2000, 0x250: 0x2000, + 0x258: 0x2000, 0x259: 0x2000, 0x25a: 0x2000, 0x25b: 0x2000, 0x25d: 0x2000, + 0x25f: 0x2000, + // Block 0xa, offset 0x280 + 0x280: 0x2000, 0x281: 0x2000, 0x282: 0x2000, 0x283: 0x2000, 0x284: 0x2000, 0x285: 0x2000, + 0x286: 0x2000, 0x287: 0x2000, 0x288: 0x2000, 0x289: 0x2000, 0x28a: 0x2000, 0x28b: 0x2000, + 0x28c: 0x2000, 0x28d: 0x2000, 0x28e: 0x2000, 0x28f: 0x2000, 0x290: 0x2000, 0x291: 0x2000, + 0x292: 0x2000, 0x293: 0x2000, 0x294: 0x2000, 0x295: 0x2000, 0x296: 0x2000, 0x297: 0x2000, + 0x298: 0x2000, 0x299: 0x2000, 0x29a: 0x2000, 0x29b: 0x2000, 0x29c: 0x2000, 0x29d: 0x2000, + 0x29e: 0x2000, 0x29f: 0x2000, 0x2a0: 0x2000, 0x2a1: 0x2000, 0x2a2: 0x2000, 0x2a3: 0x2000, + 0x2a4: 0x2000, 0x2a5: 0x2000, 0x2a6: 0x2000, 0x2a7: 0x2000, 0x2a8: 0x2000, 0x2a9: 0x2000, + 0x2aa: 0x2000, 0x2ab: 0x2000, 0x2ac: 0x2000, 0x2ad: 0x2000, 0x2ae: 0x2000, 0x2af: 0x2000, + 0x2b0: 0x2000, 0x2b1: 0x2000, 0x2b2: 0x2000, 0x2b3: 0x2000, 0x2b4: 0x2000, 0x2b5: 0x2000, + 0x2b6: 0x2000, 0x2b7: 0x2000, 0x2b8: 0x2000, 0x2b9: 0x2000, 0x2ba: 0x2000, 0x2bb: 0x2000, + 0x2bc: 0x2000, 0x2bd: 0x2000, 0x2be: 0x2000, 0x2bf: 0x2000, + // Block 0xb, offset 0x2c0 + 0x2c0: 0x2000, 0x2c1: 0x2000, 0x2c2: 0x2000, 0x2c3: 0x2000, 0x2c4: 0x2000, 0x2c5: 0x2000, + 0x2c6: 0x2000, 0x2c7: 0x2000, 0x2c8: 0x2000, 0x2c9: 0x2000, 0x2ca: 0x2000, 0x2cb: 0x2000, + 0x2cc: 0x2000, 0x2cd: 0x2000, 0x2ce: 0x2000, 0x2cf: 0x2000, 0x2d0: 0x2000, 0x2d1: 0x2000, + 0x2d2: 0x2000, 0x2d3: 0x2000, 0x2d4: 0x2000, 0x2d5: 0x2000, 0x2d6: 0x2000, 0x2d7: 0x2000, + 0x2d8: 0x2000, 0x2d9: 0x2000, 0x2da: 0x2000, 0x2db: 0x2000, 0x2dc: 0x2000, 0x2dd: 0x2000, + 0x2de: 0x2000, 0x2df: 0x2000, 0x2e0: 0x2000, 0x2e1: 0x2000, 0x2e2: 0x2000, 0x2e3: 0x2000, + 0x2e4: 0x2000, 0x2e5: 0x2000, 0x2e6: 0x2000, 0x2e7: 0x2000, 0x2e8: 0x2000, 0x2e9: 0x2000, + 0x2ea: 0x2000, 0x2eb: 0x2000, 0x2ec: 0x2000, 0x2ed: 0x2000, 0x2ee: 0x2000, 0x2ef: 0x2000, + // Block 0xc, offset 0x300 + 0x311: 0x2000, + 0x312: 0x2000, 0x313: 0x2000, 0x314: 0x2000, 0x315: 0x2000, 0x316: 0x2000, 0x317: 0x2000, + 0x318: 0x2000, 0x319: 0x2000, 0x31a: 0x2000, 0x31b: 0x2000, 0x31c: 0x2000, 0x31d: 0x2000, + 0x31e: 0x2000, 0x31f: 0x2000, 0x320: 0x2000, 0x321: 0x2000, 0x323: 0x2000, + 0x324: 0x2000, 0x325: 0x2000, 0x326: 0x2000, 0x327: 0x2000, 0x328: 0x2000, 0x329: 0x2000, + 0x331: 0x2000, 0x332: 0x2000, 0x333: 0x2000, 0x334: 0x2000, 0x335: 0x2000, + 0x336: 0x2000, 0x337: 0x2000, 0x338: 0x2000, 0x339: 0x2000, 0x33a: 0x2000, 0x33b: 0x2000, + 0x33c: 0x2000, 0x33d: 0x2000, 0x33e: 0x2000, 0x33f: 0x2000, + // Block 0xd, offset 0x340 + 0x340: 0x2000, 0x341: 0x2000, 0x343: 0x2000, 0x344: 0x2000, 0x345: 0x2000, + 0x346: 0x2000, 0x347: 0x2000, 0x348: 0x2000, 0x349: 0x2000, + // Block 0xe, offset 0x380 + 0x381: 0x2000, + 0x390: 0x2000, 0x391: 0x2000, + 0x392: 0x2000, 0x393: 0x2000, 0x394: 0x2000, 0x395: 0x2000, 0x396: 0x2000, 0x397: 0x2000, + 0x398: 0x2000, 0x399: 0x2000, 0x39a: 0x2000, 0x39b: 0x2000, 0x39c: 0x2000, 0x39d: 0x2000, + 0x39e: 0x2000, 0x39f: 0x2000, 0x3a0: 0x2000, 0x3a1: 0x2000, 0x3a2: 0x2000, 0x3a3: 0x2000, + 0x3a4: 0x2000, 0x3a5: 0x2000, 0x3a6: 0x2000, 0x3a7: 0x2000, 0x3a8: 0x2000, 0x3a9: 0x2000, + 0x3aa: 0x2000, 0x3ab: 0x2000, 0x3ac: 0x2000, 0x3ad: 0x2000, 0x3ae: 0x2000, 0x3af: 0x2000, + 0x3b0: 0x2000, 0x3b1: 0x2000, 0x3b2: 0x2000, 0x3b3: 0x2000, 0x3b4: 0x2000, 0x3b5: 0x2000, + 0x3b6: 0x2000, 0x3b7: 0x2000, 0x3b8: 0x2000, 0x3b9: 0x2000, 0x3ba: 0x2000, 0x3bb: 0x2000, + 0x3bc: 0x2000, 0x3bd: 0x2000, 0x3be: 0x2000, 0x3bf: 0x2000, + // Block 0xf, offset 0x3c0 + 0x3c0: 0x2000, 0x3c1: 0x2000, 0x3c2: 0x2000, 0x3c3: 0x2000, 0x3c4: 0x2000, 0x3c5: 0x2000, + 0x3c6: 0x2000, 0x3c7: 0x2000, 0x3c8: 0x2000, 0x3c9: 0x2000, 0x3ca: 0x2000, 0x3cb: 0x2000, + 0x3cc: 0x2000, 0x3cd: 0x2000, 0x3ce: 0x2000, 0x3cf: 0x2000, 0x3d1: 0x2000, + // Block 0x10, offset 0x400 + 0x400: 0x4000, 0x401: 0x4000, 0x402: 0x4000, 0x403: 0x4000, 0x404: 0x4000, 0x405: 0x4000, + 0x406: 0x4000, 0x407: 0x4000, 0x408: 0x4000, 0x409: 0x4000, 0x40a: 0x4000, 0x40b: 0x4000, + 0x40c: 0x4000, 0x40d: 0x4000, 0x40e: 0x4000, 0x40f: 0x4000, 0x410: 0x4000, 0x411: 0x4000, + 0x412: 0x4000, 0x413: 0x4000, 0x414: 0x4000, 0x415: 0x4000, 0x416: 0x4000, 0x417: 0x4000, + 0x418: 0x4000, 0x419: 0x4000, 0x41a: 0x4000, 0x41b: 0x4000, 0x41c: 0x4000, 0x41d: 0x4000, + 0x41e: 0x4000, 0x41f: 0x4000, 0x420: 0x4000, 0x421: 0x4000, 0x422: 0x4000, 0x423: 0x4000, + 0x424: 0x4000, 0x425: 0x4000, 0x426: 0x4000, 0x427: 0x4000, 0x428: 0x4000, 0x429: 0x4000, + 0x42a: 0x4000, 0x42b: 0x4000, 0x42c: 0x4000, 0x42d: 0x4000, 0x42e: 0x4000, 0x42f: 0x4000, + 0x430: 0x4000, 0x431: 0x4000, 0x432: 0x4000, 0x433: 0x4000, 0x434: 0x4000, 0x435: 0x4000, + 0x436: 0x4000, 0x437: 0x4000, 0x438: 0x4000, 0x439: 0x4000, 0x43a: 0x4000, 0x43b: 0x4000, + 0x43c: 0x4000, 0x43d: 0x4000, 0x43e: 0x4000, 0x43f: 0x4000, + // Block 0x11, offset 0x440 + 0x440: 0x4000, 0x441: 0x4000, 0x442: 0x4000, 0x443: 0x4000, 0x444: 0x4000, 0x445: 0x4000, + 0x446: 0x4000, 0x447: 0x4000, 0x448: 0x4000, 0x449: 0x4000, 0x44a: 0x4000, 0x44b: 0x4000, + 0x44c: 0x4000, 0x44d: 0x4000, 0x44e: 0x4000, 0x44f: 0x4000, 0x450: 0x4000, 0x451: 0x4000, + 0x452: 0x4000, 0x453: 0x4000, 0x454: 0x4000, 0x455: 0x4000, 0x456: 0x4000, 0x457: 0x4000, + 0x458: 0x4000, 0x459: 0x4000, 0x45a: 0x4000, 0x45b: 0x4000, 0x45c: 0x4000, 0x45d: 0x4000, + 0x45e: 0x4000, 0x45f: 0x4000, + // Block 0x12, offset 0x480 + 0x490: 0x2000, + 0x493: 0x2000, 0x494: 0x2000, 0x495: 0x2000, 0x496: 0x2000, + 0x498: 0x2000, 0x499: 0x2000, 0x49c: 0x2000, 0x49d: 0x2000, + 0x4a0: 0x2000, 0x4a1: 0x2000, 0x4a2: 0x2000, + 0x4a4: 0x2000, 0x4a5: 0x2000, 0x4a6: 0x2000, 0x4a7: 0x2000, + 0x4b0: 0x2000, 0x4b2: 0x2000, 0x4b3: 0x2000, 0x4b5: 0x2000, + 0x4bb: 0x2000, + 0x4be: 0x2000, + // Block 0x13, offset 0x4c0 + 0x4f4: 0x2000, + 0x4ff: 0x2000, + // Block 0x14, offset 0x500 + 0x501: 0x2000, 0x502: 0x2000, 0x503: 0x2000, 0x504: 0x2000, + 0x529: 0xa009, + 0x52c: 0x2000, + // Block 0x15, offset 0x540 + 0x543: 0x2000, 0x545: 0x2000, + 0x549: 0x2000, + 0x553: 0x2000, 0x556: 0x2000, + 0x561: 0x2000, 0x562: 0x2000, + 0x566: 0x2000, + 0x56b: 0x2000, + // Block 0x16, offset 0x580 + 0x593: 0x2000, 0x594: 0x2000, + 0x59b: 0x2000, 0x59c: 0x2000, 0x59d: 0x2000, + 0x59e: 0x2000, 0x5a0: 0x2000, 0x5a1: 0x2000, 0x5a2: 0x2000, 0x5a3: 0x2000, + 0x5a4: 0x2000, 0x5a5: 0x2000, 0x5a6: 0x2000, 0x5a7: 0x2000, 0x5a8: 0x2000, 0x5a9: 0x2000, + 0x5aa: 0x2000, 0x5ab: 0x2000, + 0x5b0: 0x2000, 0x5b1: 0x2000, 0x5b2: 0x2000, 0x5b3: 0x2000, 0x5b4: 0x2000, 0x5b5: 0x2000, + 0x5b6: 0x2000, 0x5b7: 0x2000, 0x5b8: 0x2000, 0x5b9: 0x2000, + // Block 0x17, offset 0x5c0 + 0x5c9: 0x2000, + 0x5d0: 0x200a, 0x5d1: 0x200b, + 0x5d2: 0x200a, 0x5d3: 0x200c, 0x5d4: 0x2000, 0x5d5: 0x2000, 0x5d6: 0x2000, 0x5d7: 0x2000, + 0x5d8: 0x2000, 0x5d9: 0x2000, + 0x5f8: 0x2000, 0x5f9: 0x2000, + // Block 0x18, offset 0x600 + 0x612: 0x2000, 0x614: 0x2000, + 0x627: 0x2000, + // Block 0x19, offset 0x640 + 0x640: 0x2000, 0x642: 0x2000, 0x643: 0x2000, + 0x647: 0x2000, 0x648: 0x2000, 0x64b: 0x2000, + 0x64f: 0x2000, 0x651: 0x2000, + 0x655: 0x2000, + 0x65a: 0x2000, 0x65d: 0x2000, + 0x65e: 0x2000, 0x65f: 0x2000, 0x660: 0x2000, 0x663: 0x2000, + 0x665: 0x2000, 0x667: 0x2000, 0x668: 0x2000, 0x669: 0x2000, + 0x66a: 0x2000, 0x66b: 0x2000, 0x66c: 0x2000, 0x66e: 0x2000, + 0x674: 0x2000, 0x675: 0x2000, + 0x676: 0x2000, 0x677: 0x2000, + 0x67c: 0x2000, 0x67d: 0x2000, + // Block 0x1a, offset 0x680 + 0x688: 0x2000, + 0x68c: 0x2000, + 0x692: 0x2000, + 0x6a0: 0x2000, 0x6a1: 0x2000, + 0x6a4: 0x2000, 0x6a5: 0x2000, 0x6a6: 0x2000, 0x6a7: 0x2000, + 0x6aa: 0x2000, 0x6ab: 0x2000, 0x6ae: 0x2000, 0x6af: 0x2000, + // Block 0x1b, offset 0x6c0 + 0x6c2: 0x2000, 0x6c3: 0x2000, + 0x6c6: 0x2000, 0x6c7: 0x2000, + 0x6d5: 0x2000, + 0x6d9: 0x2000, + 0x6e5: 0x2000, + 0x6ff: 0x2000, + // Block 0x1c, offset 0x700 + 0x712: 0x2000, + 0x71a: 0x4000, 0x71b: 0x4000, + 0x729: 0x4000, + 0x72a: 0x4000, + // Block 0x1d, offset 0x740 + 0x769: 0x4000, + 0x76a: 0x4000, 0x76b: 0x4000, 0x76c: 0x4000, + 0x770: 0x4000, 0x773: 0x4000, + // Block 0x1e, offset 0x780 + 0x7a0: 0x2000, 0x7a1: 0x2000, 0x7a2: 0x2000, 0x7a3: 0x2000, + 0x7a4: 0x2000, 0x7a5: 0x2000, 0x7a6: 0x2000, 0x7a7: 0x2000, 0x7a8: 0x2000, 0x7a9: 0x2000, + 0x7aa: 0x2000, 0x7ab: 0x2000, 0x7ac: 0x2000, 0x7ad: 0x2000, 0x7ae: 0x2000, 0x7af: 0x2000, + 0x7b0: 0x2000, 0x7b1: 0x2000, 0x7b2: 0x2000, 0x7b3: 0x2000, 0x7b4: 0x2000, 0x7b5: 0x2000, + 0x7b6: 0x2000, 0x7b7: 0x2000, 0x7b8: 0x2000, 0x7b9: 0x2000, 0x7ba: 0x2000, 0x7bb: 0x2000, + 0x7bc: 0x2000, 0x7bd: 0x2000, 0x7be: 0x2000, 0x7bf: 0x2000, + // Block 0x1f, offset 0x7c0 + 0x7c0: 0x2000, 0x7c1: 0x2000, 0x7c2: 0x2000, 0x7c3: 0x2000, 0x7c4: 0x2000, 0x7c5: 0x2000, + 0x7c6: 0x2000, 0x7c7: 0x2000, 0x7c8: 0x2000, 0x7c9: 0x2000, 0x7ca: 0x2000, 0x7cb: 0x2000, + 0x7cc: 0x2000, 0x7cd: 0x2000, 0x7ce: 0x2000, 0x7cf: 0x2000, 0x7d0: 0x2000, 0x7d1: 0x2000, + 0x7d2: 0x2000, 0x7d3: 0x2000, 0x7d4: 0x2000, 0x7d5: 0x2000, 0x7d6: 0x2000, 0x7d7: 0x2000, + 0x7d8: 0x2000, 0x7d9: 0x2000, 0x7da: 0x2000, 0x7db: 0x2000, 0x7dc: 0x2000, 0x7dd: 0x2000, + 0x7de: 0x2000, 0x7df: 0x2000, 0x7e0: 0x2000, 0x7e1: 0x2000, 0x7e2: 0x2000, 0x7e3: 0x2000, + 0x7e4: 0x2000, 0x7e5: 0x2000, 0x7e6: 0x2000, 0x7e7: 0x2000, 0x7e8: 0x2000, 0x7e9: 0x2000, + 0x7eb: 0x2000, 0x7ec: 0x2000, 0x7ed: 0x2000, 0x7ee: 0x2000, 0x7ef: 0x2000, + 0x7f0: 0x2000, 0x7f1: 0x2000, 0x7f2: 0x2000, 0x7f3: 0x2000, 0x7f4: 0x2000, 0x7f5: 0x2000, + 0x7f6: 0x2000, 0x7f7: 0x2000, 0x7f8: 0x2000, 0x7f9: 0x2000, 0x7fa: 0x2000, 0x7fb: 0x2000, + 0x7fc: 0x2000, 0x7fd: 0x2000, 0x7fe: 0x2000, 0x7ff: 0x2000, + // Block 0x20, offset 0x800 + 0x800: 0x2000, 0x801: 0x2000, 0x802: 0x200d, 0x803: 0x2000, 0x804: 0x2000, 0x805: 0x2000, + 0x806: 0x2000, 0x807: 0x2000, 0x808: 0x2000, 0x809: 0x2000, 0x80a: 0x2000, 0x80b: 0x2000, + 0x80c: 0x2000, 0x80d: 0x2000, 0x80e: 0x2000, 0x80f: 0x2000, 0x810: 0x2000, 0x811: 0x2000, + 0x812: 0x2000, 0x813: 0x2000, 0x814: 0x2000, 0x815: 0x2000, 0x816: 0x2000, 0x817: 0x2000, + 0x818: 0x2000, 0x819: 0x2000, 0x81a: 0x2000, 0x81b: 0x2000, 0x81c: 0x2000, 0x81d: 0x2000, + 0x81e: 0x2000, 0x81f: 0x2000, 0x820: 0x2000, 0x821: 0x2000, 0x822: 0x2000, 0x823: 0x2000, + 0x824: 0x2000, 0x825: 0x2000, 0x826: 0x2000, 0x827: 0x2000, 0x828: 0x2000, 0x829: 0x2000, + 0x82a: 0x2000, 0x82b: 0x2000, 0x82c: 0x2000, 0x82d: 0x2000, 0x82e: 0x2000, 0x82f: 0x2000, + 0x830: 0x2000, 0x831: 0x2000, 0x832: 0x2000, 0x833: 0x2000, 0x834: 0x2000, 0x835: 0x2000, + 0x836: 0x2000, 0x837: 0x2000, 0x838: 0x2000, 0x839: 0x2000, 0x83a: 0x2000, 0x83b: 0x2000, + 0x83c: 0x2000, 0x83d: 0x2000, 0x83e: 0x2000, 0x83f: 0x2000, + // Block 0x21, offset 0x840 + 0x840: 0x2000, 0x841: 0x2000, 0x842: 0x2000, 0x843: 0x2000, 0x844: 0x2000, 0x845: 0x2000, + 0x846: 0x2000, 0x847: 0x2000, 0x848: 0x2000, 0x849: 0x2000, 0x84a: 0x2000, 0x84b: 0x2000, + 0x850: 0x2000, 0x851: 0x2000, + 0x852: 0x2000, 0x853: 0x2000, 0x854: 0x2000, 0x855: 0x2000, 0x856: 0x2000, 0x857: 0x2000, + 0x858: 0x2000, 0x859: 0x2000, 0x85a: 0x2000, 0x85b: 0x2000, 0x85c: 0x2000, 0x85d: 0x2000, + 0x85e: 0x2000, 0x85f: 0x2000, 0x860: 0x2000, 0x861: 0x2000, 0x862: 0x2000, 0x863: 0x2000, + 0x864: 0x2000, 0x865: 0x2000, 0x866: 0x2000, 0x867: 0x2000, 0x868: 0x2000, 0x869: 0x2000, + 0x86a: 0x2000, 0x86b: 0x2000, 0x86c: 0x2000, 0x86d: 0x2000, 0x86e: 0x2000, 0x86f: 0x2000, + 0x870: 0x2000, 0x871: 0x2000, 0x872: 0x2000, 0x873: 0x2000, + // Block 0x22, offset 0x880 + 0x880: 0x2000, 0x881: 0x2000, 0x882: 0x2000, 0x883: 0x2000, 0x884: 0x2000, 0x885: 0x2000, + 0x886: 0x2000, 0x887: 0x2000, 0x888: 0x2000, 0x889: 0x2000, 0x88a: 0x2000, 0x88b: 0x2000, + 0x88c: 0x2000, 0x88d: 0x2000, 0x88e: 0x2000, 0x88f: 0x2000, + 0x892: 0x2000, 0x893: 0x2000, 0x894: 0x2000, 0x895: 0x2000, + 0x8a0: 0x200e, 0x8a1: 0x2000, 0x8a3: 0x2000, + 0x8a4: 0x2000, 0x8a5: 0x2000, 0x8a6: 0x2000, 0x8a7: 0x2000, 0x8a8: 0x2000, 0x8a9: 0x2000, + 0x8b2: 0x2000, 0x8b3: 0x2000, + 0x8b6: 0x2000, 0x8b7: 0x2000, + 0x8bc: 0x2000, 0x8bd: 0x2000, + // Block 0x23, offset 0x8c0 + 0x8c0: 0x2000, 0x8c1: 0x2000, + 0x8c6: 0x2000, 0x8c7: 0x2000, 0x8c8: 0x2000, 0x8cb: 0x200f, + 0x8ce: 0x2000, 0x8cf: 0x2000, 0x8d0: 0x2000, 0x8d1: 0x2000, + 0x8e2: 0x2000, 0x8e3: 0x2000, + 0x8e4: 0x2000, 0x8e5: 0x2000, + 0x8ef: 0x2000, + 0x8fd: 0x4000, 0x8fe: 0x4000, + // Block 0x24, offset 0x900 + 0x905: 0x2000, + 0x906: 0x2000, 0x909: 0x2000, + 0x90e: 0x2000, 0x90f: 0x2000, + 0x914: 0x4000, 0x915: 0x4000, + 0x91c: 0x2000, + 0x91e: 0x2000, + // Block 0x25, offset 0x940 + 0x940: 0x2000, 0x942: 0x2000, + 0x948: 0x4000, 0x949: 0x4000, 0x94a: 0x4000, 0x94b: 0x4000, + 0x94c: 0x4000, 0x94d: 0x4000, 0x94e: 0x4000, 0x94f: 0x4000, 0x950: 0x4000, 0x951: 0x4000, + 0x952: 0x4000, 0x953: 0x4000, + 0x960: 0x2000, 0x961: 0x2000, 0x963: 0x2000, + 0x964: 0x2000, 0x965: 0x2000, 0x967: 0x2000, 0x968: 0x2000, 0x969: 0x2000, + 0x96a: 0x2000, 0x96c: 0x2000, 0x96d: 0x2000, 0x96f: 0x2000, + 0x97f: 0x4000, + // Block 0x26, offset 0x980 + 0x993: 0x4000, + 0x99e: 0x2000, 0x99f: 0x2000, 0x9a1: 0x4000, + 0x9aa: 0x4000, 0x9ab: 0x4000, + 0x9bd: 0x4000, 0x9be: 0x4000, 0x9bf: 0x2000, + // Block 0x27, offset 0x9c0 + 0x9c4: 0x4000, 0x9c5: 0x4000, + 0x9c6: 0x2000, 0x9c7: 0x2000, 0x9c8: 0x2000, 0x9c9: 0x2000, 0x9ca: 0x2000, 0x9cb: 0x2000, + 0x9cc: 0x2000, 0x9cd: 0x2000, 0x9ce: 0x4000, 0x9cf: 0x2000, 0x9d0: 0x2000, 0x9d1: 0x2000, + 0x9d2: 0x2000, 0x9d3: 0x2000, 0x9d4: 0x4000, 0x9d5: 0x2000, 0x9d6: 0x2000, 0x9d7: 0x2000, + 0x9d8: 0x2000, 0x9d9: 0x2000, 0x9da: 0x2000, 0x9db: 0x2000, 0x9dc: 0x2000, 0x9dd: 0x2000, + 0x9de: 0x2000, 0x9df: 0x2000, 0x9e0: 0x2000, 0x9e1: 0x2000, 0x9e3: 0x2000, + 0x9e8: 0x2000, 0x9e9: 0x2000, + 0x9ea: 0x4000, 0x9eb: 0x2000, 0x9ec: 0x2000, 0x9ed: 0x2000, 0x9ee: 0x2000, 0x9ef: 0x2000, + 0x9f0: 0x2000, 0x9f1: 0x2000, 0x9f2: 0x4000, 0x9f3: 0x4000, 0x9f4: 0x2000, 0x9f5: 0x4000, + 0x9f6: 0x2000, 0x9f7: 0x2000, 0x9f8: 0x2000, 0x9f9: 0x2000, 0x9fa: 0x4000, 0x9fb: 0x2000, + 0x9fc: 0x2000, 0x9fd: 0x4000, 0x9fe: 0x2000, 0x9ff: 0x2000, + // Block 0x28, offset 0xa00 + 0xa05: 0x4000, + 0xa0a: 0x4000, 0xa0b: 0x4000, + 0xa28: 0x4000, + 0xa3d: 0x2000, + // Block 0x29, offset 0xa40 + 0xa4c: 0x4000, 0xa4e: 0x4000, + 0xa53: 0x4000, 0xa54: 0x4000, 0xa55: 0x4000, 0xa57: 0x4000, + 0xa76: 0x2000, 0xa77: 0x2000, 0xa78: 0x2000, 0xa79: 0x2000, 0xa7a: 0x2000, 0xa7b: 0x2000, + 0xa7c: 0x2000, 0xa7d: 0x2000, 0xa7e: 0x2000, 0xa7f: 0x2000, + // Block 0x2a, offset 0xa80 + 0xa95: 0x4000, 0xa96: 0x4000, 0xa97: 0x4000, + 0xab0: 0x4000, + 0xabf: 0x4000, + // Block 0x2b, offset 0xac0 + 0xae6: 0x6000, 0xae7: 0x6000, 0xae8: 0x6000, 0xae9: 0x6000, + 0xaea: 0x6000, 0xaeb: 0x6000, 0xaec: 0x6000, 0xaed: 0x6000, + // Block 0x2c, offset 0xb00 + 0xb05: 0x6010, + 0xb06: 0x6011, + // Block 0x2d, offset 0xb40 + 0xb5b: 0x4000, 0xb5c: 0x4000, + // Block 0x2e, offset 0xb80 + 0xb90: 0x4000, + 0xb95: 0x4000, 0xb96: 0x2000, 0xb97: 0x2000, + 0xb98: 0x2000, 0xb99: 0x2000, + // Block 0x2f, offset 0xbc0 + 0xbc0: 0x4000, 0xbc1: 0x4000, 0xbc2: 0x4000, 0xbc3: 0x4000, 0xbc4: 0x4000, 0xbc5: 0x4000, + 0xbc6: 0x4000, 0xbc7: 0x4000, 0xbc8: 0x4000, 0xbc9: 0x4000, 0xbca: 0x4000, 0xbcb: 0x4000, + 0xbcc: 0x4000, 0xbcd: 0x4000, 0xbce: 0x4000, 0xbcf: 0x4000, 0xbd0: 0x4000, 0xbd1: 0x4000, + 0xbd2: 0x4000, 0xbd3: 0x4000, 0xbd4: 0x4000, 0xbd5: 0x4000, 0xbd6: 0x4000, 0xbd7: 0x4000, + 0xbd8: 0x4000, 0xbd9: 0x4000, 0xbdb: 0x4000, 0xbdc: 0x4000, 0xbdd: 0x4000, + 0xbde: 0x4000, 0xbdf: 0x4000, 0xbe0: 0x4000, 0xbe1: 0x4000, 0xbe2: 0x4000, 0xbe3: 0x4000, + 0xbe4: 0x4000, 0xbe5: 0x4000, 0xbe6: 0x4000, 0xbe7: 0x4000, 0xbe8: 0x4000, 0xbe9: 0x4000, + 0xbea: 0x4000, 0xbeb: 0x4000, 0xbec: 0x4000, 0xbed: 0x4000, 0xbee: 0x4000, 0xbef: 0x4000, + 0xbf0: 0x4000, 0xbf1: 0x4000, 0xbf2: 0x4000, 0xbf3: 0x4000, 0xbf4: 0x4000, 0xbf5: 0x4000, + 0xbf6: 0x4000, 0xbf7: 0x4000, 0xbf8: 0x4000, 0xbf9: 0x4000, 0xbfa: 0x4000, 0xbfb: 0x4000, + 0xbfc: 0x4000, 0xbfd: 0x4000, 0xbfe: 0x4000, 0xbff: 0x4000, + // Block 0x30, offset 0xc00 + 0xc00: 0x4000, 0xc01: 0x4000, 0xc02: 0x4000, 0xc03: 0x4000, 0xc04: 0x4000, 0xc05: 0x4000, + 0xc06: 0x4000, 0xc07: 0x4000, 0xc08: 0x4000, 0xc09: 0x4000, 0xc0a: 0x4000, 0xc0b: 0x4000, + 0xc0c: 0x4000, 0xc0d: 0x4000, 0xc0e: 0x4000, 0xc0f: 0x4000, 0xc10: 0x4000, 0xc11: 0x4000, + 0xc12: 0x4000, 0xc13: 0x4000, 0xc14: 0x4000, 0xc15: 0x4000, 0xc16: 0x4000, 0xc17: 0x4000, + 0xc18: 0x4000, 0xc19: 0x4000, 0xc1a: 0x4000, 0xc1b: 0x4000, 0xc1c: 0x4000, 0xc1d: 0x4000, + 0xc1e: 0x4000, 0xc1f: 0x4000, 0xc20: 0x4000, 0xc21: 0x4000, 0xc22: 0x4000, 0xc23: 0x4000, + 0xc24: 0x4000, 0xc25: 0x4000, 0xc26: 0x4000, 0xc27: 0x4000, 0xc28: 0x4000, 0xc29: 0x4000, + 0xc2a: 0x4000, 0xc2b: 0x4000, 0xc2c: 0x4000, 0xc2d: 0x4000, 0xc2e: 0x4000, 0xc2f: 0x4000, + 0xc30: 0x4000, 0xc31: 0x4000, 0xc32: 0x4000, 0xc33: 0x4000, + // Block 0x31, offset 0xc40 + 0xc40: 0x4000, 0xc41: 0x4000, 0xc42: 0x4000, 0xc43: 0x4000, 0xc44: 0x4000, 0xc45: 0x4000, + 0xc46: 0x4000, 0xc47: 0x4000, 0xc48: 0x4000, 0xc49: 0x4000, 0xc4a: 0x4000, 0xc4b: 0x4000, + 0xc4c: 0x4000, 0xc4d: 0x4000, 0xc4e: 0x4000, 0xc4f: 0x4000, 0xc50: 0x4000, 0xc51: 0x4000, + 0xc52: 0x4000, 0xc53: 0x4000, 0xc54: 0x4000, 0xc55: 0x4000, + 0xc70: 0x4000, 0xc71: 0x4000, 0xc72: 0x4000, 0xc73: 0x4000, 0xc74: 0x4000, 0xc75: 0x4000, + 0xc76: 0x4000, 0xc77: 0x4000, 0xc78: 0x4000, 0xc79: 0x4000, 0xc7a: 0x4000, 0xc7b: 0x4000, + // Block 0x32, offset 0xc80 + 0xc80: 0x9012, 0xc81: 0x4013, 0xc82: 0x4014, 0xc83: 0x4000, 0xc84: 0x4000, 0xc85: 0x4000, + 0xc86: 0x4000, 0xc87: 0x4000, 0xc88: 0x4000, 0xc89: 0x4000, 0xc8a: 0x4000, 0xc8b: 0x4000, + 0xc8c: 0x4015, 0xc8d: 0x4015, 0xc8e: 0x4000, 0xc8f: 0x4000, 0xc90: 0x4000, 0xc91: 0x4000, + 0xc92: 0x4000, 0xc93: 0x4000, 0xc94: 0x4000, 0xc95: 0x4000, 0xc96: 0x4000, 0xc97: 0x4000, + 0xc98: 0x4000, 0xc99: 0x4000, 0xc9a: 0x4000, 0xc9b: 0x4000, 0xc9c: 0x4000, 0xc9d: 0x4000, + 0xc9e: 0x4000, 0xc9f: 0x4000, 0xca0: 0x4000, 0xca1: 0x4000, 0xca2: 0x4000, 0xca3: 0x4000, + 0xca4: 0x4000, 0xca5: 0x4000, 0xca6: 0x4000, 0xca7: 0x4000, 0xca8: 0x4000, 0xca9: 0x4000, + 0xcaa: 0x4000, 0xcab: 0x4000, 0xcac: 0x4000, 0xcad: 0x4000, 0xcae: 0x4000, 0xcaf: 0x4000, + 0xcb0: 0x4000, 0xcb1: 0x4000, 0xcb2: 0x4000, 0xcb3: 0x4000, 0xcb4: 0x4000, 0xcb5: 0x4000, + 0xcb6: 0x4000, 0xcb7: 0x4000, 0xcb8: 0x4000, 0xcb9: 0x4000, 0xcba: 0x4000, 0xcbb: 0x4000, + 0xcbc: 0x4000, 0xcbd: 0x4000, 0xcbe: 0x4000, + // Block 0x33, offset 0xcc0 + 0xcc1: 0x4000, 0xcc2: 0x4000, 0xcc3: 0x4000, 0xcc4: 0x4000, 0xcc5: 0x4000, + 0xcc6: 0x4000, 0xcc7: 0x4000, 0xcc8: 0x4000, 0xcc9: 0x4000, 0xcca: 0x4000, 0xccb: 0x4000, + 0xccc: 0x4000, 0xccd: 0x4000, 0xcce: 0x4000, 0xccf: 0x4000, 0xcd0: 0x4000, 0xcd1: 0x4000, + 0xcd2: 0x4000, 0xcd3: 0x4000, 0xcd4: 0x4000, 0xcd5: 0x4000, 0xcd6: 0x4000, 0xcd7: 0x4000, + 0xcd8: 0x4000, 0xcd9: 0x4000, 0xcda: 0x4000, 0xcdb: 0x4000, 0xcdc: 0x4000, 0xcdd: 0x4000, + 0xcde: 0x4000, 0xcdf: 0x4000, 0xce0: 0x4000, 0xce1: 0x4000, 0xce2: 0x4000, 0xce3: 0x4000, + 0xce4: 0x4000, 0xce5: 0x4000, 0xce6: 0x4000, 0xce7: 0x4000, 0xce8: 0x4000, 0xce9: 0x4000, + 0xcea: 0x4000, 0xceb: 0x4000, 0xcec: 0x4000, 0xced: 0x4000, 0xcee: 0x4000, 0xcef: 0x4000, + 0xcf0: 0x4000, 0xcf1: 0x4000, 0xcf2: 0x4000, 0xcf3: 0x4000, 0xcf4: 0x4000, 0xcf5: 0x4000, + 0xcf6: 0x4000, 0xcf7: 0x4000, 0xcf8: 0x4000, 0xcf9: 0x4000, 0xcfa: 0x4000, 0xcfb: 0x4000, + 0xcfc: 0x4000, 0xcfd: 0x4000, 0xcfe: 0x4000, 0xcff: 0x4000, + // Block 0x34, offset 0xd00 + 0xd00: 0x4000, 0xd01: 0x4000, 0xd02: 0x4000, 0xd03: 0x4000, 0xd04: 0x4000, 0xd05: 0x4000, + 0xd06: 0x4000, 0xd07: 0x4000, 0xd08: 0x4000, 0xd09: 0x4000, 0xd0a: 0x4000, 0xd0b: 0x4000, + 0xd0c: 0x4000, 0xd0d: 0x4000, 0xd0e: 0x4000, 0xd0f: 0x4000, 0xd10: 0x4000, 0xd11: 0x4000, + 0xd12: 0x4000, 0xd13: 0x4000, 0xd14: 0x4000, 0xd15: 0x4000, 0xd16: 0x4000, + 0xd19: 0x4016, 0xd1a: 0x4017, 0xd1b: 0x4000, 0xd1c: 0x4000, 0xd1d: 0x4000, + 0xd1e: 0x4000, 0xd1f: 0x4000, 0xd20: 0x4000, 0xd21: 0x4018, 0xd22: 0x4019, 0xd23: 0x401a, + 0xd24: 0x401b, 0xd25: 0x401c, 0xd26: 0x401d, 0xd27: 0x401e, 0xd28: 0x401f, 0xd29: 0x4020, + 0xd2a: 0x4021, 0xd2b: 0x4022, 0xd2c: 0x4000, 0xd2d: 0x4010, 0xd2e: 0x4000, 0xd2f: 0x4023, + 0xd30: 0x4000, 0xd31: 0x4024, 0xd32: 0x4000, 0xd33: 0x4025, 0xd34: 0x4000, 0xd35: 0x4026, + 0xd36: 0x4000, 0xd37: 0x401a, 0xd38: 0x4000, 0xd39: 0x4027, 0xd3a: 0x4000, 0xd3b: 0x4028, + 0xd3c: 0x4000, 0xd3d: 0x4020, 0xd3e: 0x4000, 0xd3f: 0x4029, + // Block 0x35, offset 0xd40 + 0xd40: 0x4000, 0xd41: 0x402a, 0xd42: 0x4000, 0xd43: 0x402b, 0xd44: 0x402c, 0xd45: 0x4000, + 0xd46: 0x4017, 0xd47: 0x4000, 0xd48: 0x402d, 0xd49: 0x4000, 0xd4a: 0x402e, 0xd4b: 0x402f, + 0xd4c: 0x4030, 0xd4d: 0x4017, 0xd4e: 0x4016, 0xd4f: 0x4017, 0xd50: 0x4000, 0xd51: 0x4000, + 0xd52: 0x4031, 0xd53: 0x4000, 0xd54: 0x4000, 0xd55: 0x4031, 0xd56: 0x4000, 0xd57: 0x4000, + 0xd58: 0x4032, 0xd59: 0x4000, 0xd5a: 0x4000, 0xd5b: 0x4032, 0xd5c: 0x4000, 0xd5d: 0x4000, + 0xd5e: 0x4033, 0xd5f: 0x402e, 0xd60: 0x4034, 0xd61: 0x4035, 0xd62: 0x4034, 0xd63: 0x4036, + 0xd64: 0x4037, 0xd65: 0x4024, 0xd66: 0x4035, 0xd67: 0x4025, 0xd68: 0x4038, 0xd69: 0x4038, + 0xd6a: 0x4039, 0xd6b: 0x4039, 0xd6c: 0x403a, 0xd6d: 0x403a, 0xd6e: 0x4000, 0xd6f: 0x4035, + 0xd70: 0x4000, 0xd71: 0x4000, 0xd72: 0x403b, 0xd73: 0x403c, 0xd74: 0x4000, 0xd75: 0x4000, + 0xd76: 0x4000, 0xd77: 0x4000, 0xd78: 0x4000, 0xd79: 0x4000, 0xd7a: 0x4000, 0xd7b: 0x403d, + 0xd7c: 0x401c, 0xd7d: 0x4000, 0xd7e: 0x4000, 0xd7f: 0x4000, + // Block 0x36, offset 0xd80 + 0xd85: 0x4000, + 0xd86: 0x4000, 0xd87: 0x4000, 0xd88: 0x4000, 0xd89: 0x4000, 0xd8a: 0x4000, 0xd8b: 0x4000, + 0xd8c: 0x4000, 0xd8d: 0x4000, 0xd8e: 0x4000, 0xd8f: 0x4000, 0xd90: 0x4000, 0xd91: 0x4000, + 0xd92: 0x4000, 0xd93: 0x4000, 0xd94: 0x4000, 0xd95: 0x4000, 0xd96: 0x4000, 0xd97: 0x4000, + 0xd98: 0x4000, 0xd99: 0x4000, 0xd9a: 0x4000, 0xd9b: 0x4000, 0xd9c: 0x4000, 0xd9d: 0x4000, + 0xd9e: 0x4000, 0xd9f: 0x4000, 0xda0: 0x4000, 0xda1: 0x4000, 0xda2: 0x4000, 0xda3: 0x4000, + 0xda4: 0x4000, 0xda5: 0x4000, 0xda6: 0x4000, 0xda7: 0x4000, 0xda8: 0x4000, 0xda9: 0x4000, + 0xdaa: 0x4000, 0xdab: 0x4000, 0xdac: 0x4000, 0xdad: 0x4000, 0xdae: 0x4000, 0xdaf: 0x4000, + 0xdb1: 0x403e, 0xdb2: 0x403e, 0xdb3: 0x403e, 0xdb4: 0x403e, 0xdb5: 0x403e, + 0xdb6: 0x403e, 0xdb7: 0x403e, 0xdb8: 0x403e, 0xdb9: 0x403e, 0xdba: 0x403e, 0xdbb: 0x403e, + 0xdbc: 0x403e, 0xdbd: 0x403e, 0xdbe: 0x403e, 0xdbf: 0x403e, + // Block 0x37, offset 0xdc0 + 0xdc0: 0x4037, 0xdc1: 0x4037, 0xdc2: 0x4037, 0xdc3: 0x4037, 0xdc4: 0x4037, 0xdc5: 0x4037, + 0xdc6: 0x4037, 0xdc7: 0x4037, 0xdc8: 0x4037, 0xdc9: 0x4037, 0xdca: 0x4037, 0xdcb: 0x4037, + 0xdcc: 0x4037, 0xdcd: 0x4037, 0xdce: 0x4037, 0xdcf: 0x400e, 0xdd0: 0x403f, 0xdd1: 0x4040, + 0xdd2: 0x4041, 0xdd3: 0x4040, 0xdd4: 0x403f, 0xdd5: 0x4042, 0xdd6: 0x4043, 0xdd7: 0x4044, + 0xdd8: 0x4040, 0xdd9: 0x4041, 0xdda: 0x4040, 0xddb: 0x4045, 0xddc: 0x4009, 0xddd: 0x4045, + 0xdde: 0x4046, 0xddf: 0x4045, 0xde0: 0x4047, 0xde1: 0x400b, 0xde2: 0x400a, 0xde3: 0x400c, + 0xde4: 0x4048, 0xde5: 0x4000, 0xde6: 0x4000, 0xde7: 0x4000, 0xde8: 0x4000, 0xde9: 0x4000, + 0xdea: 0x4000, 0xdeb: 0x4000, 0xdec: 0x4000, 0xded: 0x4000, 0xdee: 0x4000, 0xdef: 0x4000, + 0xdf0: 0x4000, 0xdf1: 0x4000, 0xdf2: 0x4000, 0xdf3: 0x4000, 0xdf4: 0x4000, 0xdf5: 0x4000, + 0xdf6: 0x4000, 0xdf7: 0x4000, 0xdf8: 0x4000, 0xdf9: 0x4000, 0xdfa: 0x4000, 0xdfb: 0x4000, + 0xdfc: 0x4000, 0xdfd: 0x4000, 0xdfe: 0x4000, 0xdff: 0x4000, + // Block 0x38, offset 0xe00 + 0xe00: 0x4000, 0xe01: 0x4000, 0xe02: 0x4000, 0xe03: 0x4000, 0xe04: 0x4000, 0xe05: 0x4000, + 0xe06: 0x4000, 0xe07: 0x4000, 0xe08: 0x4000, 0xe09: 0x4000, 0xe0a: 0x4000, 0xe0b: 0x4000, + 0xe0c: 0x4000, 0xe0d: 0x4000, 0xe0e: 0x4000, 0xe10: 0x4000, 0xe11: 0x4000, + 0xe12: 0x4000, 0xe13: 0x4000, 0xe14: 0x4000, 0xe15: 0x4000, 0xe16: 0x4000, 0xe17: 0x4000, + 0xe18: 0x4000, 0xe19: 0x4000, 0xe1a: 0x4000, 0xe1b: 0x4000, 0xe1c: 0x4000, 0xe1d: 0x4000, + 0xe1e: 0x4000, 0xe1f: 0x4000, 0xe20: 0x4000, 0xe21: 0x4000, 0xe22: 0x4000, 0xe23: 0x4000, + 0xe24: 0x4000, 0xe25: 0x4000, 0xe26: 0x4000, 0xe27: 0x4000, 0xe28: 0x4000, 0xe29: 0x4000, + 0xe2a: 0x4000, 0xe2b: 0x4000, 0xe2c: 0x4000, 0xe2d: 0x4000, 0xe2e: 0x4000, 0xe2f: 0x4000, + 0xe30: 0x4000, 0xe31: 0x4000, 0xe32: 0x4000, 0xe33: 0x4000, 0xe34: 0x4000, 0xe35: 0x4000, + 0xe36: 0x4000, 0xe37: 0x4000, 0xe38: 0x4000, 0xe39: 0x4000, 0xe3a: 0x4000, 0xe3b: 0x4000, + 0xe3c: 0x4000, 0xe3d: 0x4000, 0xe3e: 0x4000, 0xe3f: 0x4000, + // Block 0x39, offset 0xe40 + 0xe40: 0x4000, 0xe41: 0x4000, 0xe42: 0x4000, 0xe43: 0x4000, 0xe44: 0x4000, 0xe45: 0x4000, + 0xe46: 0x4000, 0xe47: 0x4000, 0xe48: 0x4000, 0xe49: 0x4000, 0xe4a: 0x4000, 0xe4b: 0x4000, + 0xe4c: 0x4000, 0xe4d: 0x4000, 0xe4e: 0x4000, 0xe4f: 0x4000, 0xe50: 0x4000, 0xe51: 0x4000, + 0xe52: 0x4000, 0xe53: 0x4000, 0xe54: 0x4000, 0xe55: 0x4000, 0xe56: 0x4000, 0xe57: 0x4000, + 0xe58: 0x4000, 0xe59: 0x4000, 0xe5a: 0x4000, 0xe5b: 0x4000, 0xe5c: 0x4000, 0xe5d: 0x4000, + 0xe5e: 0x4000, 0xe5f: 0x4000, 0xe60: 0x4000, 0xe61: 0x4000, 0xe62: 0x4000, 0xe63: 0x4000, + 0xe70: 0x4000, 0xe71: 0x4000, 0xe72: 0x4000, 0xe73: 0x4000, 0xe74: 0x4000, 0xe75: 0x4000, + 0xe76: 0x4000, 0xe77: 0x4000, 0xe78: 0x4000, 0xe79: 0x4000, 0xe7a: 0x4000, 0xe7b: 0x4000, + 0xe7c: 0x4000, 0xe7d: 0x4000, 0xe7e: 0x4000, 0xe7f: 0x4000, + // Block 0x3a, offset 0xe80 + 0xe80: 0x4000, 0xe81: 0x4000, 0xe82: 0x4000, 0xe83: 0x4000, 0xe84: 0x4000, 0xe85: 0x4000, + 0xe86: 0x4000, 0xe87: 0x4000, 0xe88: 0x4000, 0xe89: 0x4000, 0xe8a: 0x4000, 0xe8b: 0x4000, + 0xe8c: 0x4000, 0xe8d: 0x4000, 0xe8e: 0x4000, 0xe8f: 0x4000, 0xe90: 0x4000, 0xe91: 0x4000, + 0xe92: 0x4000, 0xe93: 0x4000, 0xe94: 0x4000, 0xe95: 0x4000, 0xe96: 0x4000, 0xe97: 0x4000, + 0xe98: 0x4000, 0xe99: 0x4000, 0xe9a: 0x4000, 0xe9b: 0x4000, 0xe9c: 0x4000, 0xe9d: 0x4000, + 0xe9e: 0x4000, 0xea0: 0x4000, 0xea1: 0x4000, 0xea2: 0x4000, 0xea3: 0x4000, + 0xea4: 0x4000, 0xea5: 0x4000, 0xea6: 0x4000, 0xea7: 0x4000, 0xea8: 0x4000, 0xea9: 0x4000, + 0xeaa: 0x4000, 0xeab: 0x4000, 0xeac: 0x4000, 0xead: 0x4000, 0xeae: 0x4000, 0xeaf: 0x4000, + 0xeb0: 0x4000, 0xeb1: 0x4000, 0xeb2: 0x4000, 0xeb3: 0x4000, 0xeb4: 0x4000, 0xeb5: 0x4000, + 0xeb6: 0x4000, 0xeb7: 0x4000, 0xeb8: 0x4000, 0xeb9: 0x4000, 0xeba: 0x4000, 0xebb: 0x4000, + 0xebc: 0x4000, 0xebd: 0x4000, 0xebe: 0x4000, 0xebf: 0x4000, + // Block 0x3b, offset 0xec0 + 0xec0: 0x4000, 0xec1: 0x4000, 0xec2: 0x4000, 0xec3: 0x4000, 0xec4: 0x4000, 0xec5: 0x4000, + 0xec6: 0x4000, 0xec7: 0x4000, 0xec8: 0x2000, 0xec9: 0x2000, 0xeca: 0x2000, 0xecb: 0x2000, + 0xecc: 0x2000, 0xecd: 0x2000, 0xece: 0x2000, 0xecf: 0x2000, 0xed0: 0x4000, 0xed1: 0x4000, + 0xed2: 0x4000, 0xed3: 0x4000, 0xed4: 0x4000, 0xed5: 0x4000, 0xed6: 0x4000, 0xed7: 0x4000, + 0xed8: 0x4000, 0xed9: 0x4000, 0xeda: 0x4000, 0xedb: 0x4000, 0xedc: 0x4000, 0xedd: 0x4000, + 0xede: 0x4000, 0xedf: 0x4000, 0xee0: 0x4000, 0xee1: 0x4000, 0xee2: 0x4000, 0xee3: 0x4000, + 0xee4: 0x4000, 0xee5: 0x4000, 0xee6: 0x4000, 0xee7: 0x4000, 0xee8: 0x4000, 0xee9: 0x4000, + 0xeea: 0x4000, 0xeeb: 0x4000, 0xeec: 0x4000, 0xeed: 0x4000, 0xeee: 0x4000, 0xeef: 0x4000, + 0xef0: 0x4000, 0xef1: 0x4000, 0xef2: 0x4000, 0xef3: 0x4000, 0xef4: 0x4000, 0xef5: 0x4000, + 0xef6: 0x4000, 0xef7: 0x4000, 0xef8: 0x4000, 0xef9: 0x4000, 0xefa: 0x4000, 0xefb: 0x4000, + 0xefc: 0x4000, 0xefd: 0x4000, 0xefe: 0x4000, 0xeff: 0x4000, + // Block 0x3c, offset 0xf00 + 0xf00: 0x4000, 0xf01: 0x4000, 0xf02: 0x4000, 0xf03: 0x4000, 0xf04: 0x4000, 0xf05: 0x4000, + 0xf06: 0x4000, 0xf07: 0x4000, 0xf08: 0x4000, 0xf09: 0x4000, 0xf0a: 0x4000, 0xf0b: 0x4000, + 0xf0c: 0x4000, 0xf10: 0x4000, 0xf11: 0x4000, + 0xf12: 0x4000, 0xf13: 0x4000, 0xf14: 0x4000, 0xf15: 0x4000, 0xf16: 0x4000, 0xf17: 0x4000, + 0xf18: 0x4000, 0xf19: 0x4000, 0xf1a: 0x4000, 0xf1b: 0x4000, 0xf1c: 0x4000, 0xf1d: 0x4000, + 0xf1e: 0x4000, 0xf1f: 0x4000, 0xf20: 0x4000, 0xf21: 0x4000, 0xf22: 0x4000, 0xf23: 0x4000, + 0xf24: 0x4000, 0xf25: 0x4000, 0xf26: 0x4000, 0xf27: 0x4000, 0xf28: 0x4000, 0xf29: 0x4000, + 0xf2a: 0x4000, 0xf2b: 0x4000, 0xf2c: 0x4000, 0xf2d: 0x4000, 0xf2e: 0x4000, 0xf2f: 0x4000, + 0xf30: 0x4000, 0xf31: 0x4000, 0xf32: 0x4000, 0xf33: 0x4000, 0xf34: 0x4000, 0xf35: 0x4000, + 0xf36: 0x4000, 0xf37: 0x4000, 0xf38: 0x4000, 0xf39: 0x4000, 0xf3a: 0x4000, 0xf3b: 0x4000, + 0xf3c: 0x4000, 0xf3d: 0x4000, 0xf3e: 0x4000, 0xf3f: 0x4000, + // Block 0x3d, offset 0xf40 + 0xf40: 0x4000, 0xf41: 0x4000, 0xf42: 0x4000, 0xf43: 0x4000, 0xf44: 0x4000, 0xf45: 0x4000, + 0xf46: 0x4000, + // Block 0x3e, offset 0xf80 + 0xfa0: 0x4000, 0xfa1: 0x4000, 0xfa2: 0x4000, 0xfa3: 0x4000, + 0xfa4: 0x4000, 0xfa5: 0x4000, 0xfa6: 0x4000, 0xfa7: 0x4000, 0xfa8: 0x4000, 0xfa9: 0x4000, + 0xfaa: 0x4000, 0xfab: 0x4000, 0xfac: 0x4000, 0xfad: 0x4000, 0xfae: 0x4000, 0xfaf: 0x4000, + 0xfb0: 0x4000, 0xfb1: 0x4000, 0xfb2: 0x4000, 0xfb3: 0x4000, 0xfb4: 0x4000, 0xfb5: 0x4000, + 0xfb6: 0x4000, 0xfb7: 0x4000, 0xfb8: 0x4000, 0xfb9: 0x4000, 0xfba: 0x4000, 0xfbb: 0x4000, + 0xfbc: 0x4000, + // Block 0x3f, offset 0xfc0 + 0xfc0: 0x4000, 0xfc1: 0x4000, 0xfc2: 0x4000, 0xfc3: 0x4000, 0xfc4: 0x4000, 0xfc5: 0x4000, + 0xfc6: 0x4000, 0xfc7: 0x4000, 0xfc8: 0x4000, 0xfc9: 0x4000, 0xfca: 0x4000, 0xfcb: 0x4000, + 0xfcc: 0x4000, 0xfcd: 0x4000, 0xfce: 0x4000, 0xfcf: 0x4000, 0xfd0: 0x4000, 0xfd1: 0x4000, + 0xfd2: 0x4000, 0xfd3: 0x4000, 0xfd4: 0x4000, 0xfd5: 0x4000, 0xfd6: 0x4000, 0xfd7: 0x4000, + 0xfd8: 0x4000, 0xfd9: 0x4000, 0xfda: 0x4000, 0xfdb: 0x4000, 0xfdc: 0x4000, 0xfdd: 0x4000, + 0xfde: 0x4000, 0xfdf: 0x4000, 0xfe0: 0x4000, 0xfe1: 0x4000, 0xfe2: 0x4000, 0xfe3: 0x4000, + // Block 0x40, offset 0x1000 + 0x1000: 0x2000, 0x1001: 0x2000, 0x1002: 0x2000, 0x1003: 0x2000, 0x1004: 0x2000, 0x1005: 0x2000, + 0x1006: 0x2000, 0x1007: 0x2000, 0x1008: 0x2000, 0x1009: 0x2000, 0x100a: 0x2000, 0x100b: 0x2000, + 0x100c: 0x2000, 0x100d: 0x2000, 0x100e: 0x2000, 0x100f: 0x2000, 0x1010: 0x4000, 0x1011: 0x4000, + 0x1012: 0x4000, 0x1013: 0x4000, 0x1014: 0x4000, 0x1015: 0x4000, 0x1016: 0x4000, 0x1017: 0x4000, + 0x1018: 0x4000, 0x1019: 0x4000, + 0x1030: 0x4000, 0x1031: 0x4000, 0x1032: 0x4000, 0x1033: 0x4000, 0x1034: 0x4000, 0x1035: 0x4000, + 0x1036: 0x4000, 0x1037: 0x4000, 0x1038: 0x4000, 0x1039: 0x4000, 0x103a: 0x4000, 0x103b: 0x4000, + 0x103c: 0x4000, 0x103d: 0x4000, 0x103e: 0x4000, 0x103f: 0x4000, + // Block 0x41, offset 0x1040 + 0x1040: 0x4000, 0x1041: 0x4000, 0x1042: 0x4000, 0x1043: 0x4000, 0x1044: 0x4000, 0x1045: 0x4000, + 0x1046: 0x4000, 0x1047: 0x4000, 0x1048: 0x4000, 0x1049: 0x4000, 0x104a: 0x4000, 0x104b: 0x4000, + 0x104c: 0x4000, 0x104d: 0x4000, 0x104e: 0x4000, 0x104f: 0x4000, 0x1050: 0x4000, 0x1051: 0x4000, + 0x1052: 0x4000, 0x1054: 0x4000, 0x1055: 0x4000, 0x1056: 0x4000, 0x1057: 0x4000, + 0x1058: 0x4000, 0x1059: 0x4000, 0x105a: 0x4000, 0x105b: 0x4000, 0x105c: 0x4000, 0x105d: 0x4000, + 0x105e: 0x4000, 0x105f: 0x4000, 0x1060: 0x4000, 0x1061: 0x4000, 0x1062: 0x4000, 0x1063: 0x4000, + 0x1064: 0x4000, 0x1065: 0x4000, 0x1066: 0x4000, 0x1068: 0x4000, 0x1069: 0x4000, + 0x106a: 0x4000, 0x106b: 0x4000, + // Block 0x42, offset 0x1080 + 0x1081: 0x9012, 0x1082: 0x9012, 0x1083: 0x9012, 0x1084: 0x9012, 0x1085: 0x9012, + 0x1086: 0x9012, 0x1087: 0x9012, 0x1088: 0x9012, 0x1089: 0x9012, 0x108a: 0x9012, 0x108b: 0x9012, + 0x108c: 0x9012, 0x108d: 0x9012, 0x108e: 0x9012, 0x108f: 0x9012, 0x1090: 0x9012, 0x1091: 0x9012, + 0x1092: 0x9012, 0x1093: 0x9012, 0x1094: 0x9012, 0x1095: 0x9012, 0x1096: 0x9012, 0x1097: 0x9012, + 0x1098: 0x9012, 0x1099: 0x9012, 0x109a: 0x9012, 0x109b: 0x9012, 0x109c: 0x9012, 0x109d: 0x9012, + 0x109e: 0x9012, 0x109f: 0x9012, 0x10a0: 0x9049, 0x10a1: 0x9049, 0x10a2: 0x9049, 0x10a3: 0x9049, + 0x10a4: 0x9049, 0x10a5: 0x9049, 0x10a6: 0x9049, 0x10a7: 0x9049, 0x10a8: 0x9049, 0x10a9: 0x9049, + 0x10aa: 0x9049, 0x10ab: 0x9049, 0x10ac: 0x9049, 0x10ad: 0x9049, 0x10ae: 0x9049, 0x10af: 0x9049, + 0x10b0: 0x9049, 0x10b1: 0x9049, 0x10b2: 0x9049, 0x10b3: 0x9049, 0x10b4: 0x9049, 0x10b5: 0x9049, + 0x10b6: 0x9049, 0x10b7: 0x9049, 0x10b8: 0x9049, 0x10b9: 0x9049, 0x10ba: 0x9049, 0x10bb: 0x9049, + 0x10bc: 0x9049, 0x10bd: 0x9049, 0x10be: 0x9049, 0x10bf: 0x9049, + // Block 0x43, offset 0x10c0 + 0x10c0: 0x9049, 0x10c1: 0x9049, 0x10c2: 0x9049, 0x10c3: 0x9049, 0x10c4: 0x9049, 0x10c5: 0x9049, + 0x10c6: 0x9049, 0x10c7: 0x9049, 0x10c8: 0x9049, 0x10c9: 0x9049, 0x10ca: 0x9049, 0x10cb: 0x9049, + 0x10cc: 0x9049, 0x10cd: 0x9049, 0x10ce: 0x9049, 0x10cf: 0x9049, 0x10d0: 0x9049, 0x10d1: 0x9049, + 0x10d2: 0x9049, 0x10d3: 0x9049, 0x10d4: 0x9049, 0x10d5: 0x9049, 0x10d6: 0x9049, 0x10d7: 0x9049, + 0x10d8: 0x9049, 0x10d9: 0x9049, 0x10da: 0x9049, 0x10db: 0x9049, 0x10dc: 0x9049, 0x10dd: 0x9049, + 0x10de: 0x9049, 0x10df: 0x904a, 0x10e0: 0x904b, 0x10e1: 0xb04c, 0x10e2: 0xb04d, 0x10e3: 0xb04d, + 0x10e4: 0xb04e, 0x10e5: 0xb04f, 0x10e6: 0xb050, 0x10e7: 0xb051, 0x10e8: 0xb052, 0x10e9: 0xb053, + 0x10ea: 0xb054, 0x10eb: 0xb055, 0x10ec: 0xb056, 0x10ed: 0xb057, 0x10ee: 0xb058, 0x10ef: 0xb059, + 0x10f0: 0xb05a, 0x10f1: 0xb05b, 0x10f2: 0xb05c, 0x10f3: 0xb05d, 0x10f4: 0xb05e, 0x10f5: 0xb05f, + 0x10f6: 0xb060, 0x10f7: 0xb061, 0x10f8: 0xb062, 0x10f9: 0xb063, 0x10fa: 0xb064, 0x10fb: 0xb065, + 0x10fc: 0xb052, 0x10fd: 0xb066, 0x10fe: 0xb067, 0x10ff: 0xb055, + // Block 0x44, offset 0x1100 + 0x1100: 0xb068, 0x1101: 0xb069, 0x1102: 0xb06a, 0x1103: 0xb06b, 0x1104: 0xb05a, 0x1105: 0xb056, + 0x1106: 0xb06c, 0x1107: 0xb06d, 0x1108: 0xb06b, 0x1109: 0xb06e, 0x110a: 0xb06b, 0x110b: 0xb06f, + 0x110c: 0xb06f, 0x110d: 0xb070, 0x110e: 0xb070, 0x110f: 0xb071, 0x1110: 0xb056, 0x1111: 0xb072, + 0x1112: 0xb073, 0x1113: 0xb072, 0x1114: 0xb074, 0x1115: 0xb073, 0x1116: 0xb075, 0x1117: 0xb075, + 0x1118: 0xb076, 0x1119: 0xb076, 0x111a: 0xb077, 0x111b: 0xb077, 0x111c: 0xb073, 0x111d: 0xb078, + 0x111e: 0xb079, 0x111f: 0xb067, 0x1120: 0xb07a, 0x1121: 0xb07b, 0x1122: 0xb07b, 0x1123: 0xb07b, + 0x1124: 0xb07b, 0x1125: 0xb07b, 0x1126: 0xb07b, 0x1127: 0xb07b, 0x1128: 0xb07b, 0x1129: 0xb07b, + 0x112a: 0xb07b, 0x112b: 0xb07b, 0x112c: 0xb07b, 0x112d: 0xb07b, 0x112e: 0xb07b, 0x112f: 0xb07b, + 0x1130: 0xb07c, 0x1131: 0xb07c, 0x1132: 0xb07c, 0x1133: 0xb07c, 0x1134: 0xb07c, 0x1135: 0xb07c, + 0x1136: 0xb07c, 0x1137: 0xb07c, 0x1138: 0xb07c, 0x1139: 0xb07c, 0x113a: 0xb07c, 0x113b: 0xb07c, + 0x113c: 0xb07c, 0x113d: 0xb07c, 0x113e: 0xb07c, + // Block 0x45, offset 0x1140 + 0x1142: 0xb07d, 0x1143: 0xb07e, 0x1144: 0xb07f, 0x1145: 0xb080, + 0x1146: 0xb07f, 0x1147: 0xb07e, 0x114a: 0xb081, 0x114b: 0xb082, + 0x114c: 0xb083, 0x114d: 0xb07f, 0x114e: 0xb080, 0x114f: 0xb07f, + 0x1152: 0xb084, 0x1153: 0xb085, 0x1154: 0xb084, 0x1155: 0xb086, 0x1156: 0xb084, 0x1157: 0xb087, + 0x115a: 0xb088, 0x115b: 0xb089, 0x115c: 0xb08a, + 0x1160: 0x908b, 0x1161: 0x908b, 0x1162: 0x908c, 0x1163: 0x908d, + 0x1164: 0x908b, 0x1165: 0x908e, 0x1166: 0x908f, 0x1168: 0xb090, 0x1169: 0xb091, + 0x116a: 0xb092, 0x116b: 0xb091, 0x116c: 0xb093, 0x116d: 0xb094, 0x116e: 0xb095, + 0x117d: 0x2000, + // Block 0x46, offset 0x1180 + 0x11a0: 0x4000, 0x11a1: 0x4000, 0x11a2: 0x4000, 0x11a3: 0x4000, + 0x11a4: 0x4000, + 0x11b0: 0x4000, 0x11b1: 0x4000, + // Block 0x47, offset 0x11c0 + 0x11c0: 0x4000, 0x11c1: 0x4000, 0x11c2: 0x4000, 0x11c3: 0x4000, 0x11c4: 0x4000, 0x11c5: 0x4000, + 0x11c6: 0x4000, 0x11c7: 0x4000, 0x11c8: 0x4000, 0x11c9: 0x4000, 0x11ca: 0x4000, 0x11cb: 0x4000, + 0x11cc: 0x4000, 0x11cd: 0x4000, 0x11ce: 0x4000, 0x11cf: 0x4000, 0x11d0: 0x4000, 0x11d1: 0x4000, + 0x11d2: 0x4000, 0x11d3: 0x4000, 0x11d4: 0x4000, 0x11d5: 0x4000, 0x11d6: 0x4000, 0x11d7: 0x4000, + 0x11d8: 0x4000, 0x11d9: 0x4000, 0x11da: 0x4000, 0x11db: 0x4000, 0x11dc: 0x4000, 0x11dd: 0x4000, + 0x11de: 0x4000, 0x11df: 0x4000, 0x11e0: 0x4000, 0x11e1: 0x4000, 0x11e2: 0x4000, 0x11e3: 0x4000, + 0x11e4: 0x4000, 0x11e5: 0x4000, 0x11e6: 0x4000, 0x11e7: 0x4000, 0x11e8: 0x4000, 0x11e9: 0x4000, + 0x11ea: 0x4000, 0x11eb: 0x4000, 0x11ec: 0x4000, 0x11ed: 0x4000, 0x11ee: 0x4000, 0x11ef: 0x4000, + 0x11f0: 0x4000, 0x11f1: 0x4000, 0x11f2: 0x4000, 0x11f3: 0x4000, 0x11f4: 0x4000, 0x11f5: 0x4000, + 0x11f6: 0x4000, 0x11f7: 0x4000, + // Block 0x48, offset 0x1200 + 0x1200: 0x4000, 0x1201: 0x4000, 0x1202: 0x4000, 0x1203: 0x4000, 0x1204: 0x4000, 0x1205: 0x4000, + 0x1206: 0x4000, 0x1207: 0x4000, 0x1208: 0x4000, 0x1209: 0x4000, 0x120a: 0x4000, 0x120b: 0x4000, + 0x120c: 0x4000, 0x120d: 0x4000, 0x120e: 0x4000, 0x120f: 0x4000, 0x1210: 0x4000, 0x1211: 0x4000, + 0x1212: 0x4000, 0x1213: 0x4000, 0x1214: 0x4000, 0x1215: 0x4000, + // Block 0x49, offset 0x1240 + 0x1240: 0x4000, 0x1241: 0x4000, 0x1242: 0x4000, 0x1243: 0x4000, 0x1244: 0x4000, 0x1245: 0x4000, + 0x1246: 0x4000, 0x1247: 0x4000, 0x1248: 0x4000, + // Block 0x4a, offset 0x1280 + 0x12b0: 0x4000, 0x12b1: 0x4000, 0x12b2: 0x4000, 0x12b3: 0x4000, 0x12b5: 0x4000, + 0x12b6: 0x4000, 0x12b7: 0x4000, 0x12b8: 0x4000, 0x12b9: 0x4000, 0x12ba: 0x4000, 0x12bb: 0x4000, + 0x12bd: 0x4000, 0x12be: 0x4000, + // Block 0x4b, offset 0x12c0 + 0x12c0: 0x4000, 0x12c1: 0x4000, 0x12c2: 0x4000, 0x12c3: 0x4000, 0x12c4: 0x4000, 0x12c5: 0x4000, + 0x12c6: 0x4000, 0x12c7: 0x4000, 0x12c8: 0x4000, 0x12c9: 0x4000, 0x12ca: 0x4000, 0x12cb: 0x4000, + 0x12cc: 0x4000, 0x12cd: 0x4000, 0x12ce: 0x4000, 0x12cf: 0x4000, 0x12d0: 0x4000, 0x12d1: 0x4000, + 0x12d2: 0x4000, 0x12d3: 0x4000, 0x12d4: 0x4000, 0x12d5: 0x4000, 0x12d6: 0x4000, 0x12d7: 0x4000, + 0x12d8: 0x4000, 0x12d9: 0x4000, 0x12da: 0x4000, 0x12db: 0x4000, 0x12dc: 0x4000, 0x12dd: 0x4000, + 0x12de: 0x4000, 0x12df: 0x4000, 0x12e0: 0x4000, 0x12e1: 0x4000, 0x12e2: 0x4000, + 0x12f2: 0x4000, + // Block 0x4c, offset 0x1300 + 0x1310: 0x4000, 0x1311: 0x4000, + 0x1312: 0x4000, 0x1315: 0x4000, + 0x1324: 0x4000, 0x1325: 0x4000, 0x1326: 0x4000, 0x1327: 0x4000, + 0x1330: 0x4000, 0x1331: 0x4000, 0x1332: 0x4000, 0x1333: 0x4000, 0x1334: 0x4000, 0x1335: 0x4000, + 0x1336: 0x4000, 0x1337: 0x4000, 0x1338: 0x4000, 0x1339: 0x4000, 0x133a: 0x4000, 0x133b: 0x4000, + 0x133c: 0x4000, 0x133d: 0x4000, 0x133e: 0x4000, 0x133f: 0x4000, + // Block 0x4d, offset 0x1340 + 0x1340: 0x4000, 0x1341: 0x4000, 0x1342: 0x4000, 0x1343: 0x4000, 0x1344: 0x4000, 0x1345: 0x4000, + 0x1346: 0x4000, 0x1347: 0x4000, 0x1348: 0x4000, 0x1349: 0x4000, 0x134a: 0x4000, 0x134b: 0x4000, + 0x134c: 0x4000, 0x134d: 0x4000, 0x134e: 0x4000, 0x134f: 0x4000, 0x1350: 0x4000, 0x1351: 0x4000, + 0x1352: 0x4000, 0x1353: 0x4000, 0x1354: 0x4000, 0x1355: 0x4000, 0x1356: 0x4000, 0x1357: 0x4000, + 0x1358: 0x4000, 0x1359: 0x4000, 0x135a: 0x4000, 0x135b: 0x4000, 0x135c: 0x4000, 0x135d: 0x4000, + 0x135e: 0x4000, 0x135f: 0x4000, 0x1360: 0x4000, 0x1361: 0x4000, 0x1362: 0x4000, 0x1363: 0x4000, + 0x1364: 0x4000, 0x1365: 0x4000, 0x1366: 0x4000, 0x1367: 0x4000, 0x1368: 0x4000, 0x1369: 0x4000, + 0x136a: 0x4000, 0x136b: 0x4000, 0x136c: 0x4000, 0x136d: 0x4000, 0x136e: 0x4000, 0x136f: 0x4000, + 0x1370: 0x4000, 0x1371: 0x4000, 0x1372: 0x4000, 0x1373: 0x4000, 0x1374: 0x4000, 0x1375: 0x4000, + 0x1376: 0x4000, 0x1377: 0x4000, 0x1378: 0x4000, 0x1379: 0x4000, 0x137a: 0x4000, 0x137b: 0x4000, + // Block 0x4e, offset 0x1380 + 0x1384: 0x4000, + // Block 0x4f, offset 0x13c0 + 0x13cf: 0x4000, + // Block 0x50, offset 0x1400 + 0x1400: 0x2000, 0x1401: 0x2000, 0x1402: 0x2000, 0x1403: 0x2000, 0x1404: 0x2000, 0x1405: 0x2000, + 0x1406: 0x2000, 0x1407: 0x2000, 0x1408: 0x2000, 0x1409: 0x2000, 0x140a: 0x2000, + 0x1410: 0x2000, 0x1411: 0x2000, + 0x1412: 0x2000, 0x1413: 0x2000, 0x1414: 0x2000, 0x1415: 0x2000, 0x1416: 0x2000, 0x1417: 0x2000, + 0x1418: 0x2000, 0x1419: 0x2000, 0x141a: 0x2000, 0x141b: 0x2000, 0x141c: 0x2000, 0x141d: 0x2000, + 0x141e: 0x2000, 0x141f: 0x2000, 0x1420: 0x2000, 0x1421: 0x2000, 0x1422: 0x2000, 0x1423: 0x2000, + 0x1424: 0x2000, 0x1425: 0x2000, 0x1426: 0x2000, 0x1427: 0x2000, 0x1428: 0x2000, 0x1429: 0x2000, + 0x142a: 0x2000, 0x142b: 0x2000, 0x142c: 0x2000, 0x142d: 0x2000, + 0x1430: 0x2000, 0x1431: 0x2000, 0x1432: 0x2000, 0x1433: 0x2000, 0x1434: 0x2000, 0x1435: 0x2000, + 0x1436: 0x2000, 0x1437: 0x2000, 0x1438: 0x2000, 0x1439: 0x2000, 0x143a: 0x2000, 0x143b: 0x2000, + 0x143c: 0x2000, 0x143d: 0x2000, 0x143e: 0x2000, 0x143f: 0x2000, + // Block 0x51, offset 0x1440 + 0x1440: 0x2000, 0x1441: 0x2000, 0x1442: 0x2000, 0x1443: 0x2000, 0x1444: 0x2000, 0x1445: 0x2000, + 0x1446: 0x2000, 0x1447: 0x2000, 0x1448: 0x2000, 0x1449: 0x2000, 0x144a: 0x2000, 0x144b: 0x2000, + 0x144c: 0x2000, 0x144d: 0x2000, 0x144e: 0x2000, 0x144f: 0x2000, 0x1450: 0x2000, 0x1451: 0x2000, + 0x1452: 0x2000, 0x1453: 0x2000, 0x1454: 0x2000, 0x1455: 0x2000, 0x1456: 0x2000, 0x1457: 0x2000, + 0x1458: 0x2000, 0x1459: 0x2000, 0x145a: 0x2000, 0x145b: 0x2000, 0x145c: 0x2000, 0x145d: 0x2000, + 0x145e: 0x2000, 0x145f: 0x2000, 0x1460: 0x2000, 0x1461: 0x2000, 0x1462: 0x2000, 0x1463: 0x2000, + 0x1464: 0x2000, 0x1465: 0x2000, 0x1466: 0x2000, 0x1467: 0x2000, 0x1468: 0x2000, 0x1469: 0x2000, + 0x1470: 0x2000, 0x1471: 0x2000, 0x1472: 0x2000, 0x1473: 0x2000, 0x1474: 0x2000, 0x1475: 0x2000, + 0x1476: 0x2000, 0x1477: 0x2000, 0x1478: 0x2000, 0x1479: 0x2000, 0x147a: 0x2000, 0x147b: 0x2000, + 0x147c: 0x2000, 0x147d: 0x2000, 0x147e: 0x2000, 0x147f: 0x2000, + // Block 0x52, offset 0x1480 + 0x1480: 0x2000, 0x1481: 0x2000, 0x1482: 0x2000, 0x1483: 0x2000, 0x1484: 0x2000, 0x1485: 0x2000, + 0x1486: 0x2000, 0x1487: 0x2000, 0x1488: 0x2000, 0x1489: 0x2000, 0x148a: 0x2000, 0x148b: 0x2000, + 0x148c: 0x2000, 0x148d: 0x2000, 0x148e: 0x4000, 0x148f: 0x2000, 0x1490: 0x2000, 0x1491: 0x4000, + 0x1492: 0x4000, 0x1493: 0x4000, 0x1494: 0x4000, 0x1495: 0x4000, 0x1496: 0x4000, 0x1497: 0x4000, + 0x1498: 0x4000, 0x1499: 0x4000, 0x149a: 0x4000, 0x149b: 0x2000, 0x149c: 0x2000, 0x149d: 0x2000, + 0x149e: 0x2000, 0x149f: 0x2000, 0x14a0: 0x2000, 0x14a1: 0x2000, 0x14a2: 0x2000, 0x14a3: 0x2000, + 0x14a4: 0x2000, 0x14a5: 0x2000, 0x14a6: 0x2000, 0x14a7: 0x2000, 0x14a8: 0x2000, 0x14a9: 0x2000, + 0x14aa: 0x2000, 0x14ab: 0x2000, 0x14ac: 0x2000, + // Block 0x53, offset 0x14c0 + 0x14c0: 0x4000, 0x14c1: 0x4000, 0x14c2: 0x4000, + 0x14d0: 0x4000, 0x14d1: 0x4000, + 0x14d2: 0x4000, 0x14d3: 0x4000, 0x14d4: 0x4000, 0x14d5: 0x4000, 0x14d6: 0x4000, 0x14d7: 0x4000, + 0x14d8: 0x4000, 0x14d9: 0x4000, 0x14da: 0x4000, 0x14db: 0x4000, 0x14dc: 0x4000, 0x14dd: 0x4000, + 0x14de: 0x4000, 0x14df: 0x4000, 0x14e0: 0x4000, 0x14e1: 0x4000, 0x14e2: 0x4000, 0x14e3: 0x4000, + 0x14e4: 0x4000, 0x14e5: 0x4000, 0x14e6: 0x4000, 0x14e7: 0x4000, 0x14e8: 0x4000, 0x14e9: 0x4000, + 0x14ea: 0x4000, 0x14eb: 0x4000, 0x14ec: 0x4000, 0x14ed: 0x4000, 0x14ee: 0x4000, 0x14ef: 0x4000, + 0x14f0: 0x4000, 0x14f1: 0x4000, 0x14f2: 0x4000, 0x14f3: 0x4000, 0x14f4: 0x4000, 0x14f5: 0x4000, + 0x14f6: 0x4000, 0x14f7: 0x4000, 0x14f8: 0x4000, 0x14f9: 0x4000, 0x14fa: 0x4000, 0x14fb: 0x4000, + // Block 0x54, offset 0x1500 + 0x1500: 0x4000, 0x1501: 0x4000, 0x1502: 0x4000, 0x1503: 0x4000, 0x1504: 0x4000, 0x1505: 0x4000, + 0x1506: 0x4000, 0x1507: 0x4000, 0x1508: 0x4000, + 0x1510: 0x4000, 0x1511: 0x4000, + 0x1520: 0x4000, 0x1521: 0x4000, 0x1522: 0x4000, 0x1523: 0x4000, + 0x1524: 0x4000, 0x1525: 0x4000, + // Block 0x55, offset 0x1540 + 0x1540: 0x4000, 0x1541: 0x4000, 0x1542: 0x4000, 0x1543: 0x4000, 0x1544: 0x4000, 0x1545: 0x4000, + 0x1546: 0x4000, 0x1547: 0x4000, 0x1548: 0x4000, 0x1549: 0x4000, 0x154a: 0x4000, 0x154b: 0x4000, + 0x154c: 0x4000, 0x154d: 0x4000, 0x154e: 0x4000, 0x154f: 0x4000, 0x1550: 0x4000, 0x1551: 0x4000, + 0x1552: 0x4000, 0x1553: 0x4000, 0x1554: 0x4000, 0x1555: 0x4000, 0x1556: 0x4000, 0x1557: 0x4000, + 0x1558: 0x4000, 0x1559: 0x4000, 0x155a: 0x4000, 0x155b: 0x4000, 0x155c: 0x4000, 0x155d: 0x4000, + 0x155e: 0x4000, 0x155f: 0x4000, 0x1560: 0x4000, + 0x156d: 0x4000, 0x156e: 0x4000, 0x156f: 0x4000, + 0x1570: 0x4000, 0x1571: 0x4000, 0x1572: 0x4000, 0x1573: 0x4000, 0x1574: 0x4000, 0x1575: 0x4000, + 0x1577: 0x4000, 0x1578: 0x4000, 0x1579: 0x4000, 0x157a: 0x4000, 0x157b: 0x4000, + 0x157c: 0x4000, 0x157d: 0x4000, 0x157e: 0x4000, 0x157f: 0x4000, + // Block 0x56, offset 0x1580 + 0x1580: 0x4000, 0x1581: 0x4000, 0x1582: 0x4000, 0x1583: 0x4000, 0x1584: 0x4000, 0x1585: 0x4000, + 0x1586: 0x4000, 0x1587: 0x4000, 0x1588: 0x4000, 0x1589: 0x4000, 0x158a: 0x4000, 0x158b: 0x4000, + 0x158c: 0x4000, 0x158d: 0x4000, 0x158e: 0x4000, 0x158f: 0x4000, 0x1590: 0x4000, 0x1591: 0x4000, + 0x1592: 0x4000, 0x1593: 0x4000, 0x1594: 0x4000, 0x1595: 0x4000, 0x1596: 0x4000, 0x1597: 0x4000, + 0x1598: 0x4000, 0x1599: 0x4000, 0x159a: 0x4000, 0x159b: 0x4000, 0x159c: 0x4000, 0x159d: 0x4000, + 0x159e: 0x4000, 0x159f: 0x4000, 0x15a0: 0x4000, 0x15a1: 0x4000, 0x15a2: 0x4000, 0x15a3: 0x4000, + 0x15a4: 0x4000, 0x15a5: 0x4000, 0x15a6: 0x4000, 0x15a7: 0x4000, 0x15a8: 0x4000, 0x15a9: 0x4000, + 0x15aa: 0x4000, 0x15ab: 0x4000, 0x15ac: 0x4000, 0x15ad: 0x4000, 0x15ae: 0x4000, 0x15af: 0x4000, + 0x15b0: 0x4000, 0x15b1: 0x4000, 0x15b2: 0x4000, 0x15b3: 0x4000, 0x15b4: 0x4000, 0x15b5: 0x4000, + 0x15b6: 0x4000, 0x15b7: 0x4000, 0x15b8: 0x4000, 0x15b9: 0x4000, 0x15ba: 0x4000, 0x15bb: 0x4000, + 0x15bc: 0x4000, 0x15be: 0x4000, 0x15bf: 0x4000, + // Block 0x57, offset 0x15c0 + 0x15c0: 0x4000, 0x15c1: 0x4000, 0x15c2: 0x4000, 0x15c3: 0x4000, 0x15c4: 0x4000, 0x15c5: 0x4000, + 0x15c6: 0x4000, 0x15c7: 0x4000, 0x15c8: 0x4000, 0x15c9: 0x4000, 0x15ca: 0x4000, 0x15cb: 0x4000, + 0x15cc: 0x4000, 0x15cd: 0x4000, 0x15ce: 0x4000, 0x15cf: 0x4000, 0x15d0: 0x4000, 0x15d1: 0x4000, + 0x15d2: 0x4000, 0x15d3: 0x4000, + 0x15e0: 0x4000, 0x15e1: 0x4000, 0x15e2: 0x4000, 0x15e3: 0x4000, + 0x15e4: 0x4000, 0x15e5: 0x4000, 0x15e6: 0x4000, 0x15e7: 0x4000, 0x15e8: 0x4000, 0x15e9: 0x4000, + 0x15ea: 0x4000, 0x15eb: 0x4000, 0x15ec: 0x4000, 0x15ed: 0x4000, 0x15ee: 0x4000, 0x15ef: 0x4000, + 0x15f0: 0x4000, 0x15f1: 0x4000, 0x15f2: 0x4000, 0x15f3: 0x4000, 0x15f4: 0x4000, 0x15f5: 0x4000, + 0x15f6: 0x4000, 0x15f7: 0x4000, 0x15f8: 0x4000, 0x15f9: 0x4000, 0x15fa: 0x4000, 0x15fb: 0x4000, + 0x15fc: 0x4000, 0x15fd: 0x4000, 0x15fe: 0x4000, 0x15ff: 0x4000, + // Block 0x58, offset 0x1600 + 0x1600: 0x4000, 0x1601: 0x4000, 0x1602: 0x4000, 0x1603: 0x4000, 0x1604: 0x4000, 0x1605: 0x4000, + 0x1606: 0x4000, 0x1607: 0x4000, 0x1608: 0x4000, 0x1609: 0x4000, 0x160a: 0x4000, + 0x160f: 0x4000, 0x1610: 0x4000, 0x1611: 0x4000, + 0x1612: 0x4000, 0x1613: 0x4000, + 0x1620: 0x4000, 0x1621: 0x4000, 0x1622: 0x4000, 0x1623: 0x4000, + 0x1624: 0x4000, 0x1625: 0x4000, 0x1626: 0x4000, 0x1627: 0x4000, 0x1628: 0x4000, 0x1629: 0x4000, + 0x162a: 0x4000, 0x162b: 0x4000, 0x162c: 0x4000, 0x162d: 0x4000, 0x162e: 0x4000, 0x162f: 0x4000, + 0x1630: 0x4000, 0x1634: 0x4000, + 0x1638: 0x4000, 0x1639: 0x4000, 0x163a: 0x4000, 0x163b: 0x4000, + 0x163c: 0x4000, 0x163d: 0x4000, 0x163e: 0x4000, 0x163f: 0x4000, + // Block 0x59, offset 0x1640 + 0x1640: 0x4000, 0x1641: 0x4000, 0x1642: 0x4000, 0x1643: 0x4000, 0x1644: 0x4000, 0x1645: 0x4000, + 0x1646: 0x4000, 0x1647: 0x4000, 0x1648: 0x4000, 0x1649: 0x4000, 0x164a: 0x4000, 0x164b: 0x4000, + 0x164c: 0x4000, 0x164d: 0x4000, 0x164e: 0x4000, 0x164f: 0x4000, 0x1650: 0x4000, 0x1651: 0x4000, + 0x1652: 0x4000, 0x1653: 0x4000, 0x1654: 0x4000, 0x1655: 0x4000, 0x1656: 0x4000, 0x1657: 0x4000, + 0x1658: 0x4000, 0x1659: 0x4000, 0x165a: 0x4000, 0x165b: 0x4000, 0x165c: 0x4000, 0x165d: 0x4000, + 0x165e: 0x4000, 0x165f: 0x4000, 0x1660: 0x4000, 0x1661: 0x4000, 0x1662: 0x4000, 0x1663: 0x4000, + 0x1664: 0x4000, 0x1665: 0x4000, 0x1666: 0x4000, 0x1667: 0x4000, 0x1668: 0x4000, 0x1669: 0x4000, + 0x166a: 0x4000, 0x166b: 0x4000, 0x166c: 0x4000, 0x166d: 0x4000, 0x166e: 0x4000, 0x166f: 0x4000, + 0x1670: 0x4000, 0x1671: 0x4000, 0x1672: 0x4000, 0x1673: 0x4000, 0x1674: 0x4000, 0x1675: 0x4000, + 0x1676: 0x4000, 0x1677: 0x4000, 0x1678: 0x4000, 0x1679: 0x4000, 0x167a: 0x4000, 0x167b: 0x4000, + 0x167c: 0x4000, 0x167d: 0x4000, 0x167e: 0x4000, + // Block 0x5a, offset 0x1680 + 0x1680: 0x4000, 0x1682: 0x4000, 0x1683: 0x4000, 0x1684: 0x4000, 0x1685: 0x4000, + 0x1686: 0x4000, 0x1687: 0x4000, 0x1688: 0x4000, 0x1689: 0x4000, 0x168a: 0x4000, 0x168b: 0x4000, + 0x168c: 0x4000, 0x168d: 0x4000, 0x168e: 0x4000, 0x168f: 0x4000, 0x1690: 0x4000, 0x1691: 0x4000, + 0x1692: 0x4000, 0x1693: 0x4000, 0x1694: 0x4000, 0x1695: 0x4000, 0x1696: 0x4000, 0x1697: 0x4000, + 0x1698: 0x4000, 0x1699: 0x4000, 0x169a: 0x4000, 0x169b: 0x4000, 0x169c: 0x4000, 0x169d: 0x4000, + 0x169e: 0x4000, 0x169f: 0x4000, 0x16a0: 0x4000, 0x16a1: 0x4000, 0x16a2: 0x4000, 0x16a3: 0x4000, + 0x16a4: 0x4000, 0x16a5: 0x4000, 0x16a6: 0x4000, 0x16a7: 0x4000, 0x16a8: 0x4000, 0x16a9: 0x4000, + 0x16aa: 0x4000, 0x16ab: 0x4000, 0x16ac: 0x4000, 0x16ad: 0x4000, 0x16ae: 0x4000, 0x16af: 0x4000, + 0x16b0: 0x4000, 0x16b1: 0x4000, 0x16b2: 0x4000, 0x16b3: 0x4000, 0x16b4: 0x4000, 0x16b5: 0x4000, + 0x16b6: 0x4000, 0x16b7: 0x4000, 0x16b8: 0x4000, 0x16b9: 0x4000, 0x16ba: 0x4000, 0x16bb: 0x4000, + 0x16bc: 0x4000, 0x16bd: 0x4000, 0x16be: 0x4000, 0x16bf: 0x4000, + // Block 0x5b, offset 0x16c0 + 0x16c0: 0x4000, 0x16c1: 0x4000, 0x16c2: 0x4000, 0x16c3: 0x4000, 0x16c4: 0x4000, 0x16c5: 0x4000, + 0x16c6: 0x4000, 0x16c7: 0x4000, 0x16c8: 0x4000, 0x16c9: 0x4000, 0x16ca: 0x4000, 0x16cb: 0x4000, + 0x16cc: 0x4000, 0x16cd: 0x4000, 0x16ce: 0x4000, 0x16cf: 0x4000, 0x16d0: 0x4000, 0x16d1: 0x4000, + 0x16d2: 0x4000, 0x16d3: 0x4000, 0x16d4: 0x4000, 0x16d5: 0x4000, 0x16d6: 0x4000, 0x16d7: 0x4000, + 0x16d8: 0x4000, 0x16d9: 0x4000, 0x16da: 0x4000, 0x16db: 0x4000, 0x16dc: 0x4000, 0x16dd: 0x4000, + 0x16de: 0x4000, 0x16df: 0x4000, 0x16e0: 0x4000, 0x16e1: 0x4000, 0x16e2: 0x4000, 0x16e3: 0x4000, + 0x16e4: 0x4000, 0x16e5: 0x4000, 0x16e6: 0x4000, 0x16e7: 0x4000, 0x16e8: 0x4000, 0x16e9: 0x4000, + 0x16ea: 0x4000, 0x16eb: 0x4000, 0x16ec: 0x4000, 0x16ed: 0x4000, 0x16ee: 0x4000, 0x16ef: 0x4000, + 0x16f0: 0x4000, 0x16f1: 0x4000, 0x16f2: 0x4000, 0x16f3: 0x4000, 0x16f4: 0x4000, 0x16f5: 0x4000, + 0x16f6: 0x4000, 0x16f7: 0x4000, 0x16f8: 0x4000, 0x16f9: 0x4000, 0x16fa: 0x4000, 0x16fb: 0x4000, + 0x16fc: 0x4000, 0x16ff: 0x4000, + // Block 0x5c, offset 0x1700 + 0x1700: 0x4000, 0x1701: 0x4000, 0x1702: 0x4000, 0x1703: 0x4000, 0x1704: 0x4000, 0x1705: 0x4000, + 0x1706: 0x4000, 0x1707: 0x4000, 0x1708: 0x4000, 0x1709: 0x4000, 0x170a: 0x4000, 0x170b: 0x4000, + 0x170c: 0x4000, 0x170d: 0x4000, 0x170e: 0x4000, 0x170f: 0x4000, 0x1710: 0x4000, 0x1711: 0x4000, + 0x1712: 0x4000, 0x1713: 0x4000, 0x1714: 0x4000, 0x1715: 0x4000, 0x1716: 0x4000, 0x1717: 0x4000, + 0x1718: 0x4000, 0x1719: 0x4000, 0x171a: 0x4000, 0x171b: 0x4000, 0x171c: 0x4000, 0x171d: 0x4000, + 0x171e: 0x4000, 0x171f: 0x4000, 0x1720: 0x4000, 0x1721: 0x4000, 0x1722: 0x4000, 0x1723: 0x4000, + 0x1724: 0x4000, 0x1725: 0x4000, 0x1726: 0x4000, 0x1727: 0x4000, 0x1728: 0x4000, 0x1729: 0x4000, + 0x172a: 0x4000, 0x172b: 0x4000, 0x172c: 0x4000, 0x172d: 0x4000, 0x172e: 0x4000, 0x172f: 0x4000, + 0x1730: 0x4000, 0x1731: 0x4000, 0x1732: 0x4000, 0x1733: 0x4000, 0x1734: 0x4000, 0x1735: 0x4000, + 0x1736: 0x4000, 0x1737: 0x4000, 0x1738: 0x4000, 0x1739: 0x4000, 0x173a: 0x4000, 0x173b: 0x4000, + 0x173c: 0x4000, 0x173d: 0x4000, + // Block 0x5d, offset 0x1740 + 0x174b: 0x4000, + 0x174c: 0x4000, 0x174d: 0x4000, 0x174e: 0x4000, 0x1750: 0x4000, 0x1751: 0x4000, + 0x1752: 0x4000, 0x1753: 0x4000, 0x1754: 0x4000, 0x1755: 0x4000, 0x1756: 0x4000, 0x1757: 0x4000, + 0x1758: 0x4000, 0x1759: 0x4000, 0x175a: 0x4000, 0x175b: 0x4000, 0x175c: 0x4000, 0x175d: 0x4000, + 0x175e: 0x4000, 0x175f: 0x4000, 0x1760: 0x4000, 0x1761: 0x4000, 0x1762: 0x4000, 0x1763: 0x4000, + 0x1764: 0x4000, 0x1765: 0x4000, 0x1766: 0x4000, 0x1767: 0x4000, + 0x177a: 0x4000, + // Block 0x5e, offset 0x1780 + 0x1795: 0x4000, 0x1796: 0x4000, + 0x17a4: 0x4000, + // Block 0x5f, offset 0x17c0 + 0x17fb: 0x4000, + 0x17fc: 0x4000, 0x17fd: 0x4000, 0x17fe: 0x4000, 0x17ff: 0x4000, + // Block 0x60, offset 0x1800 + 0x1800: 0x4000, 0x1801: 0x4000, 0x1802: 0x4000, 0x1803: 0x4000, 0x1804: 0x4000, 0x1805: 0x4000, + 0x1806: 0x4000, 0x1807: 0x4000, 0x1808: 0x4000, 0x1809: 0x4000, 0x180a: 0x4000, 0x180b: 0x4000, + 0x180c: 0x4000, 0x180d: 0x4000, 0x180e: 0x4000, 0x180f: 0x4000, + // Block 0x61, offset 0x1840 + 0x1840: 0x4000, 0x1841: 0x4000, 0x1842: 0x4000, 0x1843: 0x4000, 0x1844: 0x4000, 0x1845: 0x4000, + 0x184c: 0x4000, 0x1850: 0x4000, 0x1851: 0x4000, + 0x1852: 0x4000, 0x1855: 0x4000, 0x1856: 0x4000, 0x1857: 0x4000, + 0x185c: 0x4000, 0x185d: 0x4000, + 0x185e: 0x4000, 0x185f: 0x4000, + 0x186b: 0x4000, 0x186c: 0x4000, + 0x1874: 0x4000, 0x1875: 0x4000, + 0x1876: 0x4000, 0x1877: 0x4000, 0x1878: 0x4000, 0x1879: 0x4000, 0x187a: 0x4000, 0x187b: 0x4000, + 0x187c: 0x4000, + // Block 0x62, offset 0x1880 + 0x18a0: 0x4000, 0x18a1: 0x4000, 0x18a2: 0x4000, 0x18a3: 0x4000, + 0x18a4: 0x4000, 0x18a5: 0x4000, 0x18a6: 0x4000, 0x18a7: 0x4000, 0x18a8: 0x4000, 0x18a9: 0x4000, + 0x18aa: 0x4000, 0x18ab: 0x4000, + 0x18b0: 0x4000, + // Block 0x63, offset 0x18c0 + 0x18cc: 0x4000, 0x18cd: 0x4000, 0x18ce: 0x4000, 0x18cf: 0x4000, 0x18d0: 0x4000, 0x18d1: 0x4000, + 0x18d2: 0x4000, 0x18d3: 0x4000, 0x18d4: 0x4000, 0x18d5: 0x4000, 0x18d6: 0x4000, 0x18d7: 0x4000, + 0x18d8: 0x4000, 0x18d9: 0x4000, 0x18da: 0x4000, 0x18db: 0x4000, 0x18dc: 0x4000, 0x18dd: 0x4000, + 0x18de: 0x4000, 0x18df: 0x4000, 0x18e0: 0x4000, 0x18e1: 0x4000, 0x18e2: 0x4000, 0x18e3: 0x4000, + 0x18e4: 0x4000, 0x18e5: 0x4000, 0x18e6: 0x4000, 0x18e7: 0x4000, 0x18e8: 0x4000, 0x18e9: 0x4000, + 0x18ea: 0x4000, 0x18eb: 0x4000, 0x18ec: 0x4000, 0x18ed: 0x4000, 0x18ee: 0x4000, 0x18ef: 0x4000, + 0x18f0: 0x4000, 0x18f1: 0x4000, 0x18f2: 0x4000, 0x18f3: 0x4000, 0x18f4: 0x4000, 0x18f5: 0x4000, + 0x18f6: 0x4000, 0x18f7: 0x4000, 0x18f8: 0x4000, 0x18f9: 0x4000, 0x18fa: 0x4000, + 0x18fc: 0x4000, 0x18fd: 0x4000, 0x18fe: 0x4000, 0x18ff: 0x4000, + // Block 0x64, offset 0x1900 + 0x1900: 0x4000, 0x1901: 0x4000, 0x1902: 0x4000, 0x1903: 0x4000, 0x1904: 0x4000, 0x1905: 0x4000, + 0x1907: 0x4000, 0x1908: 0x4000, 0x1909: 0x4000, 0x190a: 0x4000, 0x190b: 0x4000, + 0x190c: 0x4000, 0x190d: 0x4000, 0x190e: 0x4000, 0x190f: 0x4000, 0x1910: 0x4000, 0x1911: 0x4000, + 0x1912: 0x4000, 0x1913: 0x4000, 0x1914: 0x4000, 0x1915: 0x4000, 0x1916: 0x4000, 0x1917: 0x4000, + 0x1918: 0x4000, 0x1919: 0x4000, 0x191a: 0x4000, 0x191b: 0x4000, 0x191c: 0x4000, 0x191d: 0x4000, + 0x191e: 0x4000, 0x191f: 0x4000, 0x1920: 0x4000, 0x1921: 0x4000, 0x1922: 0x4000, 0x1923: 0x4000, + 0x1924: 0x4000, 0x1925: 0x4000, 0x1926: 0x4000, 0x1927: 0x4000, 0x1928: 0x4000, 0x1929: 0x4000, + 0x192a: 0x4000, 0x192b: 0x4000, 0x192c: 0x4000, 0x192d: 0x4000, 0x192e: 0x4000, 0x192f: 0x4000, + 0x1930: 0x4000, 0x1931: 0x4000, 0x1932: 0x4000, 0x1933: 0x4000, 0x1934: 0x4000, 0x1935: 0x4000, + 0x1936: 0x4000, 0x1937: 0x4000, 0x1938: 0x4000, 0x1939: 0x4000, 0x193a: 0x4000, 0x193b: 0x4000, + 0x193c: 0x4000, 0x193d: 0x4000, 0x193e: 0x4000, 0x193f: 0x4000, + // Block 0x65, offset 0x1940 + 0x1970: 0x4000, 0x1971: 0x4000, 0x1972: 0x4000, 0x1973: 0x4000, 0x1974: 0x4000, 0x1975: 0x4000, + 0x1976: 0x4000, 0x1977: 0x4000, 0x1978: 0x4000, 0x1979: 0x4000, 0x197a: 0x4000, 0x197b: 0x4000, + 0x197c: 0x4000, + // Block 0x66, offset 0x1980 + 0x1980: 0x4000, 0x1981: 0x4000, 0x1982: 0x4000, 0x1983: 0x4000, 0x1984: 0x4000, 0x1985: 0x4000, + 0x1986: 0x4000, 0x1987: 0x4000, 0x1988: 0x4000, + 0x1990: 0x4000, 0x1991: 0x4000, + 0x1992: 0x4000, 0x1993: 0x4000, 0x1994: 0x4000, 0x1995: 0x4000, 0x1996: 0x4000, 0x1997: 0x4000, + 0x1998: 0x4000, 0x1999: 0x4000, 0x199a: 0x4000, 0x199b: 0x4000, 0x199c: 0x4000, 0x199d: 0x4000, + 0x199e: 0x4000, 0x199f: 0x4000, 0x19a0: 0x4000, 0x19a1: 0x4000, 0x19a2: 0x4000, 0x19a3: 0x4000, + 0x19a4: 0x4000, 0x19a5: 0x4000, 0x19a6: 0x4000, 0x19a7: 0x4000, 0x19a8: 0x4000, 0x19a9: 0x4000, + 0x19aa: 0x4000, 0x19ab: 0x4000, 0x19ac: 0x4000, 0x19ad: 0x4000, 0x19ae: 0x4000, 0x19af: 0x4000, + 0x19b0: 0x4000, 0x19b1: 0x4000, 0x19b2: 0x4000, 0x19b3: 0x4000, 0x19b4: 0x4000, 0x19b5: 0x4000, + 0x19b6: 0x4000, 0x19b7: 0x4000, 0x19b8: 0x4000, 0x19b9: 0x4000, 0x19ba: 0x4000, 0x19bb: 0x4000, + 0x19bc: 0x4000, 0x19bd: 0x4000, 0x19bf: 0x4000, + // Block 0x67, offset 0x19c0 + 0x19c0: 0x4000, 0x19c1: 0x4000, 0x19c2: 0x4000, 0x19c3: 0x4000, 0x19c4: 0x4000, 0x19c5: 0x4000, + 0x19ce: 0x4000, 0x19cf: 0x4000, 0x19d0: 0x4000, 0x19d1: 0x4000, + 0x19d2: 0x4000, 0x19d3: 0x4000, 0x19d4: 0x4000, 0x19d5: 0x4000, 0x19d6: 0x4000, 0x19d7: 0x4000, + 0x19d8: 0x4000, 0x19d9: 0x4000, 0x19da: 0x4000, 0x19db: 0x4000, + 0x19e0: 0x4000, 0x19e1: 0x4000, 0x19e2: 0x4000, 0x19e3: 0x4000, + 0x19e4: 0x4000, 0x19e5: 0x4000, 0x19e6: 0x4000, 0x19e7: 0x4000, 0x19e8: 0x4000, + 0x19f0: 0x4000, 0x19f1: 0x4000, 0x19f2: 0x4000, 0x19f3: 0x4000, 0x19f4: 0x4000, 0x19f5: 0x4000, + 0x19f6: 0x4000, 0x19f7: 0x4000, 0x19f8: 0x4000, + // Block 0x68, offset 0x1a00 + 0x1a00: 0x2000, 0x1a01: 0x2000, 0x1a02: 0x2000, 0x1a03: 0x2000, 0x1a04: 0x2000, 0x1a05: 0x2000, + 0x1a06: 0x2000, 0x1a07: 0x2000, 0x1a08: 0x2000, 0x1a09: 0x2000, 0x1a0a: 0x2000, 0x1a0b: 0x2000, + 0x1a0c: 0x2000, 0x1a0d: 0x2000, 0x1a0e: 0x2000, 0x1a0f: 0x2000, 0x1a10: 0x2000, 0x1a11: 0x2000, + 0x1a12: 0x2000, 0x1a13: 0x2000, 0x1a14: 0x2000, 0x1a15: 0x2000, 0x1a16: 0x2000, 0x1a17: 0x2000, + 0x1a18: 0x2000, 0x1a19: 0x2000, 0x1a1a: 0x2000, 0x1a1b: 0x2000, 0x1a1c: 0x2000, 0x1a1d: 0x2000, + 0x1a1e: 0x2000, 0x1a1f: 0x2000, 0x1a20: 0x2000, 0x1a21: 0x2000, 0x1a22: 0x2000, 0x1a23: 0x2000, + 0x1a24: 0x2000, 0x1a25: 0x2000, 0x1a26: 0x2000, 0x1a27: 0x2000, 0x1a28: 0x2000, 0x1a29: 0x2000, + 0x1a2a: 0x2000, 0x1a2b: 0x2000, 0x1a2c: 0x2000, 0x1a2d: 0x2000, 0x1a2e: 0x2000, 0x1a2f: 0x2000, + 0x1a30: 0x2000, 0x1a31: 0x2000, 0x1a32: 0x2000, 0x1a33: 0x2000, 0x1a34: 0x2000, 0x1a35: 0x2000, + 0x1a36: 0x2000, 0x1a37: 0x2000, 0x1a38: 0x2000, 0x1a39: 0x2000, 0x1a3a: 0x2000, 0x1a3b: 0x2000, + 0x1a3c: 0x2000, 0x1a3d: 0x2000, +} + +// widthIndex: 23 blocks, 1472 entries, 1472 bytes +// Block 0 is the zero block. +var widthIndex = [1472]uint8{ + // Block 0x0, offset 0x0 + // Block 0x1, offset 0x40 + // Block 0x2, offset 0x80 + // Block 0x3, offset 0xc0 + 0xc2: 0x01, 0xc3: 0x02, 0xc4: 0x03, 0xc5: 0x04, 0xc7: 0x05, + 0xc9: 0x06, 0xcb: 0x07, 0xcc: 0x08, 0xcd: 0x09, 0xce: 0x0a, 0xcf: 0x0b, + 0xd0: 0x0c, 0xd1: 0x0d, + 0xe1: 0x02, 0xe2: 0x03, 0xe3: 0x04, 0xe4: 0x05, 0xe5: 0x06, 0xe6: 0x06, 0xe7: 0x06, + 0xe8: 0x06, 0xe9: 0x06, 0xea: 0x07, 0xeb: 0x06, 0xec: 0x06, 0xed: 0x08, 0xee: 0x09, 0xef: 0x0a, + 0xf0: 0x10, 0xf3: 0x13, 0xf4: 0x14, + // Block 0x4, offset 0x100 + 0x104: 0x0e, 0x105: 0x0f, + // Block 0x5, offset 0x140 + 0x140: 0x10, 0x141: 0x11, 0x142: 0x12, 0x144: 0x13, 0x145: 0x14, 0x146: 0x15, 0x147: 0x16, + 0x148: 0x17, 0x149: 0x18, 0x14a: 0x19, 0x14c: 0x1a, 0x14f: 0x1b, + 0x151: 0x1c, 0x152: 0x08, 0x153: 0x1d, 0x154: 0x1e, 0x155: 0x1f, 0x156: 0x20, 0x157: 0x21, + 0x158: 0x22, 0x159: 0x23, 0x15a: 0x24, 0x15b: 0x25, 0x15c: 0x26, 0x15d: 0x27, 0x15e: 0x28, 0x15f: 0x29, + 0x166: 0x2a, + 0x16c: 0x2b, 0x16d: 0x2c, + 0x17a: 0x2d, 0x17b: 0x2e, 0x17c: 0x0e, 0x17d: 0x0e, 0x17e: 0x0e, 0x17f: 0x2f, + // Block 0x6, offset 0x180 + 0x180: 0x30, 0x181: 0x31, 0x182: 0x32, 0x183: 0x33, 0x184: 0x34, 0x185: 0x35, 0x186: 0x36, 0x187: 0x37, + 0x188: 0x38, 0x189: 0x39, 0x18a: 0x0e, 0x18b: 0x0e, 0x18c: 0x0e, 0x18d: 0x0e, 0x18e: 0x0e, 0x18f: 0x0e, + 0x190: 0x0e, 0x191: 0x0e, 0x192: 0x0e, 0x193: 0x0e, 0x194: 0x0e, 0x195: 0x0e, 0x196: 0x0e, 0x197: 0x0e, + 0x198: 0x0e, 0x199: 0x0e, 0x19a: 0x0e, 0x19b: 0x0e, 0x19c: 0x0e, 0x19d: 0x0e, 0x19e: 0x0e, 0x19f: 0x0e, + 0x1a0: 0x0e, 0x1a1: 0x0e, 0x1a2: 0x0e, 0x1a3: 0x0e, 0x1a4: 0x0e, 0x1a5: 0x0e, 0x1a6: 0x0e, 0x1a7: 0x0e, + 0x1a8: 0x0e, 0x1a9: 0x0e, 0x1aa: 0x0e, 0x1ab: 0x0e, 0x1ac: 0x0e, 0x1ad: 0x0e, 0x1ae: 0x0e, 0x1af: 0x0e, + 0x1b0: 0x0e, 0x1b1: 0x0e, 0x1b2: 0x0e, 0x1b3: 0x0e, 0x1b4: 0x0e, 0x1b5: 0x0e, 0x1b6: 0x0e, 0x1b7: 0x0e, + 0x1b8: 0x0e, 0x1b9: 0x0e, 0x1ba: 0x0e, 0x1bb: 0x0e, 0x1bc: 0x0e, 0x1bd: 0x0e, 0x1be: 0x0e, 0x1bf: 0x0e, + // Block 0x7, offset 0x1c0 + 0x1c0: 0x0e, 0x1c1: 0x0e, 0x1c2: 0x0e, 0x1c3: 0x0e, 0x1c4: 0x0e, 0x1c5: 0x0e, 0x1c6: 0x0e, 0x1c7: 0x0e, + 0x1c8: 0x0e, 0x1c9: 0x0e, 0x1ca: 0x0e, 0x1cb: 0x0e, 0x1cc: 0x0e, 0x1cd: 0x0e, 0x1ce: 0x0e, 0x1cf: 0x0e, + 0x1d0: 0x0e, 0x1d1: 0x0e, 0x1d2: 0x0e, 0x1d3: 0x0e, 0x1d4: 0x0e, 0x1d5: 0x0e, 0x1d6: 0x0e, 0x1d7: 0x0e, + 0x1d8: 0x0e, 0x1d9: 0x0e, 0x1da: 0x0e, 0x1db: 0x0e, 0x1dc: 0x0e, 0x1dd: 0x0e, 0x1de: 0x0e, 0x1df: 0x0e, + 0x1e0: 0x0e, 0x1e1: 0x0e, 0x1e2: 0x0e, 0x1e3: 0x0e, 0x1e4: 0x0e, 0x1e5: 0x0e, 0x1e6: 0x0e, 0x1e7: 0x0e, + 0x1e8: 0x0e, 0x1e9: 0x0e, 0x1ea: 0x0e, 0x1eb: 0x0e, 0x1ec: 0x0e, 0x1ed: 0x0e, 0x1ee: 0x0e, 0x1ef: 0x0e, + 0x1f0: 0x0e, 0x1f1: 0x0e, 0x1f2: 0x0e, 0x1f3: 0x0e, 0x1f4: 0x0e, 0x1f5: 0x0e, 0x1f6: 0x0e, + 0x1f8: 0x0e, 0x1f9: 0x0e, 0x1fa: 0x0e, 0x1fb: 0x0e, 0x1fc: 0x0e, 0x1fd: 0x0e, 0x1fe: 0x0e, 0x1ff: 0x0e, + // Block 0x8, offset 0x200 + 0x200: 0x0e, 0x201: 0x0e, 0x202: 0x0e, 0x203: 0x0e, 0x204: 0x0e, 0x205: 0x0e, 0x206: 0x0e, 0x207: 0x0e, + 0x208: 0x0e, 0x209: 0x0e, 0x20a: 0x0e, 0x20b: 0x0e, 0x20c: 0x0e, 0x20d: 0x0e, 0x20e: 0x0e, 0x20f: 0x0e, + 0x210: 0x0e, 0x211: 0x0e, 0x212: 0x0e, 0x213: 0x0e, 0x214: 0x0e, 0x215: 0x0e, 0x216: 0x0e, 0x217: 0x0e, + 0x218: 0x0e, 0x219: 0x0e, 0x21a: 0x0e, 0x21b: 0x0e, 0x21c: 0x0e, 0x21d: 0x0e, 0x21e: 0x0e, 0x21f: 0x0e, + 0x220: 0x0e, 0x221: 0x0e, 0x222: 0x0e, 0x223: 0x0e, 0x224: 0x0e, 0x225: 0x0e, 0x226: 0x0e, 0x227: 0x0e, + 0x228: 0x0e, 0x229: 0x0e, 0x22a: 0x0e, 0x22b: 0x0e, 0x22c: 0x0e, 0x22d: 0x0e, 0x22e: 0x0e, 0x22f: 0x0e, + 0x230: 0x0e, 0x231: 0x0e, 0x232: 0x0e, 0x233: 0x0e, 0x234: 0x0e, 0x235: 0x0e, 0x236: 0x0e, 0x237: 0x0e, + 0x238: 0x0e, 0x239: 0x0e, 0x23a: 0x0e, 0x23b: 0x0e, 0x23c: 0x0e, 0x23d: 0x0e, 0x23e: 0x0e, 0x23f: 0x0e, + // Block 0x9, offset 0x240 + 0x240: 0x0e, 0x241: 0x0e, 0x242: 0x0e, 0x243: 0x0e, 0x244: 0x0e, 0x245: 0x0e, 0x246: 0x0e, 0x247: 0x0e, + 0x248: 0x0e, 0x249: 0x0e, 0x24a: 0x0e, 0x24b: 0x0e, 0x24c: 0x0e, 0x24d: 0x0e, 0x24e: 0x0e, 0x24f: 0x0e, + 0x250: 0x0e, 0x251: 0x0e, 0x252: 0x3a, 0x253: 0x3b, + 0x265: 0x3c, + 0x270: 0x0e, 0x271: 0x0e, 0x272: 0x0e, 0x273: 0x0e, 0x274: 0x0e, 0x275: 0x0e, 0x276: 0x0e, 0x277: 0x0e, + 0x278: 0x0e, 0x279: 0x0e, 0x27a: 0x0e, 0x27b: 0x0e, 0x27c: 0x0e, 0x27d: 0x0e, 0x27e: 0x0e, 0x27f: 0x0e, + // Block 0xa, offset 0x280 + 0x280: 0x0e, 0x281: 0x0e, 0x282: 0x0e, 0x283: 0x0e, 0x284: 0x0e, 0x285: 0x0e, 0x286: 0x0e, 0x287: 0x0e, + 0x288: 0x0e, 0x289: 0x0e, 0x28a: 0x0e, 0x28b: 0x0e, 0x28c: 0x0e, 0x28d: 0x0e, 0x28e: 0x0e, 0x28f: 0x0e, + 0x290: 0x0e, 0x291: 0x0e, 0x292: 0x0e, 0x293: 0x0e, 0x294: 0x0e, 0x295: 0x0e, 0x296: 0x0e, 0x297: 0x0e, + 0x298: 0x0e, 0x299: 0x0e, 0x29a: 0x0e, 0x29b: 0x0e, 0x29c: 0x0e, 0x29d: 0x0e, 0x29e: 0x3d, + // Block 0xb, offset 0x2c0 + 0x2c0: 0x08, 0x2c1: 0x08, 0x2c2: 0x08, 0x2c3: 0x08, 0x2c4: 0x08, 0x2c5: 0x08, 0x2c6: 0x08, 0x2c7: 0x08, + 0x2c8: 0x08, 0x2c9: 0x08, 0x2ca: 0x08, 0x2cb: 0x08, 0x2cc: 0x08, 0x2cd: 0x08, 0x2ce: 0x08, 0x2cf: 0x08, + 0x2d0: 0x08, 0x2d1: 0x08, 0x2d2: 0x08, 0x2d3: 0x08, 0x2d4: 0x08, 0x2d5: 0x08, 0x2d6: 0x08, 0x2d7: 0x08, + 0x2d8: 0x08, 0x2d9: 0x08, 0x2da: 0x08, 0x2db: 0x08, 0x2dc: 0x08, 0x2dd: 0x08, 0x2de: 0x08, 0x2df: 0x08, + 0x2e0: 0x08, 0x2e1: 0x08, 0x2e2: 0x08, 0x2e3: 0x08, 0x2e4: 0x08, 0x2e5: 0x08, 0x2e6: 0x08, 0x2e7: 0x08, + 0x2e8: 0x08, 0x2e9: 0x08, 0x2ea: 0x08, 0x2eb: 0x08, 0x2ec: 0x08, 0x2ed: 0x08, 0x2ee: 0x08, 0x2ef: 0x08, + 0x2f0: 0x08, 0x2f1: 0x08, 0x2f2: 0x08, 0x2f3: 0x08, 0x2f4: 0x08, 0x2f5: 0x08, 0x2f6: 0x08, 0x2f7: 0x08, + 0x2f8: 0x08, 0x2f9: 0x08, 0x2fa: 0x08, 0x2fb: 0x08, 0x2fc: 0x08, 0x2fd: 0x08, 0x2fe: 0x08, 0x2ff: 0x08, + // Block 0xc, offset 0x300 + 0x300: 0x08, 0x301: 0x08, 0x302: 0x08, 0x303: 0x08, 0x304: 0x08, 0x305: 0x08, 0x306: 0x08, 0x307: 0x08, + 0x308: 0x08, 0x309: 0x08, 0x30a: 0x08, 0x30b: 0x08, 0x30c: 0x08, 0x30d: 0x08, 0x30e: 0x08, 0x30f: 0x08, + 0x310: 0x08, 0x311: 0x08, 0x312: 0x08, 0x313: 0x08, 0x314: 0x08, 0x315: 0x08, 0x316: 0x08, 0x317: 0x08, + 0x318: 0x08, 0x319: 0x08, 0x31a: 0x08, 0x31b: 0x08, 0x31c: 0x08, 0x31d: 0x08, 0x31e: 0x08, 0x31f: 0x08, + 0x320: 0x08, 0x321: 0x08, 0x322: 0x08, 0x323: 0x08, 0x324: 0x0e, 0x325: 0x0e, 0x326: 0x0e, 0x327: 0x0e, + 0x328: 0x0e, 0x329: 0x0e, 0x32a: 0x0e, 0x32b: 0x0e, + 0x338: 0x3e, 0x339: 0x3f, 0x33c: 0x40, 0x33d: 0x41, 0x33e: 0x42, 0x33f: 0x43, + // Block 0xd, offset 0x340 + 0x37f: 0x44, + // Block 0xe, offset 0x380 + 0x380: 0x0e, 0x381: 0x0e, 0x382: 0x0e, 0x383: 0x0e, 0x384: 0x0e, 0x385: 0x0e, 0x386: 0x0e, 0x387: 0x0e, + 0x388: 0x0e, 0x389: 0x0e, 0x38a: 0x0e, 0x38b: 0x0e, 0x38c: 0x0e, 0x38d: 0x0e, 0x38e: 0x0e, 0x38f: 0x0e, + 0x390: 0x0e, 0x391: 0x0e, 0x392: 0x0e, 0x393: 0x0e, 0x394: 0x0e, 0x395: 0x0e, 0x396: 0x0e, 0x397: 0x0e, + 0x398: 0x0e, 0x399: 0x0e, 0x39a: 0x0e, 0x39b: 0x0e, 0x39c: 0x0e, 0x39d: 0x0e, 0x39e: 0x0e, 0x39f: 0x45, + 0x3a0: 0x0e, 0x3a1: 0x0e, 0x3a2: 0x0e, 0x3a3: 0x0e, 0x3a4: 0x0e, 0x3a5: 0x0e, 0x3a6: 0x0e, 0x3a7: 0x0e, + 0x3a8: 0x0e, 0x3a9: 0x0e, 0x3aa: 0x0e, 0x3ab: 0x0e, 0x3ac: 0x0e, 0x3ad: 0x0e, 0x3ae: 0x0e, 0x3af: 0x0e, + 0x3b0: 0x0e, 0x3b1: 0x0e, 0x3b2: 0x0e, 0x3b3: 0x46, 0x3b4: 0x47, + // Block 0xf, offset 0x3c0 + 0x3ff: 0x48, + // Block 0x10, offset 0x400 + 0x400: 0x0e, 0x401: 0x0e, 0x402: 0x0e, 0x403: 0x0e, 0x404: 0x49, 0x405: 0x4a, 0x406: 0x0e, 0x407: 0x0e, + 0x408: 0x0e, 0x409: 0x0e, 0x40a: 0x0e, 0x40b: 0x4b, + // Block 0x11, offset 0x440 + 0x440: 0x4c, 0x443: 0x4d, 0x444: 0x4e, 0x445: 0x4f, 0x446: 0x50, + 0x448: 0x51, 0x449: 0x52, 0x44c: 0x53, 0x44d: 0x54, 0x44e: 0x55, 0x44f: 0x56, + 0x450: 0x57, 0x451: 0x58, 0x452: 0x0e, 0x453: 0x59, 0x454: 0x5a, 0x455: 0x5b, 0x456: 0x5c, 0x457: 0x5d, + 0x458: 0x0e, 0x459: 0x5e, 0x45a: 0x0e, 0x45b: 0x5f, 0x45f: 0x60, + 0x464: 0x61, 0x465: 0x62, 0x466: 0x0e, 0x467: 0x0e, + 0x469: 0x63, 0x46a: 0x64, 0x46b: 0x65, + // Block 0x12, offset 0x480 + 0x496: 0x0b, 0x497: 0x06, + 0x498: 0x0c, 0x49a: 0x0d, 0x49b: 0x0e, 0x49f: 0x0f, + 0x4a0: 0x06, 0x4a1: 0x06, 0x4a2: 0x06, 0x4a3: 0x06, 0x4a4: 0x06, 0x4a5: 0x06, 0x4a6: 0x06, 0x4a7: 0x06, + 0x4a8: 0x06, 0x4a9: 0x06, 0x4aa: 0x06, 0x4ab: 0x06, 0x4ac: 0x06, 0x4ad: 0x06, 0x4ae: 0x06, 0x4af: 0x06, + 0x4b0: 0x06, 0x4b1: 0x06, 0x4b2: 0x06, 0x4b3: 0x06, 0x4b4: 0x06, 0x4b5: 0x06, 0x4b6: 0x06, 0x4b7: 0x06, + 0x4b8: 0x06, 0x4b9: 0x06, 0x4ba: 0x06, 0x4bb: 0x06, 0x4bc: 0x06, 0x4bd: 0x06, 0x4be: 0x06, 0x4bf: 0x06, + // Block 0x13, offset 0x4c0 + 0x4c4: 0x08, 0x4c5: 0x08, 0x4c6: 0x08, 0x4c7: 0x09, + // Block 0x14, offset 0x500 + 0x500: 0x08, 0x501: 0x08, 0x502: 0x08, 0x503: 0x08, 0x504: 0x08, 0x505: 0x08, 0x506: 0x08, 0x507: 0x08, + 0x508: 0x08, 0x509: 0x08, 0x50a: 0x08, 0x50b: 0x08, 0x50c: 0x08, 0x50d: 0x08, 0x50e: 0x08, 0x50f: 0x08, + 0x510: 0x08, 0x511: 0x08, 0x512: 0x08, 0x513: 0x08, 0x514: 0x08, 0x515: 0x08, 0x516: 0x08, 0x517: 0x08, + 0x518: 0x08, 0x519: 0x08, 0x51a: 0x08, 0x51b: 0x08, 0x51c: 0x08, 0x51d: 0x08, 0x51e: 0x08, 0x51f: 0x08, + 0x520: 0x08, 0x521: 0x08, 0x522: 0x08, 0x523: 0x08, 0x524: 0x08, 0x525: 0x08, 0x526: 0x08, 0x527: 0x08, + 0x528: 0x08, 0x529: 0x08, 0x52a: 0x08, 0x52b: 0x08, 0x52c: 0x08, 0x52d: 0x08, 0x52e: 0x08, 0x52f: 0x08, + 0x530: 0x08, 0x531: 0x08, 0x532: 0x08, 0x533: 0x08, 0x534: 0x08, 0x535: 0x08, 0x536: 0x08, 0x537: 0x08, + 0x538: 0x08, 0x539: 0x08, 0x53a: 0x08, 0x53b: 0x08, 0x53c: 0x08, 0x53d: 0x08, 0x53e: 0x08, 0x53f: 0x66, + // Block 0x15, offset 0x540 + 0x560: 0x11, + 0x570: 0x09, 0x571: 0x09, 0x572: 0x09, 0x573: 0x09, 0x574: 0x09, 0x575: 0x09, 0x576: 0x09, 0x577: 0x09, + 0x578: 0x09, 0x579: 0x09, 0x57a: 0x09, 0x57b: 0x09, 0x57c: 0x09, 0x57d: 0x09, 0x57e: 0x09, 0x57f: 0x12, + // Block 0x16, offset 0x580 + 0x580: 0x09, 0x581: 0x09, 0x582: 0x09, 0x583: 0x09, 0x584: 0x09, 0x585: 0x09, 0x586: 0x09, 0x587: 0x09, + 0x588: 0x09, 0x589: 0x09, 0x58a: 0x09, 0x58b: 0x09, 0x58c: 0x09, 0x58d: 0x09, 0x58e: 0x09, 0x58f: 0x12, +} + +// inverseData contains 4-byte entries of the following format: +// +// <0 padding> +// +// The last byte of the UTF-8-encoded rune is xor-ed with the last byte of the +// UTF-8 encoding of the original rune. Mappings often have the following +// pattern: +// +// A -> A (U+FF21 -> U+0041) +// B -> B (U+FF22 -> U+0042) +// ... +// +// By xor-ing the last byte the same entry can be shared by many mappings. This +// reduces the total number of distinct entries by about two thirds. +// The resulting entry for the aforementioned mappings is +// +// { 0x01, 0xE0, 0x00, 0x00 } +// +// Using this entry to map U+FF21 (UTF-8 [EF BC A1]), we get +// +// E0 ^ A1 = 41. +// +// Similarly, for U+FF22 (UTF-8 [EF BC A2]), we get +// +// E0 ^ A2 = 42. +// +// Note that because of the xor-ing, the byte sequence stored in the entry is +// not valid UTF-8. +var inverseData = [150][4]byte{ + {0x00, 0x00, 0x00, 0x00}, + {0x03, 0xe3, 0x80, 0xa0}, + {0x03, 0xef, 0xbc, 0xa0}, + {0x03, 0xef, 0xbc, 0xe0}, + {0x03, 0xef, 0xbd, 0xe0}, + {0x03, 0xef, 0xbf, 0x02}, + {0x03, 0xef, 0xbf, 0x00}, + {0x03, 0xef, 0xbf, 0x0e}, + {0x03, 0xef, 0xbf, 0x0c}, + {0x03, 0xef, 0xbf, 0x0f}, + {0x03, 0xef, 0xbf, 0x39}, + {0x03, 0xef, 0xbf, 0x3b}, + {0x03, 0xef, 0xbf, 0x3f}, + {0x03, 0xef, 0xbf, 0x2a}, + {0x03, 0xef, 0xbf, 0x0d}, + {0x03, 0xef, 0xbf, 0x25}, + {0x03, 0xef, 0xbd, 0x1a}, + {0x03, 0xef, 0xbd, 0x26}, + {0x01, 0xa0, 0x00, 0x00}, + {0x03, 0xef, 0xbd, 0x25}, + {0x03, 0xef, 0xbd, 0x23}, + {0x03, 0xef, 0xbd, 0x2e}, + {0x03, 0xef, 0xbe, 0x07}, + {0x03, 0xef, 0xbe, 0x05}, + {0x03, 0xef, 0xbd, 0x06}, + {0x03, 0xef, 0xbd, 0x13}, + {0x03, 0xef, 0xbd, 0x0b}, + {0x03, 0xef, 0xbd, 0x16}, + {0x03, 0xef, 0xbd, 0x0c}, + {0x03, 0xef, 0xbd, 0x15}, + {0x03, 0xef, 0xbd, 0x0d}, + {0x03, 0xef, 0xbd, 0x1c}, + {0x03, 0xef, 0xbd, 0x02}, + {0x03, 0xef, 0xbd, 0x1f}, + {0x03, 0xef, 0xbd, 0x1d}, + {0x03, 0xef, 0xbd, 0x17}, + {0x03, 0xef, 0xbd, 0x08}, + {0x03, 0xef, 0xbd, 0x09}, + {0x03, 0xef, 0xbd, 0x0e}, + {0x03, 0xef, 0xbd, 0x04}, + {0x03, 0xef, 0xbd, 0x05}, + {0x03, 0xef, 0xbe, 0x3f}, + {0x03, 0xef, 0xbe, 0x00}, + {0x03, 0xef, 0xbd, 0x2c}, + {0x03, 0xef, 0xbe, 0x06}, + {0x03, 0xef, 0xbe, 0x0c}, + {0x03, 0xef, 0xbe, 0x0f}, + {0x03, 0xef, 0xbe, 0x0d}, + {0x03, 0xef, 0xbe, 0x0b}, + {0x03, 0xef, 0xbe, 0x19}, + {0x03, 0xef, 0xbe, 0x15}, + {0x03, 0xef, 0xbe, 0x11}, + {0x03, 0xef, 0xbe, 0x31}, + {0x03, 0xef, 0xbe, 0x33}, + {0x03, 0xef, 0xbd, 0x0f}, + {0x03, 0xef, 0xbe, 0x30}, + {0x03, 0xef, 0xbe, 0x3e}, + {0x03, 0xef, 0xbe, 0x32}, + {0x03, 0xef, 0xbe, 0x36}, + {0x03, 0xef, 0xbd, 0x14}, + {0x03, 0xef, 0xbe, 0x2e}, + {0x03, 0xef, 0xbd, 0x1e}, + {0x03, 0xef, 0xbe, 0x10}, + {0x03, 0xef, 0xbf, 0x13}, + {0x03, 0xef, 0xbf, 0x15}, + {0x03, 0xef, 0xbf, 0x17}, + {0x03, 0xef, 0xbf, 0x1f}, + {0x03, 0xef, 0xbf, 0x1d}, + {0x03, 0xef, 0xbf, 0x1b}, + {0x03, 0xef, 0xbf, 0x09}, + {0x03, 0xef, 0xbf, 0x0b}, + {0x03, 0xef, 0xbf, 0x37}, + {0x03, 0xef, 0xbe, 0x04}, + {0x01, 0xe0, 0x00, 0x00}, + {0x03, 0xe2, 0xa6, 0x1a}, + {0x03, 0xe2, 0xa6, 0x26}, + {0x03, 0xe3, 0x80, 0x23}, + {0x03, 0xe3, 0x80, 0x2e}, + {0x03, 0xe3, 0x80, 0x25}, + {0x03, 0xe3, 0x83, 0x1e}, + {0x03, 0xe3, 0x83, 0x14}, + {0x03, 0xe3, 0x82, 0x06}, + {0x03, 0xe3, 0x82, 0x0b}, + {0x03, 0xe3, 0x82, 0x0c}, + {0x03, 0xe3, 0x82, 0x0d}, + {0x03, 0xe3, 0x82, 0x02}, + {0x03, 0xe3, 0x83, 0x0f}, + {0x03, 0xe3, 0x83, 0x08}, + {0x03, 0xe3, 0x83, 0x09}, + {0x03, 0xe3, 0x83, 0x2c}, + {0x03, 0xe3, 0x83, 0x0c}, + {0x03, 0xe3, 0x82, 0x13}, + {0x03, 0xe3, 0x82, 0x16}, + {0x03, 0xe3, 0x82, 0x15}, + {0x03, 0xe3, 0x82, 0x1c}, + {0x03, 0xe3, 0x82, 0x1f}, + {0x03, 0xe3, 0x82, 0x1d}, + {0x03, 0xe3, 0x82, 0x1a}, + {0x03, 0xe3, 0x82, 0x17}, + {0x03, 0xe3, 0x82, 0x08}, + {0x03, 0xe3, 0x82, 0x09}, + {0x03, 0xe3, 0x82, 0x0e}, + {0x03, 0xe3, 0x82, 0x04}, + {0x03, 0xe3, 0x82, 0x05}, + {0x03, 0xe3, 0x82, 0x3f}, + {0x03, 0xe3, 0x83, 0x00}, + {0x03, 0xe3, 0x83, 0x06}, + {0x03, 0xe3, 0x83, 0x05}, + {0x03, 0xe3, 0x83, 0x0d}, + {0x03, 0xe3, 0x83, 0x0b}, + {0x03, 0xe3, 0x83, 0x07}, + {0x03, 0xe3, 0x83, 0x19}, + {0x03, 0xe3, 0x83, 0x15}, + {0x03, 0xe3, 0x83, 0x11}, + {0x03, 0xe3, 0x83, 0x31}, + {0x03, 0xe3, 0x83, 0x33}, + {0x03, 0xe3, 0x83, 0x30}, + {0x03, 0xe3, 0x83, 0x3e}, + {0x03, 0xe3, 0x83, 0x32}, + {0x03, 0xe3, 0x83, 0x36}, + {0x03, 0xe3, 0x83, 0x2e}, + {0x03, 0xe3, 0x82, 0x07}, + {0x03, 0xe3, 0x85, 0x04}, + {0x03, 0xe3, 0x84, 0x10}, + {0x03, 0xe3, 0x85, 0x30}, + {0x03, 0xe3, 0x85, 0x0d}, + {0x03, 0xe3, 0x85, 0x13}, + {0x03, 0xe3, 0x85, 0x15}, + {0x03, 0xe3, 0x85, 0x17}, + {0x03, 0xe3, 0x85, 0x1f}, + {0x03, 0xe3, 0x85, 0x1d}, + {0x03, 0xe3, 0x85, 0x1b}, + {0x03, 0xe3, 0x85, 0x09}, + {0x03, 0xe3, 0x85, 0x0f}, + {0x03, 0xe3, 0x85, 0x0b}, + {0x03, 0xe3, 0x85, 0x37}, + {0x03, 0xe3, 0x85, 0x3b}, + {0x03, 0xe3, 0x85, 0x39}, + {0x03, 0xe3, 0x85, 0x3f}, + {0x02, 0xc2, 0x02, 0x00}, + {0x02, 0xc2, 0x0e, 0x00}, + {0x02, 0xc2, 0x0c, 0x00}, + {0x02, 0xc2, 0x00, 0x00}, + {0x03, 0xe2, 0x82, 0x0f}, + {0x03, 0xe2, 0x94, 0x2a}, + {0x03, 0xe2, 0x86, 0x39}, + {0x03, 0xe2, 0x86, 0x3b}, + {0x03, 0xe2, 0x86, 0x3f}, + {0x03, 0xe2, 0x96, 0x0d}, + {0x03, 0xe2, 0x97, 0x25}, +} + +// Total table size 15512 bytes (15KiB) diff --git a/vendor/gomodules.xyz/jsonpatch/v2/jsonpatch.go b/vendor/gomodules.xyz/jsonpatch/v2/jsonpatch.go index a411d542..0d7823b3 100644 --- a/vendor/gomodules.xyz/jsonpatch/v2/jsonpatch.go +++ b/vendor/gomodules.xyz/jsonpatch/v2/jsonpatch.go @@ -1,6 +1,7 @@ package jsonpatch import ( + "bytes" "encoding/json" "fmt" "reflect" @@ -64,6 +65,9 @@ func NewOperation(op, path string, value interface{}) Operation { // // An error will be returned if any of the two documents are invalid. func CreatePatch(a, b []byte) ([]Operation, error) { + if bytes.Equal(a, b) { + return []Operation{}, nil + } var aI interface{} var bI interface{} err := json.Unmarshal(a, &aI) diff --git a/vendor/gomodules.xyz/logs/lib.go b/vendor/gomodules.xyz/logs/lib.go index 3bec711b..03a8214f 100644 --- a/vendor/gomodules.xyz/logs/lib.go +++ b/vendor/gomodules.xyz/logs/lib.go @@ -37,9 +37,12 @@ const logFlushFreqFlagName = "log-flush-frequency" var logFlushFreq = pflag.Duration(logFlushFreqFlagName, 5*time.Second, "Maximum number of seconds between log flushes") -func init() { - _ = flag.Set("stderrthreshold", "INFO") -} +/* +panic: flag stderrthreshold set before being defined +*/ +// func init() { +// _ = flag.Set("stderrthreshold", "INFO") +// } // AddFlags registers this package's flags on arbitrary FlagSets, such that they point to the // same value as the global flags. diff --git a/vendor/modules.txt b/vendor/modules.txt index b06187d3..bf2fc4a7 100644 --- a/vendor/modules.txt +++ b/vendor/modules.txt @@ -401,7 +401,7 @@ github.com/zclconf/go-cty/cty/function/stdlib github.com/zclconf/go-cty/cty/gocty github.com/zclconf/go-cty/cty/json github.com/zclconf/go-cty/cty/set -# go.bytebuilders.dev/license-verifier v0.13.2 +# go.bytebuilders.dev/license-verifier v0.13.3 ## explicit; go 1.18 go.bytebuilders.dev/license-verifier/apis/licenses go.bytebuilders.dev/license-verifier/info @@ -420,10 +420,10 @@ go.uber.org/zap/internal/bufferpool go.uber.org/zap/internal/color go.uber.org/zap/internal/exit go.uber.org/zap/zapcore -# golang.org/x/crypto v0.9.0 +# golang.org/x/crypto v0.13.0 ## explicit; go 1.17 golang.org/x/crypto/blake2b -# golang.org/x/net v0.10.0 +# golang.org/x/net v0.15.0 ## explicit; go 1.17 golang.org/x/net/context golang.org/x/net/html @@ -437,17 +437,17 @@ golang.org/x/net/idna ## explicit; go 1.17 golang.org/x/oauth2 golang.org/x/oauth2/internal -# golang.org/x/sys v0.8.0 +# golang.org/x/sys v0.12.0 ## explicit; go 1.17 golang.org/x/sys/cpu golang.org/x/sys/internal/unsafeheader golang.org/x/sys/plan9 golang.org/x/sys/unix golang.org/x/sys/windows -# golang.org/x/term v0.8.0 +# golang.org/x/term v0.12.0 ## explicit; go 1.17 golang.org/x/term -# golang.org/x/text v0.9.0 +# golang.org/x/text v0.13.0 ## explicit; go 1.17 golang.org/x/text/encoding golang.org/x/text/encoding/charmap @@ -479,10 +479,10 @@ gomodules.xyz/clock # gomodules.xyz/flags v0.1.3 ## explicit; go 1.16 gomodules.xyz/flags -# gomodules.xyz/jsonpatch/v2 v2.3.0 +# gomodules.xyz/jsonpatch/v2 v2.4.0 ## explicit; go 1.20 gomodules.xyz/jsonpatch/v2 -# gomodules.xyz/logs v0.0.6 +# gomodules.xyz/logs v0.0.7 ## explicit; go 1.16 gomodules.xyz/logs # gomodules.xyz/sets v0.2.1 @@ -936,7 +936,6 @@ sigs.k8s.io/cluster-api-provider-aws/v2/api/v1beta1 sigs.k8s.io/cluster-api-provider-aws/v2/api/v1beta2 sigs.k8s.io/cluster-api-provider-aws/v2/controlplane/eks/api/v1beta1 sigs.k8s.io/cluster-api-provider-aws/v2/controlplane/eks/api/v1beta2 -sigs.k8s.io/cluster-api-provider-aws/v2/exp/api/v1beta2 sigs.k8s.io/cluster-api-provider-aws/v2/feature sigs.k8s.io/cluster-api-provider-aws/v2/iam/api/v1beta1 sigs.k8s.io/cluster-api-provider-aws/v2/pkg/eks diff --git a/vendor/sigs.k8s.io/cluster-api-provider-aws/v2/exp/api/v1beta2/awsfargateprofile_types.go b/vendor/sigs.k8s.io/cluster-api-provider-aws/v2/exp/api/v1beta2/awsfargateprofile_types.go deleted file mode 100644 index 35317aff..00000000 --- a/vendor/sigs.k8s.io/cluster-api-provider-aws/v2/exp/api/v1beta2/awsfargateprofile_types.go +++ /dev/null @@ -1,163 +0,0 @@ -/* -Copyright 2022 The Kubernetes Authors. - -Licensed under the Apache License, Version 2.0 (the "License"); -you may not use this file except in compliance with the License. -You may obtain a copy of the License at - - http://www.apache.org/licenses/LICENSE-2.0 - -Unless required by applicable law or agreed to in writing, software -distributed under the License is distributed on an "AS IS" BASIS, -WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied. -See the License for the specific language governing permissions and -limitations under the License. -*/ - -package v1beta2 - -import ( - "fmt" - - metav1 "k8s.io/apimachinery/pkg/apis/meta/v1" - - infrav1 "sigs.k8s.io/cluster-api-provider-aws/v2/api/v1beta2" - iamv1 "sigs.k8s.io/cluster-api-provider-aws/v2/iam/api/v1beta1" - clusterv1 "sigs.k8s.io/cluster-api/api/v1beta1" - "sigs.k8s.io/cluster-api/errors" -) - -var ( - // DefaultEKSFargateRole is the name of the default IAM role to use for fargate - // profiles if no other role is supplied in the spec and if iam role creation - // is not enabled. The default can be created using clusterawsadm or created manually. - DefaultEKSFargateRole = fmt.Sprintf("eks-fargate%s", iamv1.DefaultNameSuffix) -) - -// FargateProfileSpec defines the desired state of FargateProfile. -type FargateProfileSpec struct { - // ClusterName is the name of the Cluster this object belongs to. - // +kubebuilder:validation:MinLength=1 - ClusterName string `json:"clusterName"` - - // ProfileName specifies the profile name. - ProfileName string `json:"profileName,omitempty"` - - // SubnetIDs specifies which subnets are used for the - // auto scaling group of this nodegroup. - // +optional - SubnetIDs []string `json:"subnetIDs,omitempty"` - - // AdditionalTags is an optional set of tags to add to AWS resources managed by the AWS provider, in addition to the - // ones added by default. - // +optional - AdditionalTags infrav1.Tags `json:"additionalTags,omitempty"` - - // RoleName specifies the name of IAM role for this fargate pool - // If the role is pre-existing we will treat it as unmanaged - // and not delete it on deletion. If the EKSEnableIAM feature - // flag is true and no name is supplied then a role is created. - // +optional - RoleName string `json:"roleName,omitempty"` - - // Selectors specify fargate pod selectors. - Selectors []FargateSelector `json:"selectors,omitempty"` -} - -// FargateSelector specifies a selector for pods that should run on this fargate pool. -type FargateSelector struct { - // Labels specifies which pod labels this selector should match. - Labels map[string]string `json:"labels,omitempty"` - - // Namespace specifies which namespace this selector should match. - Namespace string `json:"namespace,omitempty"` -} - -// FargateProfileStatus defines the observed state of FargateProfile. -type FargateProfileStatus struct { - // Ready denotes that the FargateProfile is available. - // +kubebuilder:default=false - Ready bool `json:"ready"` - - // FailureReason will be set in the event that there is a terminal problem - // reconciling the FargateProfile and will contain a succinct value suitable - // for machine interpretation. - // - // This field should not be set for transitive errors that a controller - // faces that are expected to be fixed automatically over - // time (like service outages), but instead indicate that something is - // fundamentally wrong with the FargateProfile's spec or the configuration of - // the controller, and that manual intervention is required. Examples - // of terminal errors would be invalid combinations of settings in the - // spec, values that are unsupported by the controller, or the - // responsible controller itself being critically misconfigured. - // - // Any transient errors that occur during the reconciliation of - // FargateProfiles can be added as events to the FargateProfile object - // and/or logged in the controller's output. - // +optional - FailureReason *errors.MachineStatusError `json:"failureReason,omitempty"` - - // FailureMessage will be set in the event that there is a terminal problem - // reconciling the FargateProfile and will contain a more verbose string suitable - // for logging and human consumption. - // - // This field should not be set for transitive errors that a controller - // faces that are expected to be fixed automatically over - // time (like service outages), but instead indicate that something is - // fundamentally wrong with the FargateProfile's spec or the configuration of - // the controller, and that manual intervention is required. Examples - // of terminal errors would be invalid combinations of settings in the - // spec, values that are unsupported by the controller, or the - // responsible controller itself being critically misconfigured. - // - // Any transient errors that occur during the reconciliation of - // FargateProfiles can be added as events to the FargateProfile - // object and/or logged in the controller's output. - // +optional - FailureMessage *string `json:"failureMessage,omitempty"` - - // Conditions defines current state of the Fargate profile. - // +optional - Conditions clusterv1.Conditions `json:"conditions,omitempty"` -} - -// +kubebuilder:object:root=true -// +kubebuilder:resource:path=awsfargateprofiles,scope=Namespaced,categories=cluster-api,shortName=awsfp -// +kubebuilder:storageversion -// +kubebuilder:subresource:status -// +kubebuilder:printcolumn:name="Ready",type="string",JSONPath=".status.ready",description="AWSFargateProfile ready status" -// +kubebuilder:printcolumn:name="ProfileName",type="string",JSONPath=".spec.profileName",description="EKS Fargate profile name" -// +kubebuilder:printcolumn:name="FailureReason",type="string",JSONPath=".status.failureReason",description="Failure reason" - -// AWSFargateProfile is the Schema for the awsfargateprofiles API. -type AWSFargateProfile struct { - metav1.TypeMeta `json:",inline"` - metav1.ObjectMeta `json:"metadata,omitempty"` - - Spec FargateProfileSpec `json:"spec,omitempty"` - Status FargateProfileStatus `json:"status,omitempty"` -} - -// GetConditions returns the observations of the operational state of the AWSFargateProfile resource. -func (r *AWSFargateProfile) GetConditions() clusterv1.Conditions { - return r.Status.Conditions -} - -// SetConditions sets the underlying service state of the AWSFargateProfile to the predescribed clusterv1.Conditions. -func (r *AWSFargateProfile) SetConditions(conditions clusterv1.Conditions) { - r.Status.Conditions = conditions -} - -// +kubebuilder:object:root=true - -// AWSFargateProfileList contains a list of FargateProfiles. -type AWSFargateProfileList struct { - metav1.TypeMeta `json:",inline"` - metav1.ListMeta `json:"metadata,omitempty"` - Items []AWSFargateProfile `json:"items"` -} - -func init() { - SchemeBuilder.Register(&AWSFargateProfile{}, &AWSFargateProfileList{}) -} diff --git a/vendor/sigs.k8s.io/cluster-api-provider-aws/v2/exp/api/v1beta2/awsfargateprofile_webhook.go b/vendor/sigs.k8s.io/cluster-api-provider-aws/v2/exp/api/v1beta2/awsfargateprofile_webhook.go deleted file mode 100644 index da67c9e1..00000000 --- a/vendor/sigs.k8s.io/cluster-api-provider-aws/v2/exp/api/v1beta2/awsfargateprofile_webhook.go +++ /dev/null @@ -1,153 +0,0 @@ -/* -Copyright 2022 The Kubernetes Authors. - -Licensed under the Apache License, Version 2.0 (the "License"); -you may not use this file except in compliance with the License. -You may obtain a copy of the License at - - http://www.apache.org/licenses/LICENSE-2.0 - -Unless required by applicable law or agreed to in writing, software -distributed under the License is distributed on an "AS IS" BASIS, -WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied. -See the License for the specific language governing permissions and -limitations under the License. -*/ - -package v1beta2 - -import ( - "fmt" - - "github.com/google/go-cmp/cmp" - "github.com/pkg/errors" - apierrors "k8s.io/apimachinery/pkg/api/errors" - "k8s.io/apimachinery/pkg/runtime" - "k8s.io/apimachinery/pkg/util/validation/field" - ctrl "sigs.k8s.io/controller-runtime" - "sigs.k8s.io/controller-runtime/pkg/webhook" - - "sigs.k8s.io/cluster-api-provider-aws/v2/pkg/eks" - clusterv1 "sigs.k8s.io/cluster-api/api/v1beta1" -) - -const ( - maxProfileNameLength = 100 - maxIAMRoleNameLength = 64 -) - -// SetupWebhookWithManager will setup the webhooks for the AWSFargateProfile. -func (r *AWSFargateProfile) SetupWebhookWithManager(mgr ctrl.Manager) error { - return ctrl.NewWebhookManagedBy(mgr). - For(r). - Complete() -} - -// +kubebuilder:webhook:verbs=create;update,path=/mutate-infrastructure-cluster-x-k8s-io-v1beta2-awsfargateprofile,mutating=true,failurePolicy=fail,matchPolicy=Equivalent,groups=infrastructure.cluster.x-k8s.io,resources=awsfargateprofiles,versions=v1beta2,name=default.awsfargateprofile.infrastructure.cluster.x-k8s.io,sideEffects=None,admissionReviewVersions=v1;v1beta1 -// +kubebuilder:webhook:verbs=create;update,path=/validate-infrastructure-cluster-x-k8s-io-v1beta2-awsfargateprofile,mutating=false,failurePolicy=fail,matchPolicy=Equivalent,groups=infrastructure.cluster.x-k8s.io,resources=awsfargateprofiles,versions=v1beta2,name=validation.awsfargateprofile.infrastructure.cluster.x-k8s.io,sideEffects=None,admissionReviewVersions=v1;v1beta1 - -var _ webhook.Defaulter = &AWSFargateProfile{} -var _ webhook.Validator = &AWSFargateProfile{} - -// Default will set default values for the AWSFargateProfile. -func (r *AWSFargateProfile) Default() { - if r.Labels == nil { - r.Labels = make(map[string]string) - } - r.Labels[clusterv1.ClusterNameLabel] = r.Spec.ClusterName - - if r.Spec.ProfileName == "" { - name, err := eks.GenerateEKSName(r.Name, r.Namespace, maxProfileNameLength) - if err != nil { - mmpLog.Error(err, "failed to create EKS nodegroup name") - return - } - - r.Spec.ProfileName = name - } -} - -// ValidateUpdate implements webhook.Validator so a webhook will be registered for the type. -func (r *AWSFargateProfile) ValidateUpdate(oldObj runtime.Object) error { - gv := r.GroupVersionKind().GroupKind() - old, ok := oldObj.(*AWSFargateProfile) - if !ok { - return apierrors.NewInvalid(gv, r.Name, field.ErrorList{ - field.InternalError(nil, errors.Errorf("failed to convert old %s to object", gv.Kind)), - }) - } - - var allErrs field.ErrorList - - // Spec is immutable, but if the new RoleName is the generated one(or default if EnableIAM is disabled) and - // the old RoleName is nil, then ignore checking that field. - if old.Spec.RoleName == "" { - roleName, err := eks.GenerateEKSName( - "fargate", - fmt.Sprintf("%s-%s", r.Spec.ClusterName, r.Spec.ProfileName), - maxIAMRoleNameLength, - ) - if err != nil { - mmpLog.Error(err, "failed to create EKS fargate role name") - } - - if r.Spec.RoleName == roleName || r.Spec.RoleName == DefaultEKSFargateRole { - r.Spec.RoleName = "" - } - } - - // Spec is immutable, but if the new ProfileName is the defaulted one and - // the old ProfileName is nil, then ignore checking that field. - if old.Spec.ProfileName == "" { - name, err := eks.GenerateEKSName(old.Name, old.Namespace, maxProfileNameLength) - if err != nil { - mmpLog.Error(err, "failed to create EKS nodegroup name") - } - if r.Spec.ProfileName == name { - r.Spec.ProfileName = "" - } - } - - allErrs = append(allErrs, r.Spec.AdditionalTags.Validate()...) - // remove additionalTags from equal check since they are mutable - old.Spec.AdditionalTags = nil - r.Spec.AdditionalTags = nil - - if !cmp.Equal(old.Spec, r.Spec) { - allErrs = append( - allErrs, - field.Invalid(field.NewPath("spec"), r.Spec, "is immutable"), - ) - } - - if len(allErrs) == 0 { - return nil - } - - return apierrors.NewInvalid( - gv, - r.Name, - allErrs, - ) -} - -// ValidateCreate implements webhook.Validator so a webhook will be registered for the type. -func (r *AWSFargateProfile) ValidateCreate() error { - var allErrs field.ErrorList - - allErrs = append(allErrs, r.Spec.AdditionalTags.Validate()...) - - if len(allErrs) == 0 { - return nil - } - return apierrors.NewInvalid( - r.GroupVersionKind().GroupKind(), - r.Name, - allErrs, - ) -} - -// ValidateDelete implements webhook.Validator so a webhook will be registered for the type. -func (r *AWSFargateProfile) ValidateDelete() error { - return nil -} diff --git a/vendor/sigs.k8s.io/cluster-api-provider-aws/v2/exp/api/v1beta2/awsmachinepool_types.go b/vendor/sigs.k8s.io/cluster-api-provider-aws/v2/exp/api/v1beta2/awsmachinepool_types.go deleted file mode 100644 index 6173f351..00000000 --- a/vendor/sigs.k8s.io/cluster-api-provider-aws/v2/exp/api/v1beta2/awsmachinepool_types.go +++ /dev/null @@ -1,292 +0,0 @@ -/* -Copyright 2022 The Kubernetes Authors. - -Licensed under the Apache License, Version 2.0 (the "License"); -you may not use this file except in compliance with the License. -You may obtain a copy of the License at - - http://www.apache.org/licenses/LICENSE-2.0 - -Unless required by applicable law or agreed to in writing, software -distributed under the License is distributed on an "AS IS" BASIS, -WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied. -See the License for the specific language governing permissions and -limitations under the License. -*/ - -package v1beta2 - -import ( - "reflect" - - metav1 "k8s.io/apimachinery/pkg/apis/meta/v1" - "k8s.io/apimachinery/pkg/runtime/schema" - - infrav1 "sigs.k8s.io/cluster-api-provider-aws/v2/api/v1beta2" - clusterv1 "sigs.k8s.io/cluster-api/api/v1beta1" - "sigs.k8s.io/cluster-api/errors" -) - -// Constants block. -const ( - // LaunchTemplateLatestVersion defines the launching of the latest version of the template. - LaunchTemplateLatestVersion = "$Latest" -) - -// AWSMachinePoolSpec defines the desired state of AWSMachinePool. -type AWSMachinePoolSpec struct { - // ProviderID is the ARN of the associated ASG - // +optional - ProviderID string `json:"providerID,omitempty"` - - // MinSize defines the minimum size of the group. - // +kubebuilder:default=1 - // +kubebuilder:validation:Minimum=0 - MinSize int32 `json:"minSize"` - - // MaxSize defines the maximum size of the group. - // +kubebuilder:default=1 - // +kubebuilder:validation:Minimum=1 - MaxSize int32 `json:"maxSize"` - - // AvailabilityZones is an array of availability zones instances can run in - AvailabilityZones []string `json:"availabilityZones,omitempty"` - - // Subnets is an array of subnet configurations - // +optional - Subnets []infrav1.AWSResourceReference `json:"subnets,omitempty"` - - // AdditionalTags is an optional set of tags to add to an instance, in addition to the ones added by default by the - // AWS provider. - // +optional - AdditionalTags infrav1.Tags `json:"additionalTags,omitempty"` - - // AWSLaunchTemplate specifies the launch template and version to use when an instance is launched. - // +kubebuilder:validation:Required - AWSLaunchTemplate AWSLaunchTemplate `json:"awsLaunchTemplate"` - - // MixedInstancesPolicy describes how multiple instance types will be used by the ASG. - MixedInstancesPolicy *MixedInstancesPolicy `json:"mixedInstancesPolicy,omitempty"` - - // ProviderIDList are the identification IDs of machine instances provided by the provider. - // This field must match the provider IDs as seen on the node objects corresponding to a machine pool's machine instances. - // +optional - ProviderIDList []string `json:"providerIDList,omitempty"` - - // The amount of time, in seconds, after a scaling activity completes before another scaling activity can start. - // If no value is supplied by user a default value of 300 seconds is set - // +optional - DefaultCoolDown metav1.Duration `json:"defaultCoolDown,omitempty"` - - // RefreshPreferences describes set of preferences associated with the instance refresh request. - // +optional - RefreshPreferences *RefreshPreferences `json:"refreshPreferences,omitempty"` - - // Enable or disable the capacity rebalance autoscaling group feature - // +optional - CapacityRebalance bool `json:"capacityRebalance,omitempty"` - - // SuspendProcesses defines a list of processes to suspend for the given ASG. This is constantly reconciled. - // If a process is removed from this list it will automatically be resumed. - SuspendProcesses *SuspendProcessesTypes `json:"suspendProcesses,omitempty"` -} - -// SuspendProcessesTypes contains user friendly auto-completable values for suspended process names. -type SuspendProcessesTypes struct { - All bool `json:"all,omitempty"` - Processes *Processes `json:"processes,omitempty"` -} - -// Processes defines the processes which can be enabled or disabled individually. -type Processes struct { - Launch *bool `json:"launch,omitempty"` - Terminate *bool `json:"terminate,omitempty"` - AddToLoadBalancer *bool `json:"addToLoadBalancer,omitempty"` - AlarmNotification *bool `json:"alarmNotification,omitempty"` - AZRebalance *bool `json:"azRebalance,omitempty"` - HealthCheck *bool `json:"healthCheck,omitempty"` - InstanceRefresh *bool `json:"instanceRefresh,omitempty"` - ReplaceUnhealthy *bool `json:"replaceUnhealthy,omitempty"` - ScheduledActions *bool `json:"scheduledActions,omitempty"` -} - -// ConvertSetValuesToStringSlice converts all the values that are set into a string slice for further processing. -func (s *SuspendProcessesTypes) ConvertSetValuesToStringSlice() []string { - if s == nil { - return nil - } - - if s.Processes == nil { - s.Processes = &Processes{} - } - - e := reflect.ValueOf(s.Processes).Elem() - var result []string - for i := 0; i < e.NumField(); i++ { - if s.All { - if !e.Field(i).IsNil() && !*e.Field(i).Interface().(*bool) { - // don't enable if explicitly set to false. - continue - } - result = append(result, e.Type().Field(i).Name) - } else if !e.Field(i).IsNil() && *e.Field(i).Interface().(*bool) { - result = append(result, e.Type().Field(i).Name) - } - } - - return result -} - -// RefreshPreferences defines the specs for instance refreshing. -type RefreshPreferences struct { - // Disable, if true, disables instance refresh from triggering when new launch templates are detected. - // This is useful in scenarios where ASG nodes are externally managed. - // +optional - Disable bool `json:"disable,omitempty"` - - // The strategy to use for the instance refresh. The only valid value is Rolling. - // A rolling update is an update that is applied to all instances in an Auto - // Scaling group until all instances have been updated. - // +optional - Strategy *string `json:"strategy,omitempty"` - - // The number of seconds until a newly launched instance is configured and ready - // to use. During this time, the next replacement will not be initiated. - // The default is to use the value for the health check grace period defined for the group. - // +optional - InstanceWarmup *int64 `json:"instanceWarmup,omitempty"` - - // The amount of capacity as a percentage in ASG that must remain healthy - // during an instance refresh. The default is 90. - // +optional - MinHealthyPercentage *int64 `json:"minHealthyPercentage,omitempty"` -} - -// AWSMachinePoolStatus defines the observed state of AWSMachinePool. -type AWSMachinePoolStatus struct { - // Ready is true when the provider resource is ready. - // +optional - Ready bool `json:"ready"` - - // Replicas is the most recently observed number of replicas - // +optional - Replicas int32 `json:"replicas"` - - // Conditions defines current service state of the AWSMachinePool. - // +optional - Conditions clusterv1.Conditions `json:"conditions,omitempty"` - - // Instances contains the status for each instance in the pool - // +optional - Instances []AWSMachinePoolInstanceStatus `json:"instances,omitempty"` - - // The ID of the launch template - LaunchTemplateID string `json:"launchTemplateID,omitempty"` - - // The version of the launch template - // +optional - LaunchTemplateVersion *string `json:"launchTemplateVersion,omitempty"` - - // FailureReason will be set in the event that there is a terminal problem - // reconciling the Machine and will contain a succinct value suitable - // for machine interpretation. - // - // This field should not be set for transitive errors that a controller - // faces that are expected to be fixed automatically over - // time (like service outages), but instead indicate that something is - // fundamentally wrong with the Machine's spec or the configuration of - // the controller, and that manual intervention is required. Examples - // of terminal errors would be invalid combinations of settings in the - // spec, values that are unsupported by the controller, or the - // responsible controller itself being critically misconfigured. - // - // Any transient errors that occur during the reconciliation of Machines - // can be added as events to the Machine object and/or logged in the - // controller's output. - // +optional - FailureReason *errors.MachineStatusError `json:"failureReason,omitempty"` - - // FailureMessage will be set in the event that there is a terminal problem - // reconciling the Machine and will contain a more verbose string suitable - // for logging and human consumption. - // - // This field should not be set for transitive errors that a controller - // faces that are expected to be fixed automatically over - // time (like service outages), but instead indicate that something is - // fundamentally wrong with the Machine's spec or the configuration of - // the controller, and that manual intervention is required. Examples - // of terminal errors would be invalid combinations of settings in the - // spec, values that are unsupported by the controller, or the - // responsible controller itself being critically misconfigured. - // - // Any transient errors that occur during the reconciliation of Machines - // can be added as events to the Machine object and/or logged in the - // controller's output. - // +optional - FailureMessage *string `json:"failureMessage,omitempty"` - - ASGStatus *ASGStatus `json:"asgStatus,omitempty"` -} - -// AWSMachinePoolInstanceStatus defines the status of the AWSMachinePoolInstance. -type AWSMachinePoolInstanceStatus struct { - // InstanceID is the identification of the Machine Instance within ASG - // +optional - InstanceID string `json:"instanceID,omitempty"` - - // Version defines the Kubernetes version for the Machine Instance - // +optional - Version *string `json:"version,omitempty"` -} - -// +kubebuilder:object:root=true -// +kubebuilder:subresource:status -// +kubebuilder:storageversion -// +kubebuilder:resource:path=awsmachinepools,scope=Namespaced,categories=cluster-api,shortName=awsmp -// +kubebuilder:printcolumn:name="Ready",type="string",JSONPath=".status.ready",description="Machine ready status" -// +kubebuilder:printcolumn:name="Replicas",type="integer",JSONPath=".status.replicas",description="Machine ready status" -// +kubebuilder:printcolumn:name="MinSize",type="integer",JSONPath=".spec.minSize",description="Minimum instanes in ASG" -// +kubebuilder:printcolumn:name="MaxSize",type="integer",JSONPath=".spec.maxSize",description="Maximum instanes in ASG" -// +kubebuilder:printcolumn:name="LaunchTemplate ID",type="string",JSONPath=".status.launchTemplateID",description="Launch Template ID" - -// AWSMachinePool is the Schema for the awsmachinepools API. -type AWSMachinePool struct { - metav1.TypeMeta `json:",inline"` - metav1.ObjectMeta `json:"metadata,omitempty"` - - Spec AWSMachinePoolSpec `json:"spec,omitempty"` - Status AWSMachinePoolStatus `json:"status,omitempty"` -} - -// +kubebuilder:object:root=true - -// AWSMachinePoolList contains a list of AWSMachinePool. -type AWSMachinePoolList struct { - metav1.TypeMeta `json:",inline"` - metav1.ListMeta `json:"metadata,omitempty"` - Items []AWSMachinePool `json:"items"` -} - -func init() { - SchemeBuilder.Register(&AWSMachinePool{}, &AWSMachinePoolList{}) -} - -// GetConditions returns the observations of the operational state of the AWSMachinePool resource. -func (r *AWSMachinePool) GetConditions() clusterv1.Conditions { - return r.Status.Conditions -} - -// SetConditions sets the underlying service state of the AWSMachinePool to the predescribed clusterv1.Conditions. -func (r *AWSMachinePool) SetConditions(conditions clusterv1.Conditions) { - r.Status.Conditions = conditions -} - -// GetObjectKind will return the ObjectKind of an AWSMachinePool. -func (r *AWSMachinePool) GetObjectKind() schema.ObjectKind { - return &r.TypeMeta -} - -// GetObjectKind will return the ObjectKind of an AWSMachinePoolList. -func (r *AWSMachinePoolList) GetObjectKind() schema.ObjectKind { - return &r.TypeMeta -} diff --git a/vendor/sigs.k8s.io/cluster-api-provider-aws/v2/exp/api/v1beta2/awsmachinepool_webhook.go b/vendor/sigs.k8s.io/cluster-api-provider-aws/v2/exp/api/v1beta2/awsmachinepool_webhook.go deleted file mode 100644 index 8ff20aa8..00000000 --- a/vendor/sigs.k8s.io/cluster-api-provider-aws/v2/exp/api/v1beta2/awsmachinepool_webhook.go +++ /dev/null @@ -1,165 +0,0 @@ -/* -Copyright 2022 The Kubernetes Authors. - -Licensed under the Apache License, Version 2.0 (the "License"); -you may not use this file except in compliance with the License. -You may obtain a copy of the License at - - http://www.apache.org/licenses/LICENSE-2.0 - -Unless required by applicable law or agreed to in writing, software -distributed under the License is distributed on an "AS IS" BASIS, -WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied. -See the License for the specific language governing permissions and -limitations under the License. -*/ - -package v1beta2 - -import ( - "time" - - apierrors "k8s.io/apimachinery/pkg/api/errors" - "k8s.io/apimachinery/pkg/runtime" - "k8s.io/apimachinery/pkg/util/validation/field" - "k8s.io/klog/v2" - ctrl "sigs.k8s.io/controller-runtime" - "sigs.k8s.io/controller-runtime/pkg/webhook" - - "sigs.k8s.io/cluster-api-provider-aws/v2/api/v1beta2" -) - -var log = ctrl.Log.WithName("awsmachinepool-resource") - -// SetupWebhookWithManager will setup the webhooks for the AWSMachinePool. -func (r *AWSMachinePool) SetupWebhookWithManager(mgr ctrl.Manager) error { - return ctrl.NewWebhookManagedBy(mgr). - For(r). - Complete() -} - -// +kubebuilder:webhook:verbs=create;update,path=/validate-infrastructure-cluster-x-k8s-io-v1beta2-awsmachinepool,mutating=false,failurePolicy=fail,matchPolicy=Equivalent,groups=infrastructure.cluster.x-k8s.io,resources=awsmachinepools,versions=v1beta2,name=validation.awsmachinepool.infrastructure.cluster.x-k8s.io,sideEffects=None,admissionReviewVersions=v1;v1beta1 -// +kubebuilder:webhook:verbs=create;update,path=/mutate-infrastructure-cluster-x-k8s-io-v1beta2-awsmachinepool,mutating=true,failurePolicy=fail,matchPolicy=Equivalent,groups=infrastructure.cluster.x-k8s.io,resources=awsmachinepools,versions=v1beta2,name=default.awsmachinepool.infrastructure.cluster.x-k8s.io,sideEffects=None,admissionReviewVersions=v1;v1beta1 - -var _ webhook.Defaulter = &AWSMachinePool{} -var _ webhook.Validator = &AWSMachinePool{} - -func (r *AWSMachinePool) validateDefaultCoolDown() field.ErrorList { - var allErrs field.ErrorList - - if int(r.Spec.DefaultCoolDown.Duration.Seconds()) < 0 { - allErrs = append(allErrs, field.Required(field.NewPath("spec.DefaultCoolDown"), "DefaultCoolDown must be greater than zero")) - } - - return allErrs -} - -func (r *AWSMachinePool) validateRootVolume() field.ErrorList { - var allErrs field.ErrorList - - if r.Spec.AWSLaunchTemplate.RootVolume == nil { - return allErrs - } - - if v1beta2.VolumeTypesProvisioned.Has(string(r.Spec.AWSLaunchTemplate.RootVolume.Type)) && r.Spec.AWSLaunchTemplate.RootVolume.IOPS == 0 { - allErrs = append(allErrs, field.Required(field.NewPath("spec.awsLaunchTemplate.rootVolume.iops"), "iops required if type is 'io1' or 'io2'")) - } - - if r.Spec.AWSLaunchTemplate.RootVolume.Throughput != nil { - if r.Spec.AWSLaunchTemplate.RootVolume.Type != v1beta2.VolumeTypeGP3 { - allErrs = append(allErrs, field.Required(field.NewPath("spec.awsLaunchTemplate.rootVolume.throughput"), "throughput is valid only for type 'gp3'")) - } - if *r.Spec.AWSLaunchTemplate.RootVolume.Throughput < 0 { - allErrs = append(allErrs, field.Required(field.NewPath("spec.awsLaunchTemplate.rootVolume.throughput"), "throughput must be nonnegative")) - } - } - - if r.Spec.AWSLaunchTemplate.RootVolume.DeviceName != "" { - log.Info("root volume shouldn't have a device name (this can be ignored if performing a `clusterctl move`)") - } - - return allErrs -} - -func (r *AWSMachinePool) validateSubnets() field.ErrorList { - var allErrs field.ErrorList - - if r.Spec.Subnets == nil { - return allErrs - } - - for _, subnet := range r.Spec.Subnets { - if subnet.ID != nil && subnet.Filters != nil { - allErrs = append(allErrs, field.Forbidden(field.NewPath("spec.subnets.filters"), "providing either subnet ID or filter is supported, should not provide both")) - break - } - } - - return allErrs -} - -func (r *AWSMachinePool) validateAdditionalSecurityGroups() field.ErrorList { - var allErrs field.ErrorList - for _, sg := range r.Spec.AWSLaunchTemplate.AdditionalSecurityGroups { - if sg.ID != nil && sg.Filters != nil { - allErrs = append(allErrs, field.Forbidden(field.NewPath("spec.awsLaunchTemplate.AdditionalSecurityGroups"), "either ID or filters should be used")) - } - } - return allErrs -} - -// ValidateCreate will do any extra validation when creating a AWSMachinePool. -func (r *AWSMachinePool) ValidateCreate() error { - log.Info("AWSMachinePool validate create", "machine-pool", klog.KObj(r)) - - var allErrs field.ErrorList - - allErrs = append(allErrs, r.validateDefaultCoolDown()...) - allErrs = append(allErrs, r.validateRootVolume()...) - allErrs = append(allErrs, r.Spec.AdditionalTags.Validate()...) - allErrs = append(allErrs, r.validateSubnets()...) - allErrs = append(allErrs, r.validateAdditionalSecurityGroups()...) - - if len(allErrs) == 0 { - return nil - } - - return apierrors.NewInvalid( - r.GroupVersionKind().GroupKind(), - r.Name, - allErrs, - ) -} - -// ValidateUpdate will do any extra validation when updating a AWSMachinePool. -func (r *AWSMachinePool) ValidateUpdate(old runtime.Object) error { - var allErrs field.ErrorList - - allErrs = append(allErrs, r.validateDefaultCoolDown()...) - allErrs = append(allErrs, r.Spec.AdditionalTags.Validate()...) - allErrs = append(allErrs, r.validateSubnets()...) - allErrs = append(allErrs, r.validateAdditionalSecurityGroups()...) - - if len(allErrs) == 0 { - return nil - } - - return apierrors.NewInvalid( - r.GroupVersionKind().GroupKind(), - r.Name, - allErrs, - ) -} - -// ValidateDelete allows you to add any extra validation when deleting. -func (r *AWSMachinePool) ValidateDelete() error { - return nil -} - -// Default will set default values for the AWSMachinePool. -func (r *AWSMachinePool) Default() { - if int(r.Spec.DefaultCoolDown.Duration.Seconds()) == 0 { - log.Info("DefaultCoolDown is zero, setting 300 seconds as default") - r.Spec.DefaultCoolDown.Duration = 300 * time.Second - } -} diff --git a/vendor/sigs.k8s.io/cluster-api-provider-aws/v2/exp/api/v1beta2/awsmanagedmachinepool_types.go b/vendor/sigs.k8s.io/cluster-api-provider-aws/v2/exp/api/v1beta2/awsmanagedmachinepool_types.go deleted file mode 100644 index d6ef952d..00000000 --- a/vendor/sigs.k8s.io/cluster-api-provider-aws/v2/exp/api/v1beta2/awsmanagedmachinepool_types.go +++ /dev/null @@ -1,273 +0,0 @@ -/* -Copyright 2022 The Kubernetes Authors. - -Licensed under the Apache License, Version 2.0 (the "License"); -you may not use this file except in compliance with the License. -You may obtain a copy of the License at - - http://www.apache.org/licenses/LICENSE-2.0 - -Unless required by applicable law or agreed to in writing, software -distributed under the License is distributed on an "AS IS" BASIS, -WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied. -See the License for the specific language governing permissions and -limitations under the License. -*/ - -package v1beta2 - -import ( - "fmt" - - metav1 "k8s.io/apimachinery/pkg/apis/meta/v1" - - infrav1 "sigs.k8s.io/cluster-api-provider-aws/v2/api/v1beta2" - iamv1 "sigs.k8s.io/cluster-api-provider-aws/v2/iam/api/v1beta1" - clusterv1 "sigs.k8s.io/cluster-api/api/v1beta1" - "sigs.k8s.io/cluster-api/errors" -) - -// ManagedMachineAMIType specifies which AWS AMI to use for a managed MachinePool. -type ManagedMachineAMIType string - -const ( - // Al2x86_64 is the default AMI type. - Al2x86_64 ManagedMachineAMIType = "AL2_x86_64" - // Al2x86_64GPU is the x86-64 GPU AMI type. - Al2x86_64GPU ManagedMachineAMIType = "AL2_x86_64_GPU" - // Al2Arm64 is the Arm AMI type. - Al2Arm64 ManagedMachineAMIType = "AL2_ARM_64" -) - -// ManagedMachinePoolCapacityType specifies the capacity type to be used for the managed MachinePool. -type ManagedMachinePoolCapacityType string - -const ( - // ManagedMachinePoolCapacityTypeOnDemand is the default capacity type, to launch on-demand instances. - ManagedMachinePoolCapacityTypeOnDemand ManagedMachinePoolCapacityType = "onDemand" - // ManagedMachinePoolCapacityTypeSpot is the spot instance capacity type to launch spot instances. - ManagedMachinePoolCapacityTypeSpot ManagedMachinePoolCapacityType = "spot" -) - -var ( - // DefaultEKSNodegroupRole is the name of the default IAM role to use for EKS nodegroups - // if no other role is supplied in the spec and if iam role creation is not enabled. The default - // can be created using clusterawsadm or created manually. - DefaultEKSNodegroupRole = fmt.Sprintf("eks-nodegroup%s", iamv1.DefaultNameSuffix) -) - -// AWSManagedMachinePoolSpec defines the desired state of AWSManagedMachinePool. -type AWSManagedMachinePoolSpec struct { - // EKSNodegroupName specifies the name of the nodegroup in AWS - // corresponding to this MachinePool. If you don't specify a name - // then a default name will be created based on the namespace and - // name of the managed machine pool. - // +optional - EKSNodegroupName string `json:"eksNodegroupName,omitempty"` - - // AvailabilityZones is an array of availability zones instances can run in - AvailabilityZones []string `json:"availabilityZones,omitempty"` - - // SubnetIDs specifies which subnets are used for the - // auto scaling group of this nodegroup - // +optional - SubnetIDs []string `json:"subnetIDs,omitempty"` - - // AdditionalTags is an optional set of tags to add to AWS resources managed by the AWS provider, in addition to the - // ones added by default. - // +optional - AdditionalTags infrav1.Tags `json:"additionalTags,omitempty"` - - // RoleAdditionalPolicies allows you to attach additional polices to - // the node group role. You must enable the EKSAllowAddRoles - // feature flag to incorporate these into the created role. - // +optional - RoleAdditionalPolicies []string `json:"roleAdditionalPolicies,omitempty"` - - // RoleName specifies the name of IAM role for the node group. - // If the role is pre-existing we will treat it as unmanaged - // and not delete it on deletion. If the EKSEnableIAM feature - // flag is true and no name is supplied then a role is created. - // +optional - RoleName string `json:"roleName,omitempty"` - - // AMIVersion defines the desired AMI release version. If no version number - // is supplied then the latest version for the Kubernetes version - // will be used - // +kubebuilder:validation:MinLength:=2 - // +optional - AMIVersion *string `json:"amiVersion,omitempty"` - - // AMIType defines the AMI type - // +kubebuilder:validation:Enum:=AL2_x86_64;AL2_x86_64_GPU;AL2_ARM_64;CUSTOM - // +kubebuilder:default:=AL2_x86_64 - // +optional - AMIType *ManagedMachineAMIType `json:"amiType,omitempty"` - - // Labels specifies labels for the Kubernetes node objects - // +optional - Labels map[string]string `json:"labels,omitempty"` - - // Taints specifies the taints to apply to the nodes of the machine pool - // +optional - Taints Taints `json:"taints,omitempty"` - - // DiskSize specifies the root disk size - // +optional - DiskSize *int32 `json:"diskSize,omitempty"` - - // InstanceType specifies the AWS instance type - // +optional - InstanceType *string `json:"instanceType,omitempty"` - - // Scaling specifies scaling for the ASG behind this pool - // +optional - Scaling *ManagedMachinePoolScaling `json:"scaling,omitempty"` - - // RemoteAccess specifies how machines can be accessed remotely - // +optional - RemoteAccess *ManagedRemoteAccess `json:"remoteAccess,omitempty"` - - // ProviderIDList are the provider IDs of instances in the - // autoscaling group corresponding to the nodegroup represented by this - // machine pool - // +optional - ProviderIDList []string `json:"providerIDList,omitempty"` - - // CapacityType specifies the capacity type for the ASG behind this pool - // +kubebuilder:validation:Enum:=onDemand;spot - // +kubebuilder:default:=onDemand - // +optional - CapacityType *ManagedMachinePoolCapacityType `json:"capacityType,omitempty"` - - // UpdateConfig holds the optional config to control the behaviour of the update - // to the nodegroup. - // +optional - UpdateConfig *UpdateConfig `json:"updateConfig,omitempty"` - - // AWSLaunchTemplate specifies the launch template to use to create the managed node group. - // If AWSLaunchTemplate is specified, certain node group configuraions outside of launch template - // are prohibited (https://docs.aws.amazon.com/eks/latest/userguide/launch-templates.html). - // +optional - AWSLaunchTemplate *AWSLaunchTemplate `json:"awsLaunchTemplate,omitempty"` -} - -// ManagedMachinePoolScaling specifies scaling options. -type ManagedMachinePoolScaling struct { - MinSize *int32 `json:"minSize,omitempty"` - MaxSize *int32 `json:"maxSize,omitempty"` -} - -// ManagedRemoteAccess specifies remote access settings for EC2 instances. -type ManagedRemoteAccess struct { - // SSHKeyName specifies which EC2 SSH key can be used to access machines. - // If left empty, the key from the control plane is used. - SSHKeyName *string `json:"sshKeyName,omitempty"` - - // SourceSecurityGroups specifies which security groups are allowed access - SourceSecurityGroups []string `json:"sourceSecurityGroups,omitempty"` - - // Public specifies whether to open port 22 to the public internet - Public bool `json:"public,omitempty"` -} - -// AWSManagedMachinePoolStatus defines the observed state of AWSManagedMachinePool. -type AWSManagedMachinePoolStatus struct { - // Ready denotes that the AWSManagedMachinePool nodegroup has joined - // the cluster - // +kubebuilder:default=false - Ready bool `json:"ready"` - - // Replicas is the most recently observed number of replicas. - // +optional - Replicas int32 `json:"replicas"` - - // The ID of the launch template - // +optional - LaunchTemplateID *string `json:"launchTemplateID,omitempty"` - - // The version of the launch template - // +optional - LaunchTemplateVersion *string `json:"launchTemplateVersion,omitempty"` - - // FailureReason will be set in the event that there is a terminal problem - // reconciling the MachinePool and will contain a succinct value suitable - // for machine interpretation. - // - // This field should not be set for transitive errors that a controller - // faces that are expected to be fixed automatically over - // time (like service outages), but instead indicate that something is - // fundamentally wrong with the Machine's spec or the configuration of - // the controller, and that manual intervention is required. Examples - // of terminal errors would be invalid combinations of settings in the - // spec, values that are unsupported by the controller, or the - // responsible controller itself being critically misconfigured. - // - // Any transient errors that occur during the reconciliation of MachinePools - // can be added as events to the MachinePool object and/or logged in the - // controller's output. - // +optional - FailureReason *errors.MachineStatusError `json:"failureReason,omitempty"` - - // FailureMessage will be set in the event that there is a terminal problem - // reconciling the MachinePool and will contain a more verbose string suitable - // for logging and human consumption. - // - // This field should not be set for transitive errors that a controller - // faces that are expected to be fixed automatically over - // time (like service outages), but instead indicate that something is - // fundamentally wrong with the MachinePool's spec or the configuration of - // the controller, and that manual intervention is required. Examples - // of terminal errors would be invalid combinations of settings in the - // spec, values that are unsupported by the controller, or the - // responsible controller itself being critically misconfigured. - // - // Any transient errors that occur during the reconciliation of MachinePools - // can be added as events to the MachinePool object and/or logged in the - // controller's output. - // +optional - FailureMessage *string `json:"failureMessage,omitempty"` - - // Conditions defines current service state of the managed machine pool - // +optional - Conditions clusterv1.Conditions `json:"conditions,omitempty"` -} - -// +kubebuilder:object:root=true -// +kubebuilder:resource:path=awsmanagedmachinepools,scope=Namespaced,categories=cluster-api,shortName=awsmmp -// +kubebuilder:storageversion -// +kubebuilder:subresource:status -// +kubebuilder:printcolumn:name="Ready",type="string",JSONPath=".status.ready",description="MachinePool ready status" -// +kubebuilder:printcolumn:name="Replicas",type="integer",JSONPath=".status.replicas",description="Number of replicas" - -// AWSManagedMachinePool is the Schema for the awsmanagedmachinepools API. -type AWSManagedMachinePool struct { - metav1.TypeMeta `json:",inline"` - metav1.ObjectMeta `json:"metadata,omitempty"` - - Spec AWSManagedMachinePoolSpec `json:"spec,omitempty"` - Status AWSManagedMachinePoolStatus `json:"status,omitempty"` -} - -// GetConditions returns the observations of the operational state of the AWSManagedMachinePool resource. -func (r *AWSManagedMachinePool) GetConditions() clusterv1.Conditions { - return r.Status.Conditions -} - -// SetConditions sets the underlying service state of the AWSManagedMachinePool to the predescribed clusterv1.Conditions. -func (r *AWSManagedMachinePool) SetConditions(conditions clusterv1.Conditions) { - r.Status.Conditions = conditions -} - -// +kubebuilder:object:root=true - -// AWSManagedMachinePoolList contains a list of AWSManagedMachinePools. -type AWSManagedMachinePoolList struct { - metav1.TypeMeta `json:",inline"` - metav1.ListMeta `json:"metadata,omitempty"` - Items []AWSManagedMachinePool `json:"items"` -} - -func init() { - SchemeBuilder.Register(&AWSManagedMachinePool{}, &AWSManagedMachinePoolList{}) -} diff --git a/vendor/sigs.k8s.io/cluster-api-provider-aws/v2/exp/api/v1beta2/awsmanagedmachinepool_webhook.go b/vendor/sigs.k8s.io/cluster-api-provider-aws/v2/exp/api/v1beta2/awsmanagedmachinepool_webhook.go deleted file mode 100644 index 00aeaec6..00000000 --- a/vendor/sigs.k8s.io/cluster-api-provider-aws/v2/exp/api/v1beta2/awsmanagedmachinepool_webhook.go +++ /dev/null @@ -1,281 +0,0 @@ -/* -Copyright 2022 The Kubernetes Authors. - -Licensed under the Apache License, Version 2.0 (the "License"); -you may not use this file except in compliance with the License. -You may obtain a copy of the License at - - http://www.apache.org/licenses/LICENSE-2.0 - -Unless required by applicable law or agreed to in writing, software -distributed under the License is distributed on an "AS IS" BASIS, -WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied. -See the License for the specific language governing permissions and -limitations under the License. -*/ - -package v1beta2 - -import ( - "fmt" - "reflect" - - "github.com/google/go-cmp/cmp" - "github.com/pkg/errors" - apierrors "k8s.io/apimachinery/pkg/api/errors" - "k8s.io/apimachinery/pkg/runtime" - "k8s.io/apimachinery/pkg/util/validation/field" - "k8s.io/klog/v2" - "k8s.io/utils/pointer" - ctrl "sigs.k8s.io/controller-runtime" - "sigs.k8s.io/controller-runtime/pkg/webhook" - - "sigs.k8s.io/cluster-api-provider-aws/v2/pkg/eks" -) - -const ( - maxNodegroupNameLength = 64 -) - -// log is for logging in this package. -var mmpLog = ctrl.Log.WithName("awsmanagedmachinepool-resource") - -// SetupWebhookWithManager will setup the webhooks for the AWSManagedMachinePool. -func (r *AWSManagedMachinePool) SetupWebhookWithManager(mgr ctrl.Manager) error { - return ctrl.NewWebhookManagedBy(mgr). - For(r). - Complete() -} - -// +kubebuilder:webhook:verbs=create;update,path=/validate-infrastructure-cluster-x-k8s-io-v1beta2-awsmanagedmachinepool,mutating=false,failurePolicy=fail,matchPolicy=Equivalent,groups=infrastructure.cluster.x-k8s.io,resources=awsmanagedmachinepools,versions=v1beta2,name=validation.awsmanagedmachinepool.infrastructure.cluster.x-k8s.io,sideEffects=None,admissionReviewVersions=v1;v1beta1 -// +kubebuilder:webhook:verbs=create;update,path=/mutate-infrastructure-cluster-x-k8s-io-v1beta2-awsmanagedmachinepool,mutating=true,failurePolicy=fail,matchPolicy=Equivalent,groups=infrastructure.cluster.x-k8s.io,resources=awsmanagedmachinepools,versions=v1beta2,name=default.awsmanagedmachinepool.infrastructure.cluster.x-k8s.io,sideEffects=None,admissionReviewVersions=v1;v1beta1 - -var _ webhook.Defaulter = &AWSManagedMachinePool{} -var _ webhook.Validator = &AWSManagedMachinePool{} - -func (r *AWSManagedMachinePool) validateScaling() field.ErrorList { - var allErrs field.ErrorList - if r.Spec.Scaling != nil { //nolint:nestif - minField := field.NewPath("spec", "scaling", "minSize") - maxField := field.NewPath("spec", "scaling", "maxSize") - min := r.Spec.Scaling.MinSize - max := r.Spec.Scaling.MaxSize - if min != nil { - if *min < 0 { - allErrs = append(allErrs, field.Invalid(minField, *min, "must be greater or equal zero")) - } - if max != nil && *max < *min { - allErrs = append(allErrs, field.Invalid(maxField, *max, fmt.Sprintf("must be greater than field %s", minField.String()))) - } - } - if max != nil && *max < 0 { - allErrs = append(allErrs, field.Invalid(maxField, *max, "must be greater than zero")) - } - } - if len(allErrs) == 0 { - return nil - } - return allErrs -} - -func (r *AWSManagedMachinePool) validateNodegroupUpdateConfig() field.ErrorList { - var allErrs field.ErrorList - - if r.Spec.UpdateConfig != nil { - nodegroupUpdateConfigField := field.NewPath("spec", "updateConfig") - - if r.Spec.UpdateConfig.MaxUnavailable == nil && r.Spec.UpdateConfig.MaxUnavailablePercentage == nil { - allErrs = append(allErrs, field.Invalid(nodegroupUpdateConfigField, r.Spec.UpdateConfig, "must specify one of maxUnavailable or maxUnavailablePercentage when using nodegroup updateconfig")) - } - - if r.Spec.UpdateConfig.MaxUnavailable != nil && r.Spec.UpdateConfig.MaxUnavailablePercentage != nil { - allErrs = append(allErrs, field.Invalid(nodegroupUpdateConfigField, r.Spec.UpdateConfig, "cannot specify both maxUnavailable and maxUnavailablePercentage")) - } - } - - if len(allErrs) == 0 { - return nil - } - return allErrs -} - -func (r *AWSManagedMachinePool) validateRemoteAccess() field.ErrorList { - var allErrs field.ErrorList - if r.Spec.RemoteAccess == nil { - return allErrs - } - remoteAccessPath := field.NewPath("spec", "remoteAccess") - sourceSecurityGroups := r.Spec.RemoteAccess.SourceSecurityGroups - - if public := r.Spec.RemoteAccess.Public; public && len(sourceSecurityGroups) > 0 { - allErrs = append( - allErrs, - field.Invalid(remoteAccessPath.Child("sourceSecurityGroups"), sourceSecurityGroups, "must be empty if public is set"), - ) - } - - return allErrs -} - -func (r *AWSManagedMachinePool) validateLaunchTemplate() field.ErrorList { - var allErrs field.ErrorList - if r.Spec.AWSLaunchTemplate == nil { - return allErrs - } - - if r.Spec.InstanceType != nil { - allErrs = append(allErrs, field.Invalid(field.NewPath("spec", "InstanceType"), r.Spec.InstanceType, "InstanceType cannot be specified when LaunchTemplate is specified")) - } - if r.Spec.DiskSize != nil { - allErrs = append(allErrs, field.Invalid(field.NewPath("spec", "DiskSize"), r.Spec.DiskSize, "DiskSize cannot be specified when LaunchTemplate is specified")) - } - - if r.Spec.AWSLaunchTemplate.IamInstanceProfile != "" { - allErrs = append(allErrs, field.Invalid(field.NewPath("spec", "AWSLaunchTemplate", "IamInstanceProfile"), r.Spec.AWSLaunchTemplate.IamInstanceProfile, "IAM instance profile in launch template is prohibited in EKS managed node group")) - } - - return allErrs -} - -// ValidateCreate will do any extra validation when creating a AWSManagedMachinePool. -func (r *AWSManagedMachinePool) ValidateCreate() error { - mmpLog.Info("AWSManagedMachinePool validate create", "managed-machine-pool", klog.KObj(r)) - - var allErrs field.ErrorList - - if r.Spec.EKSNodegroupName == "" { - allErrs = append(allErrs, field.Required(field.NewPath("spec.eksNodegroupName"), "eksNodegroupName is required")) - } - if errs := r.validateScaling(); errs != nil || len(errs) == 0 { - allErrs = append(allErrs, errs...) - } - if errs := r.validateRemoteAccess(); len(errs) > 0 { - allErrs = append(allErrs, errs...) - } - if errs := r.validateNodegroupUpdateConfig(); len(errs) > 0 { - allErrs = append(allErrs, errs...) - } - if errs := r.validateLaunchTemplate(); len(errs) > 0 { - allErrs = append(allErrs, errs...) - } - - allErrs = append(allErrs, r.Spec.AdditionalTags.Validate()...) - - if len(allErrs) == 0 { - return nil - } - - return apierrors.NewInvalid( - r.GroupVersionKind().GroupKind(), - r.Name, - allErrs, - ) -} - -// ValidateUpdate will do any extra validation when updating a AWSManagedMachinePool. -func (r *AWSManagedMachinePool) ValidateUpdate(old runtime.Object) error { - mmpLog.Info("AWSManagedMachinePool validate update", "managed-machine-pool", klog.KObj(r)) - oldPool, ok := old.(*AWSManagedMachinePool) - if !ok { - return apierrors.NewInvalid(GroupVersion.WithKind("AWSManagedMachinePool").GroupKind(), r.Name, field.ErrorList{ - field.InternalError(nil, errors.New("failed to convert old AWSManagedMachinePool to object")), - }) - } - - var allErrs field.ErrorList - allErrs = append(allErrs, r.validateImmutable(oldPool)...) - allErrs = append(allErrs, r.Spec.AdditionalTags.Validate()...) - - if errs := r.validateScaling(); errs != nil || len(errs) == 0 { - allErrs = append(allErrs, errs...) - } - if errs := r.validateNodegroupUpdateConfig(); len(errs) > 0 { - allErrs = append(allErrs, errs...) - } - if errs := r.validateLaunchTemplate(); len(errs) > 0 { - allErrs = append(allErrs, errs...) - } - - if len(allErrs) == 0 { - return nil - } - - return apierrors.NewInvalid( - r.GroupVersionKind().GroupKind(), - r.Name, - allErrs, - ) -} - -// ValidateDelete allows you to add any extra validation when deleting. -func (r *AWSManagedMachinePool) ValidateDelete() error { - mmpLog.Info("AWSManagedMachinePool validate delete", "managed-machine-pool", klog.KObj(r)) - - return nil -} - -func (r *AWSManagedMachinePool) validateImmutable(old *AWSManagedMachinePool) field.ErrorList { - var allErrs field.ErrorList - - appendErrorIfMutated := func(old, update interface{}, name string) { - if !cmp.Equal(old, update) { - allErrs = append( - allErrs, - field.Invalid(field.NewPath("spec", name), update, "field is immutable"), - ) - } - } - appendErrorIfSetAndMutated := func(old, update interface{}, name string) { - if !reflect.ValueOf(old).IsZero() && !cmp.Equal(old, update) { - allErrs = append( - allErrs, - field.Invalid(field.NewPath("spec", name), update, "field is immutable"), - ) - } - } - - if old.Spec.EKSNodegroupName != "" { - appendErrorIfMutated(old.Spec.EKSNodegroupName, r.Spec.EKSNodegroupName, "eksNodegroupName") - } - appendErrorIfMutated(old.Spec.SubnetIDs, r.Spec.SubnetIDs, "subnetIDs") - appendErrorIfSetAndMutated(old.Spec.RoleName, r.Spec.RoleName, "roleName") - appendErrorIfMutated(old.Spec.DiskSize, r.Spec.DiskSize, "diskSize") - appendErrorIfMutated(old.Spec.AMIType, r.Spec.AMIType, "amiType") - appendErrorIfMutated(old.Spec.RemoteAccess, r.Spec.RemoteAccess, "remoteAccess") - appendErrorIfSetAndMutated(old.Spec.CapacityType, r.Spec.CapacityType, "capacityType") - if (old.Spec.AWSLaunchTemplate != nil && r.Spec.AWSLaunchTemplate == nil) || - (old.Spec.AWSLaunchTemplate == nil && r.Spec.AWSLaunchTemplate != nil) { - allErrs = append( - allErrs, - field.Invalid(field.NewPath("spec", "AWSLaunchTemplate"), old.Spec.AWSLaunchTemplate, "field is immutable"), - ) - } - if old.Spec.AWSLaunchTemplate != nil && r.Spec.AWSLaunchTemplate != nil { - appendErrorIfMutated(old.Spec.AWSLaunchTemplate.Name, r.Spec.AWSLaunchTemplate.Name, "awsLaunchTemplate.name") - } - - return allErrs -} - -// Default will set default values for the AWSManagedMachinePool. -func (r *AWSManagedMachinePool) Default() { - mmpLog.Info("AWSManagedMachinePool setting defaults", "managed-machine-pool", klog.KObj(r)) - - if r.Spec.EKSNodegroupName == "" { - mmpLog.Info("EKSNodegroupName is empty, generating name") - name, err := eks.GenerateEKSName(r.Name, r.Namespace, maxNodegroupNameLength) - if err != nil { - mmpLog.Error(err, "failed to create EKS nodegroup name") - return - } - - mmpLog.Info("Generated EKSNodegroupName", "nodegroup", klog.KRef(r.Namespace, name)) - r.Spec.EKSNodegroupName = name - } - - if r.Spec.UpdateConfig == nil { - r.Spec.UpdateConfig = &UpdateConfig{ - MaxUnavailable: pointer.Int(1), - } - } -} diff --git a/vendor/sigs.k8s.io/cluster-api-provider-aws/v2/exp/api/v1beta2/conditions_consts.go b/vendor/sigs.k8s.io/cluster-api-provider-aws/v2/exp/api/v1beta2/conditions_consts.go deleted file mode 100644 index deff1a8c..00000000 --- a/vendor/sigs.k8s.io/cluster-api-provider-aws/v2/exp/api/v1beta2/conditions_consts.go +++ /dev/null @@ -1,104 +0,0 @@ -/* -Copyright 2022 The Kubernetes Authors. - -Licensed under the Apache License, Version 2.0 (the "License"); -you may not use this file except in compliance with the License. -You may obtain a copy of the License at - - http://www.apache.org/licenses/LICENSE-2.0 - -Unless required by applicable law or agreed to in writing, software -distributed under the License is distributed on an "AS IS" BASIS, -WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied. -See the License for the specific language governing permissions and -limitations under the License. -*/ - -package v1beta2 - -import clusterv1 "sigs.k8s.io/cluster-api/api/v1beta1" - -const ( - // ASGReadyCondition reports on current status of the autoscaling group. Ready indicates the group is provisioned. - ASGReadyCondition clusterv1.ConditionType = "ASGReady" - // ASGNotFoundReason used when the autoscaling group couldn't be retrieved. - ASGNotFoundReason = "ASGNotFound" - // ASGProvisionFailedReason used for failures during autoscaling group provisioning. - ASGProvisionFailedReason = "ASGProvisionFailed" - // ASGDeletionInProgress ASG is in a deletion in progress state. - ASGDeletionInProgress = "ASGDeletionInProgress" - - // LaunchTemplateReadyCondition represents the status of an AWSMachinePool's associated Launch Template. - LaunchTemplateReadyCondition clusterv1.ConditionType = "LaunchTemplateReady" - // LaunchTemplateNotFoundReason is used when an associated Launch Template can't be found. - LaunchTemplateNotFoundReason = "LaunchTemplateNotFound" - // LaunchTemplateCreateFailedReason used for failures during Launch Template creation. - LaunchTemplateCreateFailedReason = "LaunchTemplateCreateFailed" - // LaunchTemplateReconcileFailedReason used for failures during Launch Template reconciliation. - LaunchTemplateReconcileFailedReason = "LaunchTemplateReconcileFailed" - - // PreLaunchTemplateUpdateCheckCondition reports if all prerequisite are met for launch template update. - PreLaunchTemplateUpdateCheckCondition clusterv1.ConditionType = "PreLaunchTemplateUpdateCheckSuccess" - // PostLaunchTemplateUpdateOperationCondition reports on successfully completes post launch template update operation. - PostLaunchTemplateUpdateOperationCondition clusterv1.ConditionType = "PostLaunchTemplateUpdateOperationSuccess" - - // PreLaunchTemplateUpdateCheckFailedReason used to report when not all prerequisite are met for launch template update. - PreLaunchTemplateUpdateCheckFailedReason = "PreLaunchTemplateUpdateCheckFailed" - // PostLaunchTemplateUpdateOperationFailedReason used to report when post launch template update operation failed. - PostLaunchTemplateUpdateOperationFailedReason = "PostLaunchTemplateUpdateOperationFailed" - - // InstanceRefreshStartedCondition reports on successfully starting instance refresh. - InstanceRefreshStartedCondition clusterv1.ConditionType = "InstanceRefreshStarted" - // InstanceRefreshNotReadyReason used to report instance refresh is not initiated. - // If there are instance refreshes that are in progress, then a new instance refresh request will fail. - InstanceRefreshNotReadyReason = "InstanceRefreshNotReady" - // InstanceRefreshFailedReason used to report when there instance refresh is not initiated. - InstanceRefreshFailedReason = "InstanceRefreshFailed" -) - -const ( - // EKSNodegroupReadyCondition condition reports on the successful reconciliation of eks control plane. - EKSNodegroupReadyCondition clusterv1.ConditionType = "EKSNodegroupReady" - // EKSNodegroupReconciliationFailedReason used to report failures while reconciling EKS control plane. - EKSNodegroupReconciliationFailedReason = "EKSNodegroupReconciliationFailed" - // WaitingForEKSControlPlaneReason used when the machine pool is waiting for - // EKS control plane infrastructure to be ready before proceeding. - WaitingForEKSControlPlaneReason = "WaitingForEKSControlPlane" -) - -const ( - // EKSFargateProfileReadyCondition condition reports on the successful reconciliation of eks control plane. - EKSFargateProfileReadyCondition clusterv1.ConditionType = "EKSFargateProfileReady" - // EKSFargateCreatingCondition condition reports on whether the fargate - // profile is creating. - EKSFargateCreatingCondition clusterv1.ConditionType = "EKSFargateCreating" - // EKSFargateDeletingCondition used to report that the profile is deleting. - EKSFargateDeletingCondition = "EKSFargateDeleting" - // EKSFargateReconciliationFailedReason used to report failures while reconciling EKS control plane. - EKSFargateReconciliationFailedReason = "EKSFargateReconciliationFailed" - // EKSFargateDeletingReason used when the profile is deleting. - EKSFargateDeletingReason = "Deleting" - // EKSFargateCreatingReason used when the profile is creating. - EKSFargateCreatingReason = "Creating" - // EKSFargateCreatedReason used when the profile is created. - EKSFargateCreatedReason = "Created" - // EKSFargateDeletedReason used when the profile is deleted. - EKSFargateDeletedReason = "Deleted" - // EKSFargateFailedReason used when the profile failed. - EKSFargateFailedReason = "Failed" -) - -const ( - // IAMNodegroupRolesReadyCondition condition reports on the successful - // reconciliation of EKS nodegroup iam roles. - IAMNodegroupRolesReadyCondition clusterv1.ConditionType = "IAMNodegroupRolesReady" - // IAMNodegroupRolesReconciliationFailedReason used to report failures while - // reconciling EKS nodegroup iam roles. - IAMNodegroupRolesReconciliationFailedReason = "IAMNodegroupRolesReconciliationFailed" - // IAMFargateRolesReadyCondition condition reports on the successful - // reconciliation of EKS nodegroup iam roles. - IAMFargateRolesReadyCondition clusterv1.ConditionType = "IAMFargateRolesReady" - // IAMFargateRolesReconciliationFailedReason used to report failures while - // reconciling EKS nodegroup iam roles. - IAMFargateRolesReconciliationFailedReason = "IAMFargateRolesReconciliationFailed" -) diff --git a/vendor/sigs.k8s.io/cluster-api-provider-aws/v2/exp/api/v1beta2/conversion.go b/vendor/sigs.k8s.io/cluster-api-provider-aws/v2/exp/api/v1beta2/conversion.go deleted file mode 100644 index 6d354442..00000000 --- a/vendor/sigs.k8s.io/cluster-api-provider-aws/v2/exp/api/v1beta2/conversion.go +++ /dev/null @@ -1,35 +0,0 @@ -/* -Copyright 2022 The Kubernetes Authors. - -Licensed under the Apache License, Version 2.0 (the "License"); -you may not use this file except in compliance with the License. -You may obtain a copy of the License at - - http://www.apache.org/licenses/LICENSE-2.0 - -Unless required by applicable law or agreed to in writing, software -distributed under the License is distributed on an "AS IS" BASIS, -WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied. -See the License for the specific language governing permissions and -limitations under the License. -*/ - -package v1beta2 - -// Hub marks AWSMachinePool as a conversion hub. -func (*AWSMachinePool) Hub() {} - -// Hub marks AWSMachinePoolList as a conversion hub. -func (*AWSMachinePoolList) Hub() {} - -// Hub marks AWSManagedMachinePool as a conversion hub. -func (*AWSManagedMachinePool) Hub() {} - -// Hub marks AWSManagedMachinePoolList as a conversion hub. -func (*AWSManagedMachinePoolList) Hub() {} - -// Hub marks AWSFargateProfile as a conversion hub. -func (*AWSFargateProfile) Hub() {} - -// Hub marks AWSFargateProfileList as a conversion hub. -func (*AWSFargateProfileList) Hub() {} diff --git a/vendor/sigs.k8s.io/cluster-api-provider-aws/v2/exp/api/v1beta2/doc.go b/vendor/sigs.k8s.io/cluster-api-provider-aws/v2/exp/api/v1beta2/doc.go deleted file mode 100644 index b388d8f8..00000000 --- a/vendor/sigs.k8s.io/cluster-api-provider-aws/v2/exp/api/v1beta2/doc.go +++ /dev/null @@ -1,21 +0,0 @@ -/* -Copyright 2022 The Kubernetes Authors. - -Licensed under the Apache License, Version 2.0 (the "License"); -you may not use this file except in compliance with the License. -You may obtain a copy of the License at - - http://www.apache.org/licenses/LICENSE-2.0 - -Unless required by applicable law or agreed to in writing, software -distributed under the License is distributed on an "AS IS" BASIS, -WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied. -See the License for the specific language governing permissions and -limitations under the License. -*/ - -// +gencrdrefdocs:force -// +groupName=infrastructure.cluster.x-k8s.io -// +k8s:defaulter-gen=TypeMeta - -package v1beta2 diff --git a/vendor/sigs.k8s.io/cluster-api-provider-aws/v2/exp/api/v1beta2/finalizers.go b/vendor/sigs.k8s.io/cluster-api-provider-aws/v2/exp/api/v1beta2/finalizers.go deleted file mode 100644 index 045efb83..00000000 --- a/vendor/sigs.k8s.io/cluster-api-provider-aws/v2/exp/api/v1beta2/finalizers.go +++ /dev/null @@ -1,28 +0,0 @@ -/* -Copyright 2022 The Kubernetes Authors. - -Licensed under the Apache License, Version 2.0 (the "License"); -you may not use this file except in compliance with the License. -You may obtain a copy of the License at - - http://www.apache.org/licenses/LICENSE-2.0 - -Unless required by applicable law or agreed to in writing, software -distributed under the License is distributed on an "AS IS" BASIS, -WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied. -See the License for the specific language governing permissions and -limitations under the License. -*/ - -package v1beta2 - -const ( - // FargateProfileFinalizer allows the controller to clean up resources on delete. - FargateProfileFinalizer = "awsfargateprofile.infrastructure.cluster.x-k8s.io" - - // MachinePoolFinalizer is the finalizer for the machine pool. - MachinePoolFinalizer = "awsmachinepool.infrastructure.cluster.x-k8s.io" - - // ManagedMachinePoolFinalizer allows the controller to clean up resources on delete. - ManagedMachinePoolFinalizer = "awsmanagedmachinepools.infrastructure.cluster.x-k8s.io" -) diff --git a/vendor/sigs.k8s.io/cluster-api-provider-aws/v2/exp/api/v1beta2/groupversion_info.go b/vendor/sigs.k8s.io/cluster-api-provider-aws/v2/exp/api/v1beta2/groupversion_info.go deleted file mode 100644 index a54b837a..00000000 --- a/vendor/sigs.k8s.io/cluster-api-provider-aws/v2/exp/api/v1beta2/groupversion_info.go +++ /dev/null @@ -1,36 +0,0 @@ -/* -Copyright 2022 The Kubernetes Authors. - -Licensed under the Apache License, Version 2.0 (the "License"); -you may not use this file except in compliance with the License. -You may obtain a copy of the License at - - http://www.apache.org/licenses/LICENSE-2.0 - -Unless required by applicable law or agreed to in writing, software -distributed under the License is distributed on an "AS IS" BASIS, -WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied. -See the License for the specific language governing permissions and -limitations under the License. -*/ - -// package v1beta2 contains API Schema definitions for experimental v1beta2 API group -// +kubebuilder:object:generate=true -// +groupName=infrastructure.cluster.x-k8s.io -package v1beta2 - -import ( - "k8s.io/apimachinery/pkg/runtime/schema" - "sigs.k8s.io/controller-runtime/pkg/scheme" -) - -var ( - // GroupVersion is group version used to register these objects. - GroupVersion = schema.GroupVersion{Group: "infrastructure.cluster.x-k8s.io", Version: "v1beta2"} - - // SchemeBuilder is used to add go types to the GroupVersionKind scheme. - SchemeBuilder = &scheme.Builder{GroupVersion: GroupVersion} - - // AddToScheme adds the types in this group-version to the given scheme. - AddToScheme = SchemeBuilder.AddToScheme -) diff --git a/vendor/sigs.k8s.io/cluster-api-provider-aws/v2/exp/api/v1beta2/types.go b/vendor/sigs.k8s.io/cluster-api-provider-aws/v2/exp/api/v1beta2/types.go deleted file mode 100644 index 1cadc47d..00000000 --- a/vendor/sigs.k8s.io/cluster-api-provider-aws/v2/exp/api/v1beta2/types.go +++ /dev/null @@ -1,281 +0,0 @@ -/* -Copyright 2022 The Kubernetes Authors. - -Licensed under the Apache License, Version 2.0 (the "License"); -you may not use this file except in compliance with the License. -You may obtain a copy of the License at - - http://www.apache.org/licenses/LICENSE-2.0 - -Unless required by applicable law or agreed to in writing, software -distributed under the License is distributed on an "AS IS" BASIS, -WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied. -See the License for the specific language governing permissions and -limitations under the License. -*/ - -package v1beta2 - -import ( - metav1 "k8s.io/apimachinery/pkg/apis/meta/v1" - - infrav1 "sigs.k8s.io/cluster-api-provider-aws/v2/api/v1beta2" -) - -const ( - // ExternalResourceGCAnnotation is the name of an annotation that indicates if - // external resources should be garbage collected for the cluster. - ExternalResourceGCAnnotation = "aws.cluster.x-k8s.io/external-resource-gc" -) - -// EBS can be used to automatically set up EBS volumes when an instance is launched. -type EBS struct { - // Encrypted is whether the volume should be encrypted or not. - // +optional - Encrypted bool `json:"encrypted,omitempty"` - - // The size of the volume, in GiB. - // This can be a number from 1-1,024 for standard, 4-16,384 for io1, 1-16,384 - // for gp2, and 500-16,384 for st1 and sc1. If you specify a snapshot, the volume - // size must be equal to or larger than the snapshot size. - // +optional - VolumeSize int64 `json:"volumeSize,omitempty"` - - // The volume type - // For more information, see Amazon EBS Volume Types (https://docs.aws.amazon.com/AWSEC2/latest/UserGuide/EBSVolumeTypes.html) - // +kubebuilder:validation:Enum=standard;io1;gp2;st1;sc1;io2 - // +optional - VolumeType string `json:"volumeType,omitempty"` -} - -// BlockDeviceMapping specifies the block devices for the instance. -// You can specify virtual devices and EBS volumes. -type BlockDeviceMapping struct { - // The device name exposed to the EC2 instance (for example, /dev/sdh or xvdh). - // +kubebuilder:validation:Required - DeviceName string `json:"deviceName,omitempty"` - - // You can specify either VirtualName or Ebs, but not both. - // +optional - Ebs EBS `json:"ebs,omitempty"` -} - -// AWSLaunchTemplate defines the desired state of AWSLaunchTemplate. -type AWSLaunchTemplate struct { - // The name of the launch template. - Name string `json:"name,omitempty"` - - // The name or the Amazon Resource Name (ARN) of the instance profile associated - // with the IAM role for the instance. The instance profile contains the IAM - // role. - IamInstanceProfile string `json:"iamInstanceProfile,omitempty"` - - // AMI is the reference to the AMI from which to create the machine instance. - // +optional - AMI infrav1.AMIReference `json:"ami,omitempty"` - - // ImageLookupFormat is the AMI naming format to look up the image for this - // machine It will be ignored if an explicit AMI is set. Supports - // substitutions for {{.BaseOS}} and {{.K8sVersion}} with the base OS and - // kubernetes version, respectively. The BaseOS will be the value in - // ImageLookupBaseOS or ubuntu (the default), and the kubernetes version as - // defined by the packages produced by kubernetes/release without v as a - // prefix: 1.13.0, 1.12.5-mybuild.1, or 1.17.3. For example, the default - // image format of capa-ami-{{.BaseOS}}-?{{.K8sVersion}}-* will end up - // searching for AMIs that match the pattern capa-ami-ubuntu-?1.18.0-* for a - // Machine that is targeting kubernetes v1.18.0 and the ubuntu base OS. See - // also: https://golang.org/pkg/text/template/ - // +optional - ImageLookupFormat string `json:"imageLookupFormat,omitempty"` - - // ImageLookupOrg is the AWS Organization ID to use for image lookup if AMI is not set. - ImageLookupOrg string `json:"imageLookupOrg,omitempty"` - - // ImageLookupBaseOS is the name of the base operating system to use for - // image lookup the AMI is not set. - ImageLookupBaseOS string `json:"imageLookupBaseOS,omitempty"` - - // InstanceType is the type of instance to create. Example: m4.xlarge - InstanceType string `json:"instanceType,omitempty"` - - // RootVolume encapsulates the configuration options for the root volume - // +optional - RootVolume *infrav1.Volume `json:"rootVolume,omitempty"` - - // SSHKeyName is the name of the ssh key to attach to the instance. Valid values are empty string - // (do not use SSH keys), a valid SSH key name, or omitted (use the default SSH key name) - // +optional - SSHKeyName *string `json:"sshKeyName,omitempty"` - - // VersionNumber is the version of the launch template that is applied. - // Typically a new version is created when at least one of the following happens: - // 1) A new launch template spec is applied. - // 2) One or more parameters in an existing template is changed. - // 3) A new AMI is discovered. - VersionNumber *int64 `json:"versionNumber,omitempty"` - - // AdditionalSecurityGroups is an array of references to security groups that should be applied to the - // instances. These security groups would be set in addition to any security groups defined - // at the cluster level or in the actuator. - // +optional - AdditionalSecurityGroups []infrav1.AWSResourceReference `json:"additionalSecurityGroups,omitempty"` - - // SpotMarketOptions are options for configuring AWSMachinePool instances to be run using AWS Spot instances. - SpotMarketOptions *infrav1.SpotMarketOptions `json:"spotMarketOptions,omitempty"` -} - -// Overrides are used to override the instance type specified by the launch template with multiple -// instance types that can be used to launch On-Demand Instances and Spot Instances. -type Overrides struct { - InstanceType string `json:"instanceType"` -} - -// OnDemandAllocationStrategy indicates how to allocate instance types to fulfill On-Demand capacity. -type OnDemandAllocationStrategy string - -var ( - // OnDemandAllocationStrategyPrioritized uses the order of instance type overrides - // for the LaunchTemplate to define the launch priority of each instance type. - OnDemandAllocationStrategyPrioritized = OnDemandAllocationStrategy("prioritized") -) - -// SpotAllocationStrategy indicates how to allocate instances across Spot Instance pools. -type SpotAllocationStrategy string - -var ( - // SpotAllocationStrategyLowestPrice will make the Auto Scaling group launch - // instances using the Spot pools with the lowest price, and evenly allocates - // your instances across the number of Spot pools that you specify. - SpotAllocationStrategyLowestPrice = SpotAllocationStrategy("lowest-price") - - // SpotAllocationStrategyCapacityOptimized will make the Auto Scaling group launch - // instances using Spot pools that are optimally chosen based on the available Spot capacity. - SpotAllocationStrategyCapacityOptimized = SpotAllocationStrategy("capacity-optimized") -) - -// InstancesDistribution to configure distribution of On-Demand Instances and Spot Instances. -type InstancesDistribution struct { - // +kubebuilder:validation:Enum=prioritized - // +kubebuilder:default=prioritized - OnDemandAllocationStrategy OnDemandAllocationStrategy `json:"onDemandAllocationStrategy,omitempty"` - - // +kubebuilder:validation:Enum=lowest-price;capacity-optimized - // +kubebuilder:default=lowest-price - SpotAllocationStrategy SpotAllocationStrategy `json:"spotAllocationStrategy,omitempty"` - - // +kubebuilder:default=0 - OnDemandBaseCapacity *int64 `json:"onDemandBaseCapacity,omitempty"` - - // +kubebuilder:default=100 - OnDemandPercentageAboveBaseCapacity *int64 `json:"onDemandPercentageAboveBaseCapacity,omitempty"` -} - -// MixedInstancesPolicy for an Auto Scaling group. -type MixedInstancesPolicy struct { - InstancesDistribution *InstancesDistribution `json:"instancesDistribution,omitempty"` - Overrides []Overrides `json:"overrides,omitempty"` -} - -// Tags is a mapping for tags. -type Tags map[string]string - -// AutoScalingGroup describes an AWS autoscaling group. -type AutoScalingGroup struct { - // The tags associated with the instance. - ID string `json:"id,omitempty"` - Tags infrav1.Tags `json:"tags,omitempty"` - Name string `json:"name,omitempty"` - DesiredCapacity *int32 `json:"desiredCapacity,omitempty"` - MaxSize int32 `json:"maxSize,omitempty"` - MinSize int32 `json:"minSize,omitempty"` - PlacementGroup string `json:"placementGroup,omitempty"` - Subnets []string `json:"subnets,omitempty"` - DefaultCoolDown metav1.Duration `json:"defaultCoolDown,omitempty"` - CapacityRebalance bool `json:"capacityRebalance,omitempty"` - - MixedInstancesPolicy *MixedInstancesPolicy `json:"mixedInstancesPolicy,omitempty"` - Status ASGStatus - Instances []infrav1.Instance `json:"instances,omitempty"` - CurrentlySuspendProcesses []string `json:"currentlySuspendProcesses,omitempty"` -} - -// ASGStatus is a status string returned by the autoscaling API. -type ASGStatus string - -var ( - // ASGStatusDeleteInProgress is the string representing an ASG that is currently deleting. - ASGStatusDeleteInProgress = ASGStatus("Delete in progress") -) - -// TaintEffect is the effect for a Kubernetes taint. -type TaintEffect string - -var ( - // TaintEffectNoSchedule is a taint that indicates that a pod shouldn't be scheduled on a node - // unless it can tolerate the taint. - TaintEffectNoSchedule = TaintEffect("no-schedule") - // TaintEffectNoExecute is a taint that indicates that a pod shouldn't be schedule on a node - // unless it can tolerate it. And if its already running on the node it will be evicted. - TaintEffectNoExecute = TaintEffect("no-execute") - // TaintEffectPreferNoSchedule is a taint that indicates that there is a "preference" that pods shouldn't - // be scheduled on a node unless it can tolerate the taint. the scheduler will try to avoid placing the pod - // but it may still run on the node if there is no other option. - TaintEffectPreferNoSchedule = TaintEffect("prefer-no-schedule") -) - -// Taint defines the specs for a Kubernetes taint. -type Taint struct { - // Effect specifies the effect for the taint - // +kubebuilder:validation:Required - // +kubebuilder:validation:Enum=no-schedule;no-execute;prefer-no-schedule - Effect TaintEffect `json:"effect"` - // Key is the key of the taint - // +kubebuilder:validation:Required - Key string `json:"key"` - // Value is the value of the taint - // +kubebuilder:validation:Required - Value string `json:"value"` -} - -// Equals is used to test if 2 taints are equal. -func (t *Taint) Equals(other *Taint) bool { - if t == nil || other == nil { - return t == other - } - - return t.Effect == other.Effect && - t.Key == other.Key && - t.Value == other.Value -} - -// Taints is an array of Taints. -type Taints []Taint - -// Contains checks for existence of a matching taint. -func (t *Taints) Contains(taint *Taint) bool { - for _, t := range *t { - if t.Equals(taint) { - return true - } - } - - return false -} - -// UpdateConfig is the configuration options for updating a nodegroup. Only one of MaxUnavailable -// and MaxUnavailablePercentage should be specified. -type UpdateConfig struct { - // MaxUnavailable is the maximum number of nodes unavailable at once during a version update. - // Nodes will be updated in parallel. The maximum number is 100. - // +optional - // +kubebuilder:validation:Maximum=100 - // +kubebuilder:validation:Minimum=1 - MaxUnavailable *int `json:"maxUnavailable,omitempty"` - - // MaxUnavailablePercentage is the maximum percentage of nodes unavailable during a version update. This - // percentage of nodes will be updated in parallel, up to 100 nodes at once. - // +optional - // +kubebuilder:validation:Maximum=100 - // +kubebuilder:validation:Minimum=1 - MaxUnavailablePercentage *int `json:"maxUnavailablePercentage,omitempty"` -} diff --git a/vendor/sigs.k8s.io/cluster-api-provider-aws/v2/exp/api/v1beta2/zz_generated.deepcopy.go b/vendor/sigs.k8s.io/cluster-api-provider-aws/v2/exp/api/v1beta2/zz_generated.deepcopy.go deleted file mode 100644 index daa47353..00000000 --- a/vendor/sigs.k8s.io/cluster-api-provider-aws/v2/exp/api/v1beta2/zz_generated.deepcopy.go +++ /dev/null @@ -1,989 +0,0 @@ -//go:build !ignore_autogenerated -// +build !ignore_autogenerated - -/* -Copyright The Kubernetes Authors. - -Licensed under the Apache License, Version 2.0 (the "License"); -you may not use this file except in compliance with the License. -You may obtain a copy of the License at - - http://www.apache.org/licenses/LICENSE-2.0 - -Unless required by applicable law or agreed to in writing, software -distributed under the License is distributed on an "AS IS" BASIS, -WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied. -See the License for the specific language governing permissions and -limitations under the License. -*/ - -// Code generated by controller-gen. DO NOT EDIT. - -package v1beta2 - -import ( - "k8s.io/apimachinery/pkg/runtime" - apiv1beta2 "sigs.k8s.io/cluster-api-provider-aws/v2/api/v1beta2" - "sigs.k8s.io/cluster-api/api/v1beta1" - "sigs.k8s.io/cluster-api/errors" -) - -// DeepCopyInto is an autogenerated deepcopy function, copying the receiver, writing into out. in must be non-nil. -func (in *AWSFargateProfile) DeepCopyInto(out *AWSFargateProfile) { - *out = *in - out.TypeMeta = in.TypeMeta - in.ObjectMeta.DeepCopyInto(&out.ObjectMeta) - in.Spec.DeepCopyInto(&out.Spec) - in.Status.DeepCopyInto(&out.Status) -} - -// DeepCopy is an autogenerated deepcopy function, copying the receiver, creating a new AWSFargateProfile. -func (in *AWSFargateProfile) DeepCopy() *AWSFargateProfile { - if in == nil { - return nil - } - out := new(AWSFargateProfile) - in.DeepCopyInto(out) - return out -} - -// DeepCopyObject is an autogenerated deepcopy function, copying the receiver, creating a new runtime.Object. -func (in *AWSFargateProfile) DeepCopyObject() runtime.Object { - if c := in.DeepCopy(); c != nil { - return c - } - return nil -} - -// DeepCopyInto is an autogenerated deepcopy function, copying the receiver, writing into out. in must be non-nil. -func (in *AWSFargateProfileList) DeepCopyInto(out *AWSFargateProfileList) { - *out = *in - out.TypeMeta = in.TypeMeta - in.ListMeta.DeepCopyInto(&out.ListMeta) - if in.Items != nil { - in, out := &in.Items, &out.Items - *out = make([]AWSFargateProfile, len(*in)) - for i := range *in { - (*in)[i].DeepCopyInto(&(*out)[i]) - } - } -} - -// DeepCopy is an autogenerated deepcopy function, copying the receiver, creating a new AWSFargateProfileList. -func (in *AWSFargateProfileList) DeepCopy() *AWSFargateProfileList { - if in == nil { - return nil - } - out := new(AWSFargateProfileList) - in.DeepCopyInto(out) - return out -} - -// DeepCopyObject is an autogenerated deepcopy function, copying the receiver, creating a new runtime.Object. -func (in *AWSFargateProfileList) DeepCopyObject() runtime.Object { - if c := in.DeepCopy(); c != nil { - return c - } - return nil -} - -// DeepCopyInto is an autogenerated deepcopy function, copying the receiver, writing into out. in must be non-nil. -func (in *AWSLaunchTemplate) DeepCopyInto(out *AWSLaunchTemplate) { - *out = *in - in.AMI.DeepCopyInto(&out.AMI) - if in.RootVolume != nil { - in, out := &in.RootVolume, &out.RootVolume - *out = new(apiv1beta2.Volume) - (*in).DeepCopyInto(*out) - } - if in.SSHKeyName != nil { - in, out := &in.SSHKeyName, &out.SSHKeyName - *out = new(string) - **out = **in - } - if in.VersionNumber != nil { - in, out := &in.VersionNumber, &out.VersionNumber - *out = new(int64) - **out = **in - } - if in.AdditionalSecurityGroups != nil { - in, out := &in.AdditionalSecurityGroups, &out.AdditionalSecurityGroups - *out = make([]apiv1beta2.AWSResourceReference, len(*in)) - for i := range *in { - (*in)[i].DeepCopyInto(&(*out)[i]) - } - } - if in.SpotMarketOptions != nil { - in, out := &in.SpotMarketOptions, &out.SpotMarketOptions - *out = new(apiv1beta2.SpotMarketOptions) - (*in).DeepCopyInto(*out) - } -} - -// DeepCopy is an autogenerated deepcopy function, copying the receiver, creating a new AWSLaunchTemplate. -func (in *AWSLaunchTemplate) DeepCopy() *AWSLaunchTemplate { - if in == nil { - return nil - } - out := new(AWSLaunchTemplate) - in.DeepCopyInto(out) - return out -} - -// DeepCopyInto is an autogenerated deepcopy function, copying the receiver, writing into out. in must be non-nil. -func (in *AWSMachinePool) DeepCopyInto(out *AWSMachinePool) { - *out = *in - out.TypeMeta = in.TypeMeta - in.ObjectMeta.DeepCopyInto(&out.ObjectMeta) - in.Spec.DeepCopyInto(&out.Spec) - in.Status.DeepCopyInto(&out.Status) -} - -// DeepCopy is an autogenerated deepcopy function, copying the receiver, creating a new AWSMachinePool. -func (in *AWSMachinePool) DeepCopy() *AWSMachinePool { - if in == nil { - return nil - } - out := new(AWSMachinePool) - in.DeepCopyInto(out) - return out -} - -// DeepCopyObject is an autogenerated deepcopy function, copying the receiver, creating a new runtime.Object. -func (in *AWSMachinePool) DeepCopyObject() runtime.Object { - if c := in.DeepCopy(); c != nil { - return c - } - return nil -} - -// DeepCopyInto is an autogenerated deepcopy function, copying the receiver, writing into out. in must be non-nil. -func (in *AWSMachinePoolInstanceStatus) DeepCopyInto(out *AWSMachinePoolInstanceStatus) { - *out = *in - if in.Version != nil { - in, out := &in.Version, &out.Version - *out = new(string) - **out = **in - } -} - -// DeepCopy is an autogenerated deepcopy function, copying the receiver, creating a new AWSMachinePoolInstanceStatus. -func (in *AWSMachinePoolInstanceStatus) DeepCopy() *AWSMachinePoolInstanceStatus { - if in == nil { - return nil - } - out := new(AWSMachinePoolInstanceStatus) - in.DeepCopyInto(out) - return out -} - -// DeepCopyInto is an autogenerated deepcopy function, copying the receiver, writing into out. in must be non-nil. -func (in *AWSMachinePoolList) DeepCopyInto(out *AWSMachinePoolList) { - *out = *in - out.TypeMeta = in.TypeMeta - in.ListMeta.DeepCopyInto(&out.ListMeta) - if in.Items != nil { - in, out := &in.Items, &out.Items - *out = make([]AWSMachinePool, len(*in)) - for i := range *in { - (*in)[i].DeepCopyInto(&(*out)[i]) - } - } -} - -// DeepCopy is an autogenerated deepcopy function, copying the receiver, creating a new AWSMachinePoolList. -func (in *AWSMachinePoolList) DeepCopy() *AWSMachinePoolList { - if in == nil { - return nil - } - out := new(AWSMachinePoolList) - in.DeepCopyInto(out) - return out -} - -// DeepCopyObject is an autogenerated deepcopy function, copying the receiver, creating a new runtime.Object. -func (in *AWSMachinePoolList) DeepCopyObject() runtime.Object { - if c := in.DeepCopy(); c != nil { - return c - } - return nil -} - -// DeepCopyInto is an autogenerated deepcopy function, copying the receiver, writing into out. in must be non-nil. -func (in *AWSMachinePoolSpec) DeepCopyInto(out *AWSMachinePoolSpec) { - *out = *in - if in.AvailabilityZones != nil { - in, out := &in.AvailabilityZones, &out.AvailabilityZones - *out = make([]string, len(*in)) - copy(*out, *in) - } - if in.Subnets != nil { - in, out := &in.Subnets, &out.Subnets - *out = make([]apiv1beta2.AWSResourceReference, len(*in)) - for i := range *in { - (*in)[i].DeepCopyInto(&(*out)[i]) - } - } - if in.AdditionalTags != nil { - in, out := &in.AdditionalTags, &out.AdditionalTags - *out = make(apiv1beta2.Tags, len(*in)) - for key, val := range *in { - (*out)[key] = val - } - } - in.AWSLaunchTemplate.DeepCopyInto(&out.AWSLaunchTemplate) - if in.MixedInstancesPolicy != nil { - in, out := &in.MixedInstancesPolicy, &out.MixedInstancesPolicy - *out = new(MixedInstancesPolicy) - (*in).DeepCopyInto(*out) - } - if in.ProviderIDList != nil { - in, out := &in.ProviderIDList, &out.ProviderIDList - *out = make([]string, len(*in)) - copy(*out, *in) - } - out.DefaultCoolDown = in.DefaultCoolDown - if in.RefreshPreferences != nil { - in, out := &in.RefreshPreferences, &out.RefreshPreferences - *out = new(RefreshPreferences) - (*in).DeepCopyInto(*out) - } - if in.SuspendProcesses != nil { - in, out := &in.SuspendProcesses, &out.SuspendProcesses - *out = new(SuspendProcessesTypes) - (*in).DeepCopyInto(*out) - } -} - -// DeepCopy is an autogenerated deepcopy function, copying the receiver, creating a new AWSMachinePoolSpec. -func (in *AWSMachinePoolSpec) DeepCopy() *AWSMachinePoolSpec { - if in == nil { - return nil - } - out := new(AWSMachinePoolSpec) - in.DeepCopyInto(out) - return out -} - -// DeepCopyInto is an autogenerated deepcopy function, copying the receiver, writing into out. in must be non-nil. -func (in *AWSMachinePoolStatus) DeepCopyInto(out *AWSMachinePoolStatus) { - *out = *in - if in.Conditions != nil { - in, out := &in.Conditions, &out.Conditions - *out = make(v1beta1.Conditions, len(*in)) - for i := range *in { - (*in)[i].DeepCopyInto(&(*out)[i]) - } - } - if in.Instances != nil { - in, out := &in.Instances, &out.Instances - *out = make([]AWSMachinePoolInstanceStatus, len(*in)) - for i := range *in { - (*in)[i].DeepCopyInto(&(*out)[i]) - } - } - if in.LaunchTemplateVersion != nil { - in, out := &in.LaunchTemplateVersion, &out.LaunchTemplateVersion - *out = new(string) - **out = **in - } - if in.FailureReason != nil { - in, out := &in.FailureReason, &out.FailureReason - *out = new(errors.MachineStatusError) - **out = **in - } - if in.FailureMessage != nil { - in, out := &in.FailureMessage, &out.FailureMessage - *out = new(string) - **out = **in - } - if in.ASGStatus != nil { - in, out := &in.ASGStatus, &out.ASGStatus - *out = new(ASGStatus) - **out = **in - } -} - -// DeepCopy is an autogenerated deepcopy function, copying the receiver, creating a new AWSMachinePoolStatus. -func (in *AWSMachinePoolStatus) DeepCopy() *AWSMachinePoolStatus { - if in == nil { - return nil - } - out := new(AWSMachinePoolStatus) - in.DeepCopyInto(out) - return out -} - -// DeepCopyInto is an autogenerated deepcopy function, copying the receiver, writing into out. in must be non-nil. -func (in *AWSManagedMachinePool) DeepCopyInto(out *AWSManagedMachinePool) { - *out = *in - out.TypeMeta = in.TypeMeta - in.ObjectMeta.DeepCopyInto(&out.ObjectMeta) - in.Spec.DeepCopyInto(&out.Spec) - in.Status.DeepCopyInto(&out.Status) -} - -// DeepCopy is an autogenerated deepcopy function, copying the receiver, creating a new AWSManagedMachinePool. -func (in *AWSManagedMachinePool) DeepCopy() *AWSManagedMachinePool { - if in == nil { - return nil - } - out := new(AWSManagedMachinePool) - in.DeepCopyInto(out) - return out -} - -// DeepCopyObject is an autogenerated deepcopy function, copying the receiver, creating a new runtime.Object. -func (in *AWSManagedMachinePool) DeepCopyObject() runtime.Object { - if c := in.DeepCopy(); c != nil { - return c - } - return nil -} - -// DeepCopyInto is an autogenerated deepcopy function, copying the receiver, writing into out. in must be non-nil. -func (in *AWSManagedMachinePoolList) DeepCopyInto(out *AWSManagedMachinePoolList) { - *out = *in - out.TypeMeta = in.TypeMeta - in.ListMeta.DeepCopyInto(&out.ListMeta) - if in.Items != nil { - in, out := &in.Items, &out.Items - *out = make([]AWSManagedMachinePool, len(*in)) - for i := range *in { - (*in)[i].DeepCopyInto(&(*out)[i]) - } - } -} - -// DeepCopy is an autogenerated deepcopy function, copying the receiver, creating a new AWSManagedMachinePoolList. -func (in *AWSManagedMachinePoolList) DeepCopy() *AWSManagedMachinePoolList { - if in == nil { - return nil - } - out := new(AWSManagedMachinePoolList) - in.DeepCopyInto(out) - return out -} - -// DeepCopyObject is an autogenerated deepcopy function, copying the receiver, creating a new runtime.Object. -func (in *AWSManagedMachinePoolList) DeepCopyObject() runtime.Object { - if c := in.DeepCopy(); c != nil { - return c - } - return nil -} - -// DeepCopyInto is an autogenerated deepcopy function, copying the receiver, writing into out. in must be non-nil. -func (in *AWSManagedMachinePoolSpec) DeepCopyInto(out *AWSManagedMachinePoolSpec) { - *out = *in - if in.AvailabilityZones != nil { - in, out := &in.AvailabilityZones, &out.AvailabilityZones - *out = make([]string, len(*in)) - copy(*out, *in) - } - if in.SubnetIDs != nil { - in, out := &in.SubnetIDs, &out.SubnetIDs - *out = make([]string, len(*in)) - copy(*out, *in) - } - if in.AdditionalTags != nil { - in, out := &in.AdditionalTags, &out.AdditionalTags - *out = make(apiv1beta2.Tags, len(*in)) - for key, val := range *in { - (*out)[key] = val - } - } - if in.RoleAdditionalPolicies != nil { - in, out := &in.RoleAdditionalPolicies, &out.RoleAdditionalPolicies - *out = make([]string, len(*in)) - copy(*out, *in) - } - if in.AMIVersion != nil { - in, out := &in.AMIVersion, &out.AMIVersion - *out = new(string) - **out = **in - } - if in.AMIType != nil { - in, out := &in.AMIType, &out.AMIType - *out = new(ManagedMachineAMIType) - **out = **in - } - if in.Labels != nil { - in, out := &in.Labels, &out.Labels - *out = make(map[string]string, len(*in)) - for key, val := range *in { - (*out)[key] = val - } - } - if in.Taints != nil { - in, out := &in.Taints, &out.Taints - *out = make(Taints, len(*in)) - copy(*out, *in) - } - if in.DiskSize != nil { - in, out := &in.DiskSize, &out.DiskSize - *out = new(int32) - **out = **in - } - if in.InstanceType != nil { - in, out := &in.InstanceType, &out.InstanceType - *out = new(string) - **out = **in - } - if in.Scaling != nil { - in, out := &in.Scaling, &out.Scaling - *out = new(ManagedMachinePoolScaling) - (*in).DeepCopyInto(*out) - } - if in.RemoteAccess != nil { - in, out := &in.RemoteAccess, &out.RemoteAccess - *out = new(ManagedRemoteAccess) - (*in).DeepCopyInto(*out) - } - if in.ProviderIDList != nil { - in, out := &in.ProviderIDList, &out.ProviderIDList - *out = make([]string, len(*in)) - copy(*out, *in) - } - if in.CapacityType != nil { - in, out := &in.CapacityType, &out.CapacityType - *out = new(ManagedMachinePoolCapacityType) - **out = **in - } - if in.UpdateConfig != nil { - in, out := &in.UpdateConfig, &out.UpdateConfig - *out = new(UpdateConfig) - (*in).DeepCopyInto(*out) - } - if in.AWSLaunchTemplate != nil { - in, out := &in.AWSLaunchTemplate, &out.AWSLaunchTemplate - *out = new(AWSLaunchTemplate) - (*in).DeepCopyInto(*out) - } -} - -// DeepCopy is an autogenerated deepcopy function, copying the receiver, creating a new AWSManagedMachinePoolSpec. -func (in *AWSManagedMachinePoolSpec) DeepCopy() *AWSManagedMachinePoolSpec { - if in == nil { - return nil - } - out := new(AWSManagedMachinePoolSpec) - in.DeepCopyInto(out) - return out -} - -// DeepCopyInto is an autogenerated deepcopy function, copying the receiver, writing into out. in must be non-nil. -func (in *AWSManagedMachinePoolStatus) DeepCopyInto(out *AWSManagedMachinePoolStatus) { - *out = *in - if in.LaunchTemplateID != nil { - in, out := &in.LaunchTemplateID, &out.LaunchTemplateID - *out = new(string) - **out = **in - } - if in.LaunchTemplateVersion != nil { - in, out := &in.LaunchTemplateVersion, &out.LaunchTemplateVersion - *out = new(string) - **out = **in - } - if in.FailureReason != nil { - in, out := &in.FailureReason, &out.FailureReason - *out = new(errors.MachineStatusError) - **out = **in - } - if in.FailureMessage != nil { - in, out := &in.FailureMessage, &out.FailureMessage - *out = new(string) - **out = **in - } - if in.Conditions != nil { - in, out := &in.Conditions, &out.Conditions - *out = make(v1beta1.Conditions, len(*in)) - for i := range *in { - (*in)[i].DeepCopyInto(&(*out)[i]) - } - } -} - -// DeepCopy is an autogenerated deepcopy function, copying the receiver, creating a new AWSManagedMachinePoolStatus. -func (in *AWSManagedMachinePoolStatus) DeepCopy() *AWSManagedMachinePoolStatus { - if in == nil { - return nil - } - out := new(AWSManagedMachinePoolStatus) - in.DeepCopyInto(out) - return out -} - -// DeepCopyInto is an autogenerated deepcopy function, copying the receiver, writing into out. in must be non-nil. -func (in *AutoScalingGroup) DeepCopyInto(out *AutoScalingGroup) { - *out = *in - if in.Tags != nil { - in, out := &in.Tags, &out.Tags - *out = make(apiv1beta2.Tags, len(*in)) - for key, val := range *in { - (*out)[key] = val - } - } - if in.DesiredCapacity != nil { - in, out := &in.DesiredCapacity, &out.DesiredCapacity - *out = new(int32) - **out = **in - } - if in.Subnets != nil { - in, out := &in.Subnets, &out.Subnets - *out = make([]string, len(*in)) - copy(*out, *in) - } - out.DefaultCoolDown = in.DefaultCoolDown - if in.MixedInstancesPolicy != nil { - in, out := &in.MixedInstancesPolicy, &out.MixedInstancesPolicy - *out = new(MixedInstancesPolicy) - (*in).DeepCopyInto(*out) - } - if in.Instances != nil { - in, out := &in.Instances, &out.Instances - *out = make([]apiv1beta2.Instance, len(*in)) - for i := range *in { - (*in)[i].DeepCopyInto(&(*out)[i]) - } - } - if in.CurrentlySuspendProcesses != nil { - in, out := &in.CurrentlySuspendProcesses, &out.CurrentlySuspendProcesses - *out = make([]string, len(*in)) - copy(*out, *in) - } -} - -// DeepCopy is an autogenerated deepcopy function, copying the receiver, creating a new AutoScalingGroup. -func (in *AutoScalingGroup) DeepCopy() *AutoScalingGroup { - if in == nil { - return nil - } - out := new(AutoScalingGroup) - in.DeepCopyInto(out) - return out -} - -// DeepCopyInto is an autogenerated deepcopy function, copying the receiver, writing into out. in must be non-nil. -func (in *BlockDeviceMapping) DeepCopyInto(out *BlockDeviceMapping) { - *out = *in - out.Ebs = in.Ebs -} - -// DeepCopy is an autogenerated deepcopy function, copying the receiver, creating a new BlockDeviceMapping. -func (in *BlockDeviceMapping) DeepCopy() *BlockDeviceMapping { - if in == nil { - return nil - } - out := new(BlockDeviceMapping) - in.DeepCopyInto(out) - return out -} - -// DeepCopyInto is an autogenerated deepcopy function, copying the receiver, writing into out. in must be non-nil. -func (in *EBS) DeepCopyInto(out *EBS) { - *out = *in -} - -// DeepCopy is an autogenerated deepcopy function, copying the receiver, creating a new EBS. -func (in *EBS) DeepCopy() *EBS { - if in == nil { - return nil - } - out := new(EBS) - in.DeepCopyInto(out) - return out -} - -// DeepCopyInto is an autogenerated deepcopy function, copying the receiver, writing into out. in must be non-nil. -func (in *FargateProfileSpec) DeepCopyInto(out *FargateProfileSpec) { - *out = *in - if in.SubnetIDs != nil { - in, out := &in.SubnetIDs, &out.SubnetIDs - *out = make([]string, len(*in)) - copy(*out, *in) - } - if in.AdditionalTags != nil { - in, out := &in.AdditionalTags, &out.AdditionalTags - *out = make(apiv1beta2.Tags, len(*in)) - for key, val := range *in { - (*out)[key] = val - } - } - if in.Selectors != nil { - in, out := &in.Selectors, &out.Selectors - *out = make([]FargateSelector, len(*in)) - for i := range *in { - (*in)[i].DeepCopyInto(&(*out)[i]) - } - } -} - -// DeepCopy is an autogenerated deepcopy function, copying the receiver, creating a new FargateProfileSpec. -func (in *FargateProfileSpec) DeepCopy() *FargateProfileSpec { - if in == nil { - return nil - } - out := new(FargateProfileSpec) - in.DeepCopyInto(out) - return out -} - -// DeepCopyInto is an autogenerated deepcopy function, copying the receiver, writing into out. in must be non-nil. -func (in *FargateProfileStatus) DeepCopyInto(out *FargateProfileStatus) { - *out = *in - if in.FailureReason != nil { - in, out := &in.FailureReason, &out.FailureReason - *out = new(errors.MachineStatusError) - **out = **in - } - if in.FailureMessage != nil { - in, out := &in.FailureMessage, &out.FailureMessage - *out = new(string) - **out = **in - } - if in.Conditions != nil { - in, out := &in.Conditions, &out.Conditions - *out = make(v1beta1.Conditions, len(*in)) - for i := range *in { - (*in)[i].DeepCopyInto(&(*out)[i]) - } - } -} - -// DeepCopy is an autogenerated deepcopy function, copying the receiver, creating a new FargateProfileStatus. -func (in *FargateProfileStatus) DeepCopy() *FargateProfileStatus { - if in == nil { - return nil - } - out := new(FargateProfileStatus) - in.DeepCopyInto(out) - return out -} - -// DeepCopyInto is an autogenerated deepcopy function, copying the receiver, writing into out. in must be non-nil. -func (in *FargateSelector) DeepCopyInto(out *FargateSelector) { - *out = *in - if in.Labels != nil { - in, out := &in.Labels, &out.Labels - *out = make(map[string]string, len(*in)) - for key, val := range *in { - (*out)[key] = val - } - } -} - -// DeepCopy is an autogenerated deepcopy function, copying the receiver, creating a new FargateSelector. -func (in *FargateSelector) DeepCopy() *FargateSelector { - if in == nil { - return nil - } - out := new(FargateSelector) - in.DeepCopyInto(out) - return out -} - -// DeepCopyInto is an autogenerated deepcopy function, copying the receiver, writing into out. in must be non-nil. -func (in *InstancesDistribution) DeepCopyInto(out *InstancesDistribution) { - *out = *in - if in.OnDemandBaseCapacity != nil { - in, out := &in.OnDemandBaseCapacity, &out.OnDemandBaseCapacity - *out = new(int64) - **out = **in - } - if in.OnDemandPercentageAboveBaseCapacity != nil { - in, out := &in.OnDemandPercentageAboveBaseCapacity, &out.OnDemandPercentageAboveBaseCapacity - *out = new(int64) - **out = **in - } -} - -// DeepCopy is an autogenerated deepcopy function, copying the receiver, creating a new InstancesDistribution. -func (in *InstancesDistribution) DeepCopy() *InstancesDistribution { - if in == nil { - return nil - } - out := new(InstancesDistribution) - in.DeepCopyInto(out) - return out -} - -// DeepCopyInto is an autogenerated deepcopy function, copying the receiver, writing into out. in must be non-nil. -func (in *ManagedMachinePoolScaling) DeepCopyInto(out *ManagedMachinePoolScaling) { - *out = *in - if in.MinSize != nil { - in, out := &in.MinSize, &out.MinSize - *out = new(int32) - **out = **in - } - if in.MaxSize != nil { - in, out := &in.MaxSize, &out.MaxSize - *out = new(int32) - **out = **in - } -} - -// DeepCopy is an autogenerated deepcopy function, copying the receiver, creating a new ManagedMachinePoolScaling. -func (in *ManagedMachinePoolScaling) DeepCopy() *ManagedMachinePoolScaling { - if in == nil { - return nil - } - out := new(ManagedMachinePoolScaling) - in.DeepCopyInto(out) - return out -} - -// DeepCopyInto is an autogenerated deepcopy function, copying the receiver, writing into out. in must be non-nil. -func (in *ManagedRemoteAccess) DeepCopyInto(out *ManagedRemoteAccess) { - *out = *in - if in.SSHKeyName != nil { - in, out := &in.SSHKeyName, &out.SSHKeyName - *out = new(string) - **out = **in - } - if in.SourceSecurityGroups != nil { - in, out := &in.SourceSecurityGroups, &out.SourceSecurityGroups - *out = make([]string, len(*in)) - copy(*out, *in) - } -} - -// DeepCopy is an autogenerated deepcopy function, copying the receiver, creating a new ManagedRemoteAccess. -func (in *ManagedRemoteAccess) DeepCopy() *ManagedRemoteAccess { - if in == nil { - return nil - } - out := new(ManagedRemoteAccess) - in.DeepCopyInto(out) - return out -} - -// DeepCopyInto is an autogenerated deepcopy function, copying the receiver, writing into out. in must be non-nil. -func (in *MixedInstancesPolicy) DeepCopyInto(out *MixedInstancesPolicy) { - *out = *in - if in.InstancesDistribution != nil { - in, out := &in.InstancesDistribution, &out.InstancesDistribution - *out = new(InstancesDistribution) - (*in).DeepCopyInto(*out) - } - if in.Overrides != nil { - in, out := &in.Overrides, &out.Overrides - *out = make([]Overrides, len(*in)) - copy(*out, *in) - } -} - -// DeepCopy is an autogenerated deepcopy function, copying the receiver, creating a new MixedInstancesPolicy. -func (in *MixedInstancesPolicy) DeepCopy() *MixedInstancesPolicy { - if in == nil { - return nil - } - out := new(MixedInstancesPolicy) - in.DeepCopyInto(out) - return out -} - -// DeepCopyInto is an autogenerated deepcopy function, copying the receiver, writing into out. in must be non-nil. -func (in *Overrides) DeepCopyInto(out *Overrides) { - *out = *in -} - -// DeepCopy is an autogenerated deepcopy function, copying the receiver, creating a new Overrides. -func (in *Overrides) DeepCopy() *Overrides { - if in == nil { - return nil - } - out := new(Overrides) - in.DeepCopyInto(out) - return out -} - -// DeepCopyInto is an autogenerated deepcopy function, copying the receiver, writing into out. in must be non-nil. -func (in *Processes) DeepCopyInto(out *Processes) { - *out = *in - if in.Launch != nil { - in, out := &in.Launch, &out.Launch - *out = new(bool) - **out = **in - } - if in.Terminate != nil { - in, out := &in.Terminate, &out.Terminate - *out = new(bool) - **out = **in - } - if in.AddToLoadBalancer != nil { - in, out := &in.AddToLoadBalancer, &out.AddToLoadBalancer - *out = new(bool) - **out = **in - } - if in.AlarmNotification != nil { - in, out := &in.AlarmNotification, &out.AlarmNotification - *out = new(bool) - **out = **in - } - if in.AZRebalance != nil { - in, out := &in.AZRebalance, &out.AZRebalance - *out = new(bool) - **out = **in - } - if in.HealthCheck != nil { - in, out := &in.HealthCheck, &out.HealthCheck - *out = new(bool) - **out = **in - } - if in.InstanceRefresh != nil { - in, out := &in.InstanceRefresh, &out.InstanceRefresh - *out = new(bool) - **out = **in - } - if in.ReplaceUnhealthy != nil { - in, out := &in.ReplaceUnhealthy, &out.ReplaceUnhealthy - *out = new(bool) - **out = **in - } - if in.ScheduledActions != nil { - in, out := &in.ScheduledActions, &out.ScheduledActions - *out = new(bool) - **out = **in - } -} - -// DeepCopy is an autogenerated deepcopy function, copying the receiver, creating a new Processes. -func (in *Processes) DeepCopy() *Processes { - if in == nil { - return nil - } - out := new(Processes) - in.DeepCopyInto(out) - return out -} - -// DeepCopyInto is an autogenerated deepcopy function, copying the receiver, writing into out. in must be non-nil. -func (in *RefreshPreferences) DeepCopyInto(out *RefreshPreferences) { - *out = *in - if in.Strategy != nil { - in, out := &in.Strategy, &out.Strategy - *out = new(string) - **out = **in - } - if in.InstanceWarmup != nil { - in, out := &in.InstanceWarmup, &out.InstanceWarmup - *out = new(int64) - **out = **in - } - if in.MinHealthyPercentage != nil { - in, out := &in.MinHealthyPercentage, &out.MinHealthyPercentage - *out = new(int64) - **out = **in - } -} - -// DeepCopy is an autogenerated deepcopy function, copying the receiver, creating a new RefreshPreferences. -func (in *RefreshPreferences) DeepCopy() *RefreshPreferences { - if in == nil { - return nil - } - out := new(RefreshPreferences) - in.DeepCopyInto(out) - return out -} - -// DeepCopyInto is an autogenerated deepcopy function, copying the receiver, writing into out. in must be non-nil. -func (in *SuspendProcessesTypes) DeepCopyInto(out *SuspendProcessesTypes) { - *out = *in - if in.Processes != nil { - in, out := &in.Processes, &out.Processes - *out = new(Processes) - (*in).DeepCopyInto(*out) - } -} - -// DeepCopy is an autogenerated deepcopy function, copying the receiver, creating a new SuspendProcessesTypes. -func (in *SuspendProcessesTypes) DeepCopy() *SuspendProcessesTypes { - if in == nil { - return nil - } - out := new(SuspendProcessesTypes) - in.DeepCopyInto(out) - return out -} - -// DeepCopyInto is an autogenerated deepcopy function, copying the receiver, writing into out. in must be non-nil. -func (in Tags) DeepCopyInto(out *Tags) { - { - in := &in - *out = make(Tags, len(*in)) - for key, val := range *in { - (*out)[key] = val - } - } -} - -// DeepCopy is an autogenerated deepcopy function, copying the receiver, creating a new Tags. -func (in Tags) DeepCopy() Tags { - if in == nil { - return nil - } - out := new(Tags) - in.DeepCopyInto(out) - return *out -} - -// DeepCopyInto is an autogenerated deepcopy function, copying the receiver, writing into out. in must be non-nil. -func (in *Taint) DeepCopyInto(out *Taint) { - *out = *in -} - -// DeepCopy is an autogenerated deepcopy function, copying the receiver, creating a new Taint. -func (in *Taint) DeepCopy() *Taint { - if in == nil { - return nil - } - out := new(Taint) - in.DeepCopyInto(out) - return out -} - -// DeepCopyInto is an autogenerated deepcopy function, copying the receiver, writing into out. in must be non-nil. -func (in Taints) DeepCopyInto(out *Taints) { - { - in := &in - *out = make(Taints, len(*in)) - copy(*out, *in) - } -} - -// DeepCopy is an autogenerated deepcopy function, copying the receiver, creating a new Taints. -func (in Taints) DeepCopy() Taints { - if in == nil { - return nil - } - out := new(Taints) - in.DeepCopyInto(out) - return *out -} - -// DeepCopyInto is an autogenerated deepcopy function, copying the receiver, writing into out. in must be non-nil. -func (in *UpdateConfig) DeepCopyInto(out *UpdateConfig) { - *out = *in - if in.MaxUnavailable != nil { - in, out := &in.MaxUnavailable, &out.MaxUnavailable - *out = new(int) - **out = **in - } - if in.MaxUnavailablePercentage != nil { - in, out := &in.MaxUnavailablePercentage, &out.MaxUnavailablePercentage - *out = new(int) - **out = **in - } -} - -// DeepCopy is an autogenerated deepcopy function, copying the receiver, creating a new UpdateConfig. -func (in *UpdateConfig) DeepCopy() *UpdateConfig { - if in == nil { - return nil - } - out := new(UpdateConfig) - in.DeepCopyInto(out) - return out -} diff --git a/vendor/sigs.k8s.io/cluster-api-provider-aws/v2/exp/api/v1beta2/zz_generated.defaults.go b/vendor/sigs.k8s.io/cluster-api-provider-aws/v2/exp/api/v1beta2/zz_generated.defaults.go deleted file mode 100644 index b2802005..00000000 --- a/vendor/sigs.k8s.io/cluster-api-provider-aws/v2/exp/api/v1beta2/zz_generated.defaults.go +++ /dev/null @@ -1,33 +0,0 @@ -//go:build !ignore_autogenerated -// +build !ignore_autogenerated - -/* -Copyright The Kubernetes Authors. - -Licensed under the Apache License, Version 2.0 (the "License"); -you may not use this file except in compliance with the License. -You may obtain a copy of the License at - - http://www.apache.org/licenses/LICENSE-2.0 - -Unless required by applicable law or agreed to in writing, software -distributed under the License is distributed on an "AS IS" BASIS, -WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied. -See the License for the specific language governing permissions and -limitations under the License. -*/ - -// Code generated by defaulter-gen. DO NOT EDIT. - -package v1beta2 - -import ( - runtime "k8s.io/apimachinery/pkg/runtime" -) - -// RegisterDefaults adds defaulters functions to the given scheme. -// Public to allow building arbitrary schemes. -// All generated defaulters are covering - they call all nested defaulters. -func RegisterDefaults(scheme *runtime.Scheme) error { - return nil -}