-
Notifications
You must be signed in to change notification settings - Fork 6
Commit
This commit does not belong to any branch on this repository, and may belong to a fork outside of the repository.
- Loading branch information
Showing
1 changed file
with
27 additions
and
0 deletions.
There are no files selected for viewing
This file contains bidirectional Unicode text that may be interpreted or compiled differently than what appears below. To review, open the file in an editor that reveals hidden Unicode characters.
Learn more about bidirectional Unicode characters
Original file line number | Diff line number | Diff line change |
---|---|---|
@@ -0,0 +1,27 @@ | ||
from Bio import SeqIO | ||
from pathlib import Path | ||
import os | ||
import pytest | ||
|
||
from arctic3d.modules.sequence import cycle_alignment | ||
|
||
from . import golden_data | ||
|
||
|
||
@pytest.fixture | ||
def inp_fasta(): | ||
return Path(golden_data, "1rypB_r_b.fasta") | ||
|
||
|
||
def test_cycle_alignment(inp_fasta): | ||
"""Test cycle_alignment function.""" | ||
list_of_seqs = SeqIO.parse(open(inp_fasta), "fasta") | ||
ref_seq = "MTDRYSFSLTTFSPSGKLGQIDYALTAVKQGVTSLGIKATNGVVIATEKKSSSPLAMSET" | ||
max_id_chain, max_id = cycle_alignment(list_of_seqs, ref_seq, "aln") | ||
aln_content = open("aln", "r").read() | ||
assert max_id_chain == "B" | ||
assert max_id == 1.0 | ||
first_line = aln_content.split(os.linesep)[0] | ||
exp_first_line = f"target 0 {ref_seq}" | ||
assert first_line == exp_first_line | ||
os.remove("aln") |